[ { "title": "Two genes, atpC1 and atpC2, for the gamma subunit of Arabidopsis thaliana chloroplast ATP synthase.", "journal": "J. Biol. Chem.", "date": "1991", "authors": "Inohara N, Iwamoto A, Moriyama Y, Shimomura S, Maeda M, Futai M", "reference": { "type": "PubMed", "id": "1826905", "url": "https://pubmed.ncbi.nlm.nih.gov/1826905" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q01909-1", "protein_name": "ATP synthase gamma chain 2, chloroplastic", "gene_name": "ATPC2", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q01908-1", "protein_name": "ATP synthase gamma chain 1, chloroplastic", "gene_name": "ATPC1", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "Q01909", "url": "https://www.uniprot.org/uniprotkb/Q01909" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.1826905", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The nad4L gene is encoded between exon c of nad5 and orf25 in the Arabidopsis mitochondrial genome.", "journal": "Mol. Gen. Genet.", "date": "1992", "authors": "Brandt P, S\u00fcnkel S, Unseld M, Brennicke A, Knoop V", "reference": { "type": "PubMed", "id": "1494348", "url": "https://pubmed.ncbi.nlm.nih.gov/1494348" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q04614-1", "protein_name": "NADH-ubiquinone oxidoreductase chain 4L", "gene_name": "ND4L", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q04613-1", "protein_name": "ATP synthase protein MI25", "gene_name": "ATP4", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "Q04614", "url": "https://www.uniprot.org/uniprotkb/Q04614" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.1494348", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Unexpected complexity of poly(A)-binding protein gene families in flowering plants: three conserved lineages that are at least 200 million years old and possible auto- and cross-regulation.", "journal": "Genetics", "date": "2003", "authors": "Belostotsky Dmitry A", "reference": { "type": "PubMed", "id": "12586718", "url": "https://pubmed.ncbi.nlm.nih.gov/12586718" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q05196-1", "protein_name": "Polyadenylate-binding protein 5", "gene_name": "PAB5", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "F4HT49-1", "protein_name": "Polyadenylate-binding protein 1", "gene_name": "PAB1", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "O22173-1", "protein_name": "Polyadenylate-binding protein 4", "gene_name": "PAB4", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9ZQA8-1", "protein_name": "Polyadenylate-binding protein 7", "gene_name": "PAB7", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9FXA2-1", "protein_name": "Polyadenylate-binding protein 8", "gene_name": "PAB8", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "O04319-1", "protein_name": "Polyadenylate-binding protein 6", "gene_name": "PAB6", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "O64380-1", "protein_name": "Polyadenylate-binding protein 3", "gene_name": "PAB3", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "P42731-1", "protein_name": "Polyadenylate-binding protein 2", "gene_name": "PAB2", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "Q05196", "url": "https://www.uniprot.org/uniprotkb/Q05196" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.12586718", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 8 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Differential organ-specific expression of three poly(A)-binding-protein genes from Arabidopsis thaliana.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1993-07-15", "authors": "Belostotsky D A, Meagher R B", "reference": { "type": "PubMed", "id": "8341686", "url": "https://pubmed.ncbi.nlm.nih.gov/8341686" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q05196-1", "protein_name": "Polyadenylate-binding protein 5", "gene_name": "PAB5", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "F4HT49-1", "protein_name": "Polyadenylate-binding protein 1", "gene_name": "PAB1", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "O64380-1", "protein_name": "Polyadenylate-binding protein 3", "gene_name": "PAB3", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "Q05196", "url": "https://www.uniprot.org/uniprotkb/Q05196" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.8341686", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "A pollen-, ovule-, and early embryo-specific poly(A) binding protein from Arabidopsis complements essential functions in yeast.", "journal": "The Plant cell", "date": "1996-08", "authors": "Belostotsky D A, Meagher R B", "reference": { "type": "PubMed", "id": "8776896", "url": "https://pubmed.ncbi.nlm.nih.gov/8776896" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q05196-1", "protein_name": "Polyadenylate-binding protein 5", "gene_name": "PAB5", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "Q05196", "url": "https://www.uniprot.org/uniprotkb/Q05196" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.8776896", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Isolating the Arabidopsis thaliana genes for de novo purine synthesis by suppression of Escherichia coli mutants. I. 5'-Phosphoribosyl-5-aminoimidazole synthetase.", "journal": "Plant Physiol.", "date": "1993", "authors": "Senecoff J F, Meagher R B", "reference": { "type": "PubMed", "id": "8108507", "url": "https://pubmed.ncbi.nlm.nih.gov/8108507" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q05728-1", "protein_name": "Phosphoribosylformylglycinamidine cyclo-ligase, chloroplastic", "gene_name": "PUR5", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "Q05728", "url": "https://www.uniprot.org/uniprotkb/Q05728" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.8108507", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Ethylene and auxin control the Arabidopsis response to decreased light intensity.", "journal": "Plant Physiol.", "date": "2003", "authors": "Vandenbussche Filip, Vriezen Willem H, Smalle Jan, Laarhoven Lucas J J, Harren Frans J M, Van Der Straeten Dominique", "reference": { "type": "PubMed", "id": "12972669", "url": "https://pubmed.ncbi.nlm.nih.gov/12972669" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q06588-1", "protein_name": "1-aminocyclopropane-1-carboxylate oxidase 4", "gene_name": "ACO4", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9ZUN4-1", "protein_name": "1-aminocyclopropane-1-carboxylate oxidase 1", "gene_name": "ACO1", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9LSW6-1", "protein_name": "1-aminocyclopropane-1-carboxylate oxidase homolog 10", "gene_name": "MWF20.16", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "P93824-1", "protein_name": "1-aminocyclopropane-1-carboxylate oxidase homolog 6", "gene_name": "F19P19.22", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q41931-1", "protein_name": "1-aminocyclopropane-1-carboxylate oxidase 2", "gene_name": "ACO2", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "Q06588", "url": "https://www.uniprot.org/uniprotkb/Q06588" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.12972669", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 5 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Transcriptional profiling by cDNA-AFLP and microarray analysis reveals novel insights into the early response to ethylene in Arabidopsis.", "journal": "Plant J.", "date": "2004", "authors": "De Paepe Annelies, Vuylsteke Marnik, Van Hummelen Paul, Zabeau Marc, Van Der Straeten Dominique", "reference": { "type": "PubMed", "id": "15272873", "url": "https://pubmed.ncbi.nlm.nih.gov/15272873" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q06588-1", "protein_name": "1-aminocyclopropane-1-carboxylate oxidase 4", "gene_name": "ACO4", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9ZUN4-1", "protein_name": "1-aminocyclopropane-1-carboxylate oxidase 1", "gene_name": "ACO1", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9LSW6-1", "protein_name": "1-aminocyclopropane-1-carboxylate oxidase homolog 10", "gene_name": "MWF20.16", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9S814-1", "protein_name": "Ethylene-insensitive protein 2", "gene_name": "EIN2", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q41931-1", "protein_name": "1-aminocyclopropane-1-carboxylate oxidase 2", "gene_name": "ACO2", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "Q06588", "url": "https://www.uniprot.org/uniprotkb/Q06588" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.15272873", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 5 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Saturated very-long-chain fatty acids promote cotton fiber and Arabidopsis cell elongation by activating ethylene biosynthesis.", "journal": "The Plant cell", "date": "2007-11", "authors": "Qin Yong-Mei, Hu Chun-Yang, Pang Yu, Kastaniotis Alexander J, Hiltunen J Kalervo, Zhu Yu-Xian", "reference": { "type": "PubMed", "id": "17993622", "url": "https://pubmed.ncbi.nlm.nih.gov/17993622" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q06588-1", "protein_name": "1-aminocyclopropane-1-carboxylate oxidase 4", "gene_name": "ACO4", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9ZUN4-1", "protein_name": "1-aminocyclopropane-1-carboxylate oxidase 1", "gene_name": "ACO1", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "O65378-1", "protein_name": "1-aminocyclopropane-1-carboxylate oxidase 3", "gene_name": "F12F1.12", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q41931-1", "protein_name": "1-aminocyclopropane-1-carboxylate oxidase 2", "gene_name": "ACO2", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "Q06588", "url": "https://www.uniprot.org/uniprotkb/Q06588" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.17993622", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 4 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Isolation and characterization of a gene involved in ethylene biosynthesis from Arabidopsis thaliana.", "journal": "Gene", "date": "1993", "authors": "G\u00f3mez-Lim M A, Vald\u00e9s-L\u00f3pez V, Cruz-Hernandez A, Saucedo-Arias L J", "reference": { "type": "PubMed", "id": "8262380", "url": "https://pubmed.ncbi.nlm.nih.gov/8262380" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q06588-1", "protein_name": "1-aminocyclopropane-1-carboxylate oxidase 4", "gene_name": "ACO4", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "Q06588", "url": "https://www.uniprot.org/uniprotkb/Q06588" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.8262380", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Genetic and molecular identification of genes required for female gametophyte development and function in Arabidopsis.", "journal": "Development", "date": "2005", "authors": "Pagnussat Gabriela C, Yu Hee-Ju, Ngo Quy A, Rajani Sarojam, Mayalagu Sevugan, Johnson Cameron S, Capron Arnaud, Xie Li-Fen, Ye De, Sundaresan Venkatesan", "reference": { "type": "PubMed", "id": "15634699", "url": "https://pubmed.ncbi.nlm.nih.gov/15634699" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q06915-1", "protein_name": "Probable glucan endo-1,3-beta-glucosidase A6", "gene_name": "A6", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q1PF50-1", "protein_name": "Probable serine protease EDA2", "gene_name": "EDA2", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "O22768-1", "protein_name": "Transcription factor UNE12", "gene_name": "UNE12", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q8LPR5-1", "protein_name": "Transcription factor TCP4", "gene_name": "TCP4", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9SU24-1", "protein_name": "Origin of replication complex subunit 1B", "gene_name": "ORC1B", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "A2RVP7-1", "protein_name": "Mitochondrial import inner membrane translocase subunit TIM22-1", "gene_name": "MEE67; TIM22-1", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "F4IJV4-1", "protein_name": "Probable pre-mRNA-splicing factor ATP-dependent RNA helicase DEAH6", "gene_name": "MEE29", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "F4J2C8-1", "protein_name": "Protein EMBRYO SAC DEVELOPMENT ARREST 30", "gene_name": "EDA30", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "F4JSV3-1", "protein_name": "Probable E3 ubiquitin-protein ligase EDA40", "gene_name": "EDA40", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9SU00-1", "protein_name": "Calmodulin-like protein 2", "gene_name": "CML2", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9T0K9-1", "protein_name": "Heavy metal-associated isoprenylated plant protein 18", "gene_name": "HIPP18", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q94AX3-1", "protein_name": "Non-specific lipid transfer protein GPI-anchored 16", "gene_name": "EDA4; LTPG16", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9LPC5-1", "protein_name": "Brefeldin A-inhibited guanine nucleotide-exchange protein 3", "gene_name": "BIG3", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9SIJ5-1", "protein_name": "Protein RADIALIS-like 2", "gene_name": "RL2", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9ZV53-1", "protein_name": "Putative RING-H2 finger protein ATL49", "gene_name": "ATL49", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q93WN0-1", "protein_name": "Selenium-binding protein 2", "gene_name": "SBP2", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9ZU90-1", "protein_name": "F-box protein SKIP28", "gene_name": "SKIP28", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "O04312-1", "protein_name": "Jacalin-related lectin 32", "gene_name": "JAL32", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9XIM0-1", "protein_name": "CCG-binding protein 1", "gene_name": "MEE14", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q8GZ38-1", "protein_name": "Transcription factor UNE10", "gene_name": "UNE10", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q8S9J1-1", "protein_name": "Protoporphyrinogen oxidase 2, chloroplastic/mitochondrial", "gene_name": "HEMG2; PPOX2", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "O64743-1", "protein_name": "Monolignol oxidoreductase AtBBE-like 15", "gene_name": "MEE23", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "O64750-1", "protein_name": "Protein PHOTOSYSTEM I ASSEMBLY 2, chloroplastic", "gene_name": "PSA2", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "O82171-1", "protein_name": "ADP-ribosylation factor GTPase-activating protein AGD10", "gene_name": "AGD10", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "O82266-1", "protein_name": "Protein SLOW WALKER 1", "gene_name": "SWA1", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9FIZ3-1", "protein_name": "LRR receptor-like serine/threonine-protein kinase GSO2", "gene_name": "GSO2", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9FK63-1", "protein_name": "Calmodulin-binding receptor kinase CaMRLK", "gene_name": "CAMRLK", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9FRI0-1", "protein_name": "Transcription factor MEE8", "gene_name": "MEE8", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9LFF1-1", "protein_name": "Pentatricopeptide repeat-containing protein At3g53700, chloroplastic", "gene_name": "MEE40", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q5XVF0-1", "protein_name": "TATA box-binding protein-associated factor RNA polymerase I subunit B", "gene_name": "MEE12", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q8LAJ7-1", "protein_name": "Protein PHR1-LIKE 3", "gene_name": "PHL3", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "C0LGP2-1", "protein_name": "Probable LRR receptor-like serine/threonine-protein kinase MEE39", "gene_name": "MEE39", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "F4IDC2-1", "protein_name": "Protein SLOW WALKER 2", "gene_name": "SWA2", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9LZM1-1", "protein_name": "Oxysterol-binding protein-related protein 3A", "gene_name": "ORP3A; UNE18", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9SB61-1", "protein_name": "Zinc-finger homeodomain protein 2", "gene_name": "HB22; ZHD1", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9M884-1", "protein_name": "Mannose-6-phosphate isomerase 1", "gene_name": "PMI1", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9SIE1-1", "protein_name": "Bifunctional aspartate aminotransferase and glutamate/aspartate-prephenate aminotransferase", "gene_name": "PAT", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9SMX1-1", "protein_name": "DExH-box ATP-dependent RNA helicase DExH16, mitochondrial", "gene_name": "SUV3", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9T0I1-1", "protein_name": "DNA (cytosine-5)-methyltransferase 3", "gene_name": "MET3", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "Q06915", "url": "https://www.uniprot.org/uniprotkb/Q06915" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.15634699", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 39 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "A large-scale genetic screen in Arabidopsis to identify genes involved in pollen exine production.", "journal": "Plant physiology", "date": "2011-10", "authors": "Dobritsa Anna A, Geanconteri Aliza, Shrestha Jay, Carlson Ann, Kooyers Nicholas, Coerper Daniel, Urbanczyk-Wochniak Ewa, Bench Bennie J, Sumner Lloyd W, Swanson Robert, Preuss Daphne", "reference": { "type": "PubMed", "id": "21849515", "url": "https://pubmed.ncbi.nlm.nih.gov/21849515" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q06915-1", "protein_name": "Probable glucan endo-1,3-beta-glucosidase A6", "gene_name": "A6", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q08891-1", "protein_name": "Fatty acyl-CoA reductase 2, chloroplastic", "gene_name": "FAR2", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "O64470-1", "protein_name": "Spermidine hydroxycinnamoyl transferase", "gene_name": "SHT", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "Q06915", "url": "https://www.uniprot.org/uniprotkb/Q06915" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.21849515", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The anther-specific protein encoded by the Brassica napus and Arabidopsis thaliana A6 gene displays similarity to beta-1,3-glucanases.", "journal": "The Plant journal : for cell and molecular biology", "date": "1993-12", "authors": "Hird D L, Worrall D, Hodge R, Smartt S, Paul W, Scott R", "reference": { "type": "PubMed", "id": "8281185", "url": "https://pubmed.ncbi.nlm.nih.gov/8281185" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q06915-1", "protein_name": "Probable glucan endo-1,3-beta-glucosidase A6", "gene_name": "A6", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "Q06915", "url": "https://www.uniprot.org/uniprotkb/Q06915" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.8281185", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Arabidopsis enhanced ethylene response 4 encodes an EIN3-interacting TFIID transcription factor required for proper ethylene response, including ERF1 induction.", "journal": "J. Exp. Bot.", "date": "2007", "authors": "Robles Linda M, Wampole Jessica S, Christians Matthew J, Larsen Paul B", "reference": { "type": "PubMed", "id": "17526916", "url": "https://pubmed.ncbi.nlm.nih.gov/17526916" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q07099-1", "protein_name": "Serine/threonine-protein phosphatase PP2A-1 catalytic subunit", "gene_name": "PP2A1", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "O04951-1", "protein_name": "Serine/threonine-protein phosphatase PP2A-5 catalytic subunit", "gene_name": "PP2A5", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q8LDC8-1", "protein_name": "Ethylene-responsive transcription factor 1B", "gene_name": "ERF1B", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q940A7-1", "protein_name": "Transcription initiation factor TFIID subunit 12b", "gene_name": "TAF12B", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "O24606-1", "protein_name": "Protein ETHYLENE INSENSITIVE 3", "gene_name": "EIN3", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "Q07099", "url": "https://www.uniprot.org/uniprotkb/Q07099" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.17526916", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 5 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "TAP46 plays a positive role in the ABSCISIC ACID INSENSITIVE5-regulated gene expression in Arabidopsis.", "journal": "Plant Physiol.", "date": "2014", "authors": "Hu Rongbin, Zhu Yinfeng, Shen Guoxin, Zhang Hong", "reference": { "type": "PubMed", "id": "24357600", "url": "https://pubmed.ncbi.nlm.nih.gov/24357600" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q07099-1", "protein_name": "Serine/threonine-protein phosphatase PP2A-1 catalytic subunit", "gene_name": "PP2A1", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q8LDQ4-1", "protein_name": "PP2A regulatory subunit TAP46", "gene_name": "TAP46", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9SJN0-1", "protein_name": "Protein ABSCISIC ACID-INSENSITIVE 5", "gene_name": "ABI5", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9LHE7-1", "protein_name": "Phytochrome-associated serine/threonine-protein phosphatase 3", "gene_name": "FYPP3", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q07100-1", "protein_name": "Serine/threonine-protein phosphatase PP2A-3 catalytic subunit", "gene_name": "PP2A-3; PP2A3", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "P48529-1", "protein_name": "Serine/threonine-protein phosphatase PP-X isozyme 1", "gene_name": "PPX1", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q07098-1", "protein_name": "Serine/threonine-protein phosphatase PP2A-2 catalytic subunit", "gene_name": "PP2A2", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9SX52-1", "protein_name": "Phytochrome-associated serine/threonine-protein phosphatase 1", "gene_name": "FYPP1", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "Q07099", "url": "https://www.uniprot.org/uniprotkb/Q07099" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.24357600", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 8 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Identification of Open Stomata1-interacting proteins reveals interactions with sucrose non-fermenting1-related protein kinases2 and with type 2a protein phosphatases that function in abscisic acid responses.", "journal": "Plant Physiol.", "date": "2015", "authors": "Waadt Rainer, Manalansan Bianca, Rauniyar Navin, Munemasa Shintaro, Booker Matthew A, Brandt Benjamin, Waadt Christian, Nusinow Dmitri A, Kay Steve A, Kunz Hans-Henning, Schumacher Karin, DeLong Alison, Yates John R, Schroeder Julian I", "reference": { "type": "PubMed", "id": "26175513", "url": "https://pubmed.ncbi.nlm.nih.gov/26175513" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q07099-1", "protein_name": "Serine/threonine-protein phosphatase PP2A-1 catalytic subunit", "gene_name": "PP2A1", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q940H6-1", "protein_name": "Serine/threonine-protein kinase SRK2E", "gene_name": "OST1; SRK2E", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "O04375-1", "protein_name": "Serine/threonine protein phosphatase 2A 57 kDa regulatory subunit B' alpha isoform", "gene_name": "B'ALPHA", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "O04376-1", "protein_name": "Serine/threonine protein phosphatase 2A 57 kDa regulatory subunit B' beta isoform", "gene_name": "B'BETA", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9ZQY6-1", "protein_name": "Serine/threonine protein phosphatase 2A 55 kDa regulatory subunit B' delta isoform", "gene_name": "B'DELTA", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q38951-1", "protein_name": "Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A gamma isoform", "gene_name": "PP2AA3", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q07098-1", "protein_name": "Serine/threonine-protein phosphatase PP2A-2 catalytic subunit", "gene_name": "PP2A2", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q38950-1", "protein_name": "Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A beta isoform", "gene_name": "PP2AA2", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "Q07099", "url": "https://www.uniprot.org/uniprotkb/Q07099" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.26175513", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 8 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Methylation of protein phosphatase 2A-Influence of regulators and environmental stress factors.", "journal": "Plant, cell & environment", "date": "2017-10", "authors": "Creighton Maria T, Kolton Anna, Kataya Amr R A, Maple-Gr\u00f8dem Jodi, Averkina Irina O, Heidari Behzad, Lillo Cathrine", "reference": { "type": "PubMed", "id": "28741704", "url": "https://pubmed.ncbi.nlm.nih.gov/28741704" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q07099-1", "protein_name": "Serine/threonine-protein phosphatase PP2A-1 catalytic subunit", "gene_name": "PP2A1", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "O04951-1", "protein_name": "Serine/threonine-protein phosphatase PP2A-5 catalytic subunit", "gene_name": "PP2A5", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q8VY08-1", "protein_name": "Leucine carboxyl methyltransferase 1 homolog", "gene_name": "LCMT1; SBI1", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q43867-1", "protein_name": "Pectinesterase 1", "gene_name": "PME1", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q07100-1", "protein_name": "Serine/threonine-protein phosphatase PP2A-3 catalytic subunit", "gene_name": "PP2A-3; PP2A3", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "P48578-1", "protein_name": "Serine/threonine-protein phosphatase PP2A-4 catalytic subunit", "gene_name": "PP2A4", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q07098-1", "protein_name": "Serine/threonine-protein phosphatase PP2A-2 catalytic subunit", "gene_name": "PP2A2", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "Q07099", "url": "https://www.uniprot.org/uniprotkb/Q07099" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.28741704", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 7 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Protein phosphatases in higher plants: multiplicity of type 2A phosphatases in Arabidopsis thaliana.", "journal": "Plant Mol. Biol.", "date": "1993", "authors": "Ari\u00f1o J, P\u00e9rez-Callej\u00f3n E, Cunillera N, Camps M, Posas F, Ferrer A", "reference": { "type": "PubMed", "id": "8382968", "url": "https://pubmed.ncbi.nlm.nih.gov/8382968" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q07099-1", "protein_name": "Serine/threonine-protein phosphatase PP2A-1 catalytic subunit", "gene_name": "PP2A1", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q07100-1", "protein_name": "Serine/threonine-protein phosphatase PP2A-3 catalytic subunit", "gene_name": "PP2A-3; PP2A3", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q07098-1", "protein_name": "Serine/threonine-protein phosphatase PP2A-2 catalytic subunit", "gene_name": "PP2A2", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "Q07099", "url": "https://www.uniprot.org/uniprotkb/Q07099" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.8382968", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Molecular characterization of a putative plant homolog of MBD4 DNA glycosylase.", "journal": "DNA repair", "date": "2013-11", "authors": "Ramiro-Merina \u00c1ngel, Ariza Rafael R, Rold\u00e1n-Arjona Teresa", "reference": { "type": "PubMed", "id": "23994068", "url": "https://pubmed.ncbi.nlm.nih.gov/23994068" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q0IGK1-1", "protein_name": "Methyl-CpG-binding domain protein 4-like protein", "gene_name": "MBD4L", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "Q0IGK1", "url": "https://www.uniprot.org/uniprotkb/Q0IGK1" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "mutagenesis": [ { "start_pos": 429, "end_pos": 429, "sequence_org": "D", "sequence_mut": "A", "comment": "Reduces activity 160-fold.", "evidence": [ { "database": "UniProtKB", "id": "Q0IGK1", "url": "https://www.uniprot.org/uniprotkb/Q0IGK1" }, { "database": "PubMed", "id": "23994068", "url": "https://pubmed.ncbi.nlm.nih.gov/23994068" } ], "uniprot_canonical_ac": "Q0IGK1-1" } ], "record_id": "pubmed.23994068", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Expression and function of AtMBD4L, the single gene encoding the nuclear DNA glycosylase MBD4L in Arabidopsis.", "journal": "Plant science : an international journal of experimental plant biology", "date": "2015-06", "authors": "Nota Florencia, Cambiagno Dami\u00e1n A, Ribone Pamela, Alvarez Mar\u00eda E", "reference": { "type": "PubMed", "id": "25900572", "url": "https://pubmed.ncbi.nlm.nih.gov/25900572" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q0IGK1-1", "protein_name": "Methyl-CpG-binding domain protein 4-like protein", "gene_name": "MBD4L", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "Q0IGK1", "url": "https://www.uniprot.org/uniprotkb/Q0IGK1" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.25900572", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "BIGPETALp, a bHLH transcription factor is involved in the control of Arabidopsis petal size.", "journal": "The EMBO journal", "date": "2006-08-23", "authors": "Sz\u00e9csi Judit, Joly Caroline, Bordji Karim, Varaud Emilie, Cock J Mark, Dumas Christian, Bendahmane Mohammed", "reference": { "type": "PubMed", "id": "16902407", "url": "https://pubmed.ncbi.nlm.nih.gov/16902407" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q0JXE7-1", "protein_name": "Transcription factor BPE", "gene_name": "BPE", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "P31265-1", "protein_name": "Translationally-controlled tumor protein 1", "gene_name": "TCTP1", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "Q0JXE7", "url": "https://www.uniprot.org/uniprotkb/Q0JXE7" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.16902407", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "SAUR Inhibition of PP2C-D Phosphatases Activates Plasma Membrane H+-ATPases to Promote Cell Expansion in Arabidopsis.", "journal": "The Plant cell", "date": "2014-05", "authors": "Spartz Angela K, Ren Hong, Park Mee Yeon, Grandt Kristin N, Lee Sang Ho, Murphy Angus S, Sussman Michael R, Overvoorde Paul J, Gray William M", "reference": { "type": "PubMed", "id": "24858935", "url": "https://pubmed.ncbi.nlm.nih.gov/24858935" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q0V7V2-1", "protein_name": "Probable protein phosphatase 2C 42", "gene_name": "PP2C42", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q5PNS9-1", "protein_name": "Probable protein phosphatase 2C 64", "gene_name": "PP2C64", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9FJG1-1", "protein_name": "Auxin-responsive protein SAUR19", "gene_name": "SAUR19", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "P19456-1", "protein_name": "ATPase 2, plasma membrane-type", "gene_name": "AHA2; HA2", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "O65648-1", "protein_name": "Protein SMALL AUXIN UP-REGULATED RNA 9", "gene_name": "SAUR9", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q84JD5-1", "protein_name": "Probable protein phosphatase 2C 68", "gene_name": "APD8; PP2C68", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9FKX4-1", "protein_name": "Probable protein phosphatase 2C 79", "gene_name": "APD9; PP2C79", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9SD12-1", "protein_name": "Probable protein phosphatase 2C 46", "gene_name": "PP2C46", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q94CL8-1", "protein_name": "Probable protein phosphatase 2C 48", "gene_name": "PP2C6", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "O81760-1", "protein_name": "Probable protein phosphatase 2C 63", "gene_name": "APD5; PP2C63", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "O64538-1", "protein_name": "Auxin-responsive protein SAUR40", "gene_name": "SAUR40", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9LTV3-1", "protein_name": "Auxin-responsive protein SAUR72", "gene_name": "SAUR72", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q501F9-1", "protein_name": "Probable protein phosphatase 2C 67", "gene_name": "PP2C67", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9LHJ9-1", "protein_name": "Probable protein phosphatase 2C 38", "gene_name": "PP2C38", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "P20649-1", "protein_name": "ATPase 1, plasma membrane-type", "gene_name": "AHA1; HA1", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "Q0V7V2", "url": "https://www.uniprot.org/uniprotkb/Q0V7V2" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "phosphorylation": [ { "start_pos": 947, "end_pos": 947, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine", "evidence": [ { "database": "UniProtKB", "id": "P19456", "url": "https://www.uniprot.org/uniprotkb/P19456" }, { "database": "PubMed", "id": "10593986", "url": "https://pubmed.ncbi.nlm.nih.gov/10593986" }, { "database": "PubMed", "id": "30649552", "url": "https://pubmed.ncbi.nlm.nih.gov/30649552" }, { "database": "PubMed", "id": "24858935", "url": "https://pubmed.ncbi.nlm.nih.gov/24858935" }, { "database": "iPTMnet", "id": "P19456", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P19456" }, { "database": "PubMed", "id": "15308754", "url": "https://pubmed.ncbi.nlm.nih.gov/15308754" }, { "database": "PubMed", "id": "17317660", "url": "https://pubmed.ncbi.nlm.nih.gov/17317660" }, { "database": "PubMed", "id": "17586839", "url": "https://pubmed.ncbi.nlm.nih.gov/17586839" }, { "database": "PubMed", "id": "17651370", "url": "https://pubmed.ncbi.nlm.nih.gov/17651370" }, { "database": "PubMed", "id": "18463617", "url": "https://pubmed.ncbi.nlm.nih.gov/18463617" }, { "database": "PubMed", "id": "19245862", "url": "https://pubmed.ncbi.nlm.nih.gov/19245862" }, { "database": "PubMed", "id": "19376835", "url": "https://pubmed.ncbi.nlm.nih.gov/19376835" }, { "database": "PubMed", "id": "20374526", "url": "https://pubmed.ncbi.nlm.nih.gov/20374526" }, { "database": "PubMed", "id": "21768351", "url": "https://pubmed.ncbi.nlm.nih.gov/21768351" }, { "database": "PubMed", "id": "22060019", "url": "https://pubmed.ncbi.nlm.nih.gov/22060019" }, { "database": "PubMed", "id": "23111157", "url": "https://pubmed.ncbi.nlm.nih.gov/23111157" }, { "database": "PubMed", "id": "23172892", "url": "https://pubmed.ncbi.nlm.nih.gov/23172892" }, { "database": "PubMed", "id": "23328941", "url": "https://pubmed.ncbi.nlm.nih.gov/23328941" }, { "database": "PubMed", "id": "23572148", "url": "https://pubmed.ncbi.nlm.nih.gov/23572148" }, { "database": "PubMed", "id": "23660473", "url": "https://pubmed.ncbi.nlm.nih.gov/23660473" }, { "database": "PubMed", "id": "23776212", "url": "https://pubmed.ncbi.nlm.nih.gov/23776212" }, { "database": "PubMed", "id": "23820729", "url": "https://pubmed.ncbi.nlm.nih.gov/23820729" }, { "database": "PubMed", "id": "24043427", "url": "https://pubmed.ncbi.nlm.nih.gov/24043427" }, { "database": "PubMed", "id": "24924143", "url": "https://pubmed.ncbi.nlm.nih.gov/24924143" }, { "database": "PubMed", "id": "25561503", "url": "https://pubmed.ncbi.nlm.nih.gov/25561503" }, { "database": "PubMed", "id": "26091701", "url": "https://pubmed.ncbi.nlm.nih.gov/26091701" }, { "database": "PubMed", "id": "26187819", "url": "https://pubmed.ncbi.nlm.nih.gov/26187819" }, { "database": "PubMed", "id": "27419465", "url": "https://pubmed.ncbi.nlm.nih.gov/27419465" }, { "database": "PubMed", "id": "29654922", "url": "https://pubmed.ncbi.nlm.nih.gov/29654922" }, { "database": "PubMed", "id": "30833711", "url": "https://pubmed.ncbi.nlm.nih.gov/30833711" }, { "database": "PubMed", "id": "33731345", "url": "https://pubmed.ncbi.nlm.nih.gov/33731345" } ], "site_lbl": "Thr947", "uniprot_canonical_ac": "P19456-1" } ], "mutagenesis": [ { "start_pos": 276, "end_pos": 276, "sequence_org": "D", "sequence_mut": "N", "comment": "Phosphatase-dead, unable to repress the plasma membrane H(+)-ATPase AHA2 activity.", "evidence": [ { "database": "UniProtKB", "id": "Q501F9", "url": "https://www.uniprot.org/uniprotkb/Q501F9" }, { "database": "PubMed", "id": "24858935", "url": "https://pubmed.ncbi.nlm.nih.gov/24858935" } ], "uniprot_canonical_ac": "Q501F9-1" } ], "record_id": "pubmed.24858935", "abstract": "", "glycosylation": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 15 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Plant development. Arabidopsis NAC45/86 direct sieve element morphogenesis culminating in enucleation.", "journal": "Science (New York, N.Y.)", "date": "2014-08-22", "authors": "Furuta Kaori Miyashima, Yadav Shri Ram, Lehesranta Satu, Belevich Ilya, Miyashima Shunsuke, Heo Jung-ok, Vat\u00e9n Anne, Lindgren Ove, De Rybel Bert, Van Isterdael Gert, Somervuo Panu, Lichtenberger Raffael, Rocha Raquel, Thitamadee Siripong, T\u00e4htiharju Sari, Auvinen Petri, Beeckman Tom, Jokitalo Eija, Helariutta Yk\u00e4", "reference": { "type": "PubMed", "id": "25081480", "url": "https://pubmed.ncbi.nlm.nih.gov/25081480" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q0V842-1", "protein_name": "Protein NEN2", "gene_name": "NEN2", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9SGY1-1", "protein_name": "ABC transporter B family member 10", "gene_name": "ABCB10; PGP10", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9FZD0-1", "protein_name": "Carbohydrate-binding X8 domain-containing protein", "gene_name": "T1K7.18", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "A4VCM0-1", "protein_name": "NAC domain-containing protein 45", "gene_name": "NAC045", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "F4JJ23-1", "protein_name": "Protein NEN4", "gene_name": "NEN4", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9M670-1", "protein_name": "Protein RESTRICTED TEV MOVEMENT 2", "gene_name": "RTM2", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9CA74-1", "protein_name": "Protein NEN3", "gene_name": "NEN3", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9CAF4-1", "protein_name": "Nuclear pore complex protein NUP1", "gene_name": "NUP1", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9SB51-1", "protein_name": "Ubiquitin carboxyl-terminal hydrolase 16", "gene_name": "UBP16", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9FFI5-1", "protein_name": "NAC domain-containing protein 86", "gene_name": "NAC086", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9FLR0-1", "protein_name": "Protein NEN1", "gene_name": "NEN1", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "P58766-1", "protein_name": "Phospholipase D alpha 3", "gene_name": "PLDALPHA3", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9SE37-1", "protein_name": "Protein RESTRICTED TEV MOVEMENT 1", "gene_name": "RTM1", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9SAK5-1", "protein_name": "Myb family transcription factor APL", "gene_name": "APL", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "Q0V842", "url": "https://www.uniprot.org/uniprotkb/Q0V842" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.25081480", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 14 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "NPY genes and AGC kinases define two key steps in auxin-mediated organogenesis in Arabidopsis.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2008-12-30", "authors": "Cheng Youfa, Qin Genji, Dai Xinhua, Zhao Yunde", "reference": { "type": "PubMed", "id": "19075219", "url": "https://pubmed.ncbi.nlm.nih.gov/19075219" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q0WL52-1", "protein_name": "Phototropic-responsive NPH3 family protein NPY5", "gene_name": "NPY5", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9FN09-1", "protein_name": "Phototropic-responsive NPH3 family protein NPY3", "gene_name": "NPY3", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "O64814-1", "protein_name": "Phototropic-responsive NPH3 family protein NPY4", "gene_name": "NPY4", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "O80970-1", "protein_name": "Phototropic-responsive NPH3 family protein NPY2", "gene_name": "NPY2", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q8H1D3-1", "protein_name": "Phototropic-responsive NPH3 family protein NPY1", "gene_name": "NPY1", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "O64682-1", "protein_name": "Protein kinase PINOID", "gene_name": "PID", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9C8M5-1", "protein_name": "Serine/threonine-protein kinase WAG1", "gene_name": "WAG1", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q64FQ2-1", "protein_name": "Protein kinase PINOID 2", "gene_name": "PID2", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9LUL2-1", "protein_name": "Serine/threonine-protein kinase WAG2", "gene_name": "WAG2", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "Q0WL52", "url": "https://www.uniprot.org/uniprotkb/Q0WL52" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.19075219", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 9 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "NPY genes play an essential role in root gravitropic responses in Arabidopsis.", "journal": "Molecular plant", "date": "2011-01", "authors": "Li Yuanting, Dai Xinhua, Cheng Youfa, Zhao Yunde", "reference": { "type": "PubMed", "id": "20833732", "url": "https://pubmed.ncbi.nlm.nih.gov/20833732" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q0WL52-1", "protein_name": "Phototropic-responsive NPH3 family protein NPY5", "gene_name": "NPY5", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9FN09-1", "protein_name": "Phototropic-responsive NPH3 family protein NPY3", "gene_name": "NPY3", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "O64814-1", "protein_name": "Phototropic-responsive NPH3 family protein NPY4", "gene_name": "NPY4", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "O80970-1", "protein_name": "Phototropic-responsive NPH3 family protein NPY2", "gene_name": "NPY2", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q8H1D3-1", "protein_name": "Phototropic-responsive NPH3 family protein NPY1", "gene_name": "NPY1", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "Q0WL52", "url": "https://www.uniprot.org/uniprotkb/Q0WL52" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.20833732", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 5 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Polar-localized NPH3-like proteins regulate polarity and endocytosis of PIN-FORMED auxin efflux carriers.", "journal": "Development (Cambridge, England)", "date": "2011-05", "authors": "Furutani Masahiko, Sakamoto Norihito, Yoshida Shuhei, Kajiwara Takahito, Robert H\u00e9l\u00e8ne S, Friml Jir\u00ed, Tasaka Masao", "reference": { "type": "PubMed", "id": "21490067", "url": "https://pubmed.ncbi.nlm.nih.gov/21490067" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q0WL52-1", "protein_name": "Phototropic-responsive NPH3 family protein NPY5", "gene_name": "NPY5", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9FN09-1", "protein_name": "Phototropic-responsive NPH3 family protein NPY3", "gene_name": "NPY3", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "O64814-1", "protein_name": "Phototropic-responsive NPH3 family protein NPY4", "gene_name": "NPY4", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "O80970-1", "protein_name": "Phototropic-responsive NPH3 family protein NPY2", "gene_name": "NPY2", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q8H1D3-1", "protein_name": "Phototropic-responsive NPH3 family protein NPY1", "gene_name": "NPY1", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "Q0WL52", "url": "https://www.uniprot.org/uniprotkb/Q0WL52" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.21490067", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 5 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "MAB4-induced auxin sink generates local auxin gradients in Arabidopsis organ formation.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2014-01-21", "authors": "Furutani Masahiko, Nakano Yasukazu, Tasaka Masao", "reference": { "type": "PubMed", "id": "24395791", "url": "https://pubmed.ncbi.nlm.nih.gov/24395791" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q0WL52-1", "protein_name": "Phototropic-responsive NPH3 family protein NPY5", "gene_name": "NPY5", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9FN09-1", "protein_name": "Phototropic-responsive NPH3 family protein NPY3", "gene_name": "NPY3", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q8H1D3-1", "protein_name": "Phototropic-responsive NPH3 family protein NPY1", "gene_name": "NPY1", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "Q0WL52", "url": "https://www.uniprot.org/uniprotkb/Q0WL52" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.24395791", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "AGC kinases and MAB4/MEL proteins maintain PIN polarity by limiting lateral diffusion in plant cells.", "journal": "Current biology : CB", "date": "2021-05-10", "authors": "Glanc Matou\u0161, Van Gelderen Kasper, Hoermayer Lukas, Tan Shutang, Naramoto Satoshi, Zhang Xixi, Domjan David, V\u010dela\u0159ov\u00e1 Ludmila, Hauschild Robert, Johnson Alexander, de Koning Edward, van Dop Maritza, Rademacher Eike, Janson Stef, Wei Xiaoyu, Moln\u00e1r Gergely, Fendrych Maty\u00e1\u0161, De Rybel Bert, Offringa Remko, Friml Ji\u0159\u00ed", "reference": { "type": "PubMed", "id": "33705718", "url": "https://pubmed.ncbi.nlm.nih.gov/33705718" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q0WL52-1", "protein_name": "Phototropic-responsive NPH3 family protein NPY5", "gene_name": "NPY5", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9FN09-1", "protein_name": "Phototropic-responsive NPH3 family protein NPY3", "gene_name": "NPY3", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "O64814-1", "protein_name": "Phototropic-responsive NPH3 family protein NPY4", "gene_name": "NPY4", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "O80970-1", "protein_name": "Phototropic-responsive NPH3 family protein NPY2", "gene_name": "NPY2", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q8H1D3-1", "protein_name": "Phototropic-responsive NPH3 family protein NPY1", "gene_name": "NPY1", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "O64682-1", "protein_name": "Protein kinase PINOID", "gene_name": "PID", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9C6B8-1", "protein_name": "Auxin efflux carrier component 1", "gene_name": "PIN1", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9FG74-1", "protein_name": "Serine/threonine-protein kinase D6PK", "gene_name": "D6PK", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9LU77-1", "protein_name": "Auxin efflux carrier component 2", "gene_name": "EIR1; PIN2", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "Q0WL52", "url": "https://www.uniprot.org/uniprotkb/Q0WL52" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "mutagenesis": [ { "start_pos": 231, "end_pos": 231, "sequence_org": "S", "sequence_mut": "A", "comment": "Apical-to-basal shift in polar targeting, lost ability to recruit NPY1/MAB4 and NPY5/MEL1 to the plasma membrane, and increased auxin accumulation in the root tips; when associated with A-252 and A-290. Non-phosphorylatable, slightly decreased auxin transport activity; when associated with A-252; A-271 and A-290.", "evidence": [ { "database": "UniProtKB", "id": "Q9C6B8", "url": "https://www.uniprot.org/uniprotkb/Q9C6B8" }, { "database": "PubMed", "id": "20407025", "url": "https://pubmed.ncbi.nlm.nih.gov/20407025" }, { "database": "PubMed", "id": "33705718", "url": "https://pubmed.ncbi.nlm.nih.gov/33705718" }, { "database": "PubMed", "id": "35917925", "url": "https://pubmed.ncbi.nlm.nih.gov/35917925" } ], "uniprot_canonical_ac": "Q9C6B8-1" }, { "start_pos": 252, "end_pos": 252, "sequence_org": "S", "sequence_mut": "A", "comment": "Apical-to-basal shift in polar targeting, lost ability to recruit NPY1/MAB4 and NPY5/MEL1 to the plasma membrane, and increased auxin accumulation in the root tips; when associated with A-231 and A-290. Non-phosphorylatable, slightly decreased auxin transport activity; when associated with A-231; A-271 and A-290.", "evidence": [ { "database": "UniProtKB", "id": "Q9C6B8", "url": "https://www.uniprot.org/uniprotkb/Q9C6B8" }, { "database": "PubMed", "id": "20407025", "url": "https://pubmed.ncbi.nlm.nih.gov/20407025" }, { "database": "PubMed", "id": "33705718", "url": "https://pubmed.ncbi.nlm.nih.gov/33705718" }, { "database": "PubMed", "id": "35917925", "url": "https://pubmed.ncbi.nlm.nih.gov/35917925" } ], "uniprot_canonical_ac": "Q9C6B8-1" }, { "start_pos": 290, "end_pos": 290, "sequence_org": "S", "sequence_mut": "A", "comment": "Apical-to-basal shift in polar targeting, lost ability to recruit NPY1/MAB4 and NPY5/MEL1 to the plasma membrane, and increased auxin accumulation in the root tips; when associated with A-231 and A-252. Non-phosphorylatable, slightly decreased auxin transport activity; when associated with A-231; A-252 and A-271.", "evidence": [ { "database": "UniProtKB", "id": "Q9C6B8", "url": "https://www.uniprot.org/uniprotkb/Q9C6B8" }, { "database": "PubMed", "id": "20407025", "url": "https://pubmed.ncbi.nlm.nih.gov/20407025" }, { "database": "PubMed", "id": "33705718", "url": "https://pubmed.ncbi.nlm.nih.gov/33705718" }, { "database": "PubMed", "id": "35917925", "url": "https://pubmed.ncbi.nlm.nih.gov/35917925" } ], "uniprot_canonical_ac": "Q9C6B8-1" }, { "start_pos": 237, "end_pos": 237, "sequence_org": "S", "sequence_mut": "A", "comment": "Reduced phosphorylation and lost ability to recruit NPY1/MAB4 and NPY5/MEL1 to the plasma membrane; when associated with A-258 and A-310.", "evidence": [ { "database": "UniProtKB", "id": "Q9LU77", "url": "https://www.uniprot.org/uniprotkb/Q9LU77" }, { "database": "PubMed", "id": "33705718", "url": "https://pubmed.ncbi.nlm.nih.gov/33705718" } ], "uniprot_canonical_ac": "Q9LU77-1" }, { "start_pos": 258, "end_pos": 258, "sequence_org": "S", "sequence_mut": "A", "comment": "Reduced phosphorylation and lost ability to recruit NPY1/MAB4 and NPY5/MEL1 to the plasma membrane; when associated with A-237 and A-310.", "evidence": [ { "database": "UniProtKB", "id": "Q9LU77", "url": "https://www.uniprot.org/uniprotkb/Q9LU77" }, { "database": "PubMed", "id": "33705718", "url": "https://pubmed.ncbi.nlm.nih.gov/33705718" } ], "uniprot_canonical_ac": "Q9LU77-1" }, { "start_pos": 310, "end_pos": 310, "sequence_org": "S", "sequence_mut": "A", "comment": "Reduced phosphorylation and lost ability to recruit NPY1/MAB4 and NPY5/MEL1 to the plasma membrane; when associated with A-237 and A-258.", "evidence": [ { "database": "UniProtKB", "id": "Q9LU77", "url": "https://www.uniprot.org/uniprotkb/Q9LU77" }, { "database": "PubMed", "id": "33705718", "url": "https://pubmed.ncbi.nlm.nih.gov/33705718" } ], "uniprot_canonical_ac": "Q9LU77-1" } ], "record_id": "pubmed.33705718", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 9 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Gene duplication, exon gain and neofunctionalization of OEP16-related genes in land plants.", "journal": "Plant J.", "date": "2006", "authors": "Drea Sin\u00e9ad C, Lao Nga T, Wolfe Kenneth H, Kavanagh Tony A", "reference": { "type": "PubMed", "id": "16709189", "url": "https://pubmed.ncbi.nlm.nih.gov/16709189" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q0WMZ5-1", "protein_name": "Outer envelope pore protein 16-2, chloroplastic", "gene_name": "OEP162", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9ZV24-1", "protein_name": "Outer envelope pore protein 16-1, chloroplastic", "gene_name": "OEP161", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "Q0WMZ5", "url": "https://www.uniprot.org/uniprotkb/Q0WMZ5" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.16709189", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Characterization of DUF724 gene family in Arabidopsis thaliana.", "journal": "Plant molecular biology", "date": "2010-01", "authors": "Cao Xi, Yang Ke-Zhen, Xia Chuan, Zhang Xue-Qin, Chen Li-Qun, Ye De", "reference": { "type": "PubMed", "id": "19795213", "url": "https://pubmed.ncbi.nlm.nih.gov/19795213" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q0WNB1-1", "protein_name": "DUF724 domain-containing protein 5", "gene_name": "DUF5", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9ZVT1-1", "protein_name": "DUF724 domain-containing protein 1", "gene_name": "DUF1", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "F4KEA4-1", "protein_name": "DUF724 domain-containing protein 8", "gene_name": "DUF8", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "O81039-1", "protein_name": "DUF724 domain-containing protein 4", "gene_name": "DUF4", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9FFA2-1", "protein_name": "DUF724 domain-containing protein 9", "gene_name": "DUF9", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9FFA0-1", "protein_name": "DUF724 domain-containing protein 10", "gene_name": "DUF10; DUF", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "F4I8W1-1", "protein_name": "DUF724 domain-containing protein 2", "gene_name": "DUF2", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "O22897-1", "protein_name": "DUF724 domain-containing protein 6", "gene_name": "DUF6", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q8H0V4-1", "protein_name": "DUF724 domain-containing protein 7", "gene_name": "DUF7", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9FZD9-1", "protein_name": "DUF724 domain-containing protein 3", "gene_name": "DUF3", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "Q0WNB1", "url": "https://www.uniprot.org/uniprotkb/Q0WNB1" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.19795213", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 10 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Identification of myosin XI receptors in Arabidopsis defines a distinct class of transport vesicles.", "journal": "The Plant cell", "date": "2013-08", "authors": "Peremyslov Valera V, Morgun Eva A, Kurth Elizabeth G, Makarova Kira S, Koonin Eugene V, Dolja Valerian V", "reference": { "type": "PubMed", "id": "23995081", "url": "https://pubmed.ncbi.nlm.nih.gov/23995081" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q0WNW4-1", "protein_name": "Myosin-binding protein 3", "gene_name": "MYOB3", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "F4INW9-1", "protein_name": "Probable myosin-binding protein 4", "gene_name": "MYOB4", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q39160-1", "protein_name": "Myosin-5", "gene_name": "XI-1", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "F4HXQ7-1", "protein_name": "Myosin-binding protein 1", "gene_name": "MYOB1", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9FG14-1", "protein_name": "Myosin-binding protein 7", "gene_name": "MYOB7", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9CAC4-1", "protein_name": "Myosin-binding protein 2", "gene_name": "MYOB2", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q0WPU1-1", "protein_name": "Myosin-15", "gene_name": "XI-I", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "F4K5J1-1", "protein_name": "Myosin-17", "gene_name": "XI-K; XIK", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "Q0WNW4", "url": "https://www.uniprot.org/uniprotkb/Q0WNW4" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.23995081", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 8 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Conserved RNaseII domain protein functions in cytoplasmic mRNA decay and suppresses Arabidopsis decapping mutant phenotypes.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2010-09-07", "authors": "Zhang Weiping, Murphy Caroline, Sieburth Leslie E", "reference": { "type": "PubMed", "id": "20798041", "url": "https://pubmed.ncbi.nlm.nih.gov/20798041" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q0WPN0-1", "protein_name": "Inactive exonuclease DIS3L2", "gene_name": "SOV", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9SHL7-1", "protein_name": "Exosome complex exonuclease RRP44 homolog A", "gene_name": "EMB2763; RRP44A", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "Q0WPN0", "url": "https://www.uniprot.org/uniprotkb/Q0WPN0" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.20798041", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Arabidopsis AtRRP44A is the functional homolog of Rrp44/Dis3, an exosome component, is essential for viability and is required for RNA processing and degradation.", "journal": "PloS one", "date": "2013", "authors": "Kumakura Naoyoshi, Otsuki Hiroka, Tsuzuki Masayuki, Takeda Atsushi, Watanabe Yuichiro", "reference": { "type": "PubMed", "id": "24244451", "url": "https://pubmed.ncbi.nlm.nih.gov/24244451" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q0WPN0-1", "protein_name": "Inactive exonuclease DIS3L2", "gene_name": "SOV", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9SHL7-1", "protein_name": "Exosome complex exonuclease RRP44 homolog A", "gene_name": "EMB2763; RRP44A", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "Q0WPN0", "url": "https://www.uniprot.org/uniprotkb/Q0WPN0" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.24244451", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Characterization of the Arabidopsis augmin complex uncovers its critical function in the assembly of the acentrosomal spindle and phragmoplast microtubule arrays.", "journal": "The Plant cell", "date": "2012-04", "authors": "Hotta Takashi, Kong Zhaosheng, Ho Chin-Min Kimmy, Zeng Cui Jing Tracy, Horio Tetsuya, Fong Sophia, Vuong Trang, Lee Yuh-Ru Julie, Liu Bo", "reference": { "type": "PubMed", "id": "22505726", "url": "https://pubmed.ncbi.nlm.nih.gov/22505726" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q0WTP1-1", "protein_name": "AUGMIN subunit 7", "gene_name": "AUG7", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9SUH5-1", "protein_name": "AUGMIN subunit 8", "gene_name": "AUG8; QWRF8", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "F4IK01-1", "protein_name": "AUGMIN subunit 1", "gene_name": "AUG1", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "O48767-1", "protein_name": "AUGMIN subunit 2", "gene_name": "AUG2", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9FMB4-1", "protein_name": "AUGMIN subunit 5", "gene_name": "AUG5", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q8GYM3-1", "protein_name": "AUGMIN subunit 4", "gene_name": "AUG4", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q94BP7-1", "protein_name": "AUGMIN subunit 6", "gene_name": "AUG6", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q0WQE7-1", "protein_name": "AUGMIN subunit 3", "gene_name": "AUG3", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "Q0WTP1", "url": "https://www.uniprot.org/uniprotkb/Q0WTP1" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.22505726", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 8 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Gene families from the Arabidopsis thaliana pollen coat proteome.", "journal": "Science", "date": "2001", "authors": "Mayfield J A, Fiebig A, Johnstone S E, Preuss D", "reference": { "type": "PubMed", "id": "11431566", "url": "https://pubmed.ncbi.nlm.nih.gov/11431566" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q0WUV7-1", "protein_name": "GDSL esterase/lipase EXL4", "gene_name": "EXL4", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q93X94-1", "protein_name": "GDSL esterase/lipase EXL6", "gene_name": "EXL6", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q94CH7-1", "protein_name": "GDSL esterase/lipase EXL2", "gene_name": "EXL2", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q94CH5-1", "protein_name": "GDSL esterase/lipase EXL5", "gene_name": "EXL5", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q94CH6-1", "protein_name": "GDSL esterase/lipase EXL3", "gene_name": "EXL3", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q94CH8-1", "protein_name": "GDSL esterase/lipase EXL1", "gene_name": "EXL1", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "B3H7A9-1", "protein_name": "Probable peroxygenase 7", "gene_name": "PXG7", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9LY09-1", "protein_name": "Tapetal oleosin GRP-17", "gene_name": "GRP17", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q42574-1", "protein_name": "Tapetal oleosin GRP-19", "gene_name": "GRP19", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9LY08-1", "protein_name": "Tapetal oleosin GRP-16", "gene_name": "GRP16", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "Q0WUV7", "url": "https://www.uniprot.org/uniprotkb/Q0WUV7" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.11431566", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 10 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The DUF59 family gene AE7 acts in the cytosolic iron-sulfur cluster assembly pathway to maintain nuclear genome integrity in Arabidopsis.", "journal": "The Plant cell", "date": "2012-10", "authors": "Luo Dexian, Bernard Delphine G, Balk Janneke, Hai Huang, Cui Xiaofeng", "reference": { "type": "PubMed", "id": "23104832", "url": "https://pubmed.ncbi.nlm.nih.gov/23104832" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q0WVF8-1", "protein_name": "MMS19 nucleotide excision repair protein homolog", "gene_name": "MMS19", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "O80990-1", "protein_name": "Protein CIA1", "gene_name": "CIA1", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9SR25-1", "protein_name": "Protein AE7-like 2", "gene_name": "AEL2", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "A8MR89-1", "protein_name": "Protein AE7-like 1", "gene_name": "AEL1", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q94CL6-1", "protein_name": "Protein NAR1", "gene_name": "NAR1", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9C9G6-1", "protein_name": "Protein AE7", "gene_name": "AE7", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "Q0WVF8", "url": "https://www.uniprot.org/uniprotkb/Q0WVF8" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "mutagenesis": [ { "start_pos": 51, "end_pos": 51, "sequence_org": "E", "sequence_mut": "K", "comment": "In ae7-1; leaf adaxial-abaxial polarity defects, highly accumulated DNA damage and activation of the DNA damage response.", "evidence": [ { "database": "UniProtKB", "id": "Q9C9G6", "url": "https://www.uniprot.org/uniprotkb/Q9C9G6" }, { "database": "PubMed", "id": "21070412", "url": "https://pubmed.ncbi.nlm.nih.gov/21070412" }, { "database": "PubMed", "id": "23104832", "url": "https://pubmed.ncbi.nlm.nih.gov/23104832" } ], "uniprot_canonical_ac": "Q9C9G6-1" } ], "record_id": "pubmed.23104832", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 6 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Functional genomics by integrated analysis of metabolome and transcriptome of Arabidopsis plants over-expressing an MYB transcription factor.", "journal": "The Plant journal : for cell and molecular biology", "date": "2005-04", "authors": "Tohge Takayuki, Nishiyama Yasutaka, Hirai Masami Yokota, Yano Mitsuru, Nakajima Jun-ichiro, Awazuhara Motoko, Inoue Eri, Takahashi Hideki, Goodenowe Dayan B, Kitayama Masahiko, Noji Masaaki, Yamazaki Mami, Saito Kazuki", "reference": { "type": "PubMed", "id": "15807784", "url": "https://pubmed.ncbi.nlm.nih.gov/15807784" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q0WW21-1", "protein_name": "UDP-glycosyltransferase 75C1", "gene_name": "UGT75C1", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q8VZW3-1", "protein_name": "Probable chalcone--flavanone isomerase 3", "gene_name": "CHI3", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9FE25-1", "protein_name": "Transcription factor MYB75", "gene_name": "MYB75", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9LFJ8-1", "protein_name": "Flavonol 3-O-glucosyltransferase", "gene_name": "UGT78D2", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "Q0WW21", "url": "https://www.uniprot.org/uniprotkb/Q0WW21" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.15807784", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 4 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The formation of Anthocyanic Vacuolar Inclusions in Arabidopsis thaliana and implications for the sequestration of anthocyanin pigments.", "journal": "Molecular plant", "date": "2010-01", "authors": "Pourcel Lucille, Irani Niloufer G, Lu Yuhua, Riedl Ken, Schwartz Steve, Grotewold Erich", "reference": { "type": "PubMed", "id": "20085894", "url": "https://pubmed.ncbi.nlm.nih.gov/20085894" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q0WW21-1", "protein_name": "UDP-glycosyltransferase 75C1", "gene_name": "UGT75C1", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q8VZ52-1", "protein_name": "Ubiquitin-like-conjugating enzyme ATG10", "gene_name": "ATG10", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9LFJ8-1", "protein_name": "Flavonol 3-O-glucosyltransferase", "gene_name": "UGT78D2", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "Q0WW21", "url": "https://www.uniprot.org/uniprotkb/Q0WW21" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.20085894", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "TDPOZ, a family of bipartite animal and plant proteins that contain the TRAF (TD) and POZ/BTB domains.", "journal": "Gene", "date": "2004", "authors": "Huang Chiu Jung, Chen Chung Yung, Chen Huang Hui, Tsai Shih Feng, Choo Kong Bung", "reference": { "type": "PubMed", "id": "14693377", "url": "https://pubmed.ncbi.nlm.nih.gov/14693377" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q1EBV6-1", "protein_name": "BTB/POZ and MATH domain-containing protein 5", "gene_name": "BPM5", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9M8J9-1", "protein_name": "BTB/POZ and MATH domain-containing protein 2", "gene_name": "BPM2", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "A1L4W5-1", "protein_name": "BTB/POZ and MATH domain-containing protein 6", "gene_name": "BPM6", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q717B2-1", "protein_name": "TD and POZ domain-containing protein 2", "gene_name": "Tdpoz2", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "Q6YCH1-1", "protein_name": "TD and POZ domain-containing protein 5", "gene_name": "Tdpoz5", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "P0DMR5-1", "protein_name": "TD and POZ domain-containing protein 1", "gene_name": "Tdpoz1", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "Q6YCH2-1", "protein_name": "TD and POZ domain-containing protein 4", "gene_name": "Tdpoz4", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "Q717B4-1", "protein_name": "TD and POZ domain-containing protein 3", "gene_name": "Tdpoz3", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "Q9SRV1-1", "protein_name": "BTB/POZ and MATH domain-containing protein 4", "gene_name": "BPM4", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q8L765-1", "protein_name": "BTB/POZ and MATH domain-containing protein 1", "gene_name": "BPM1", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "O22286-1", "protein_name": "BTB/POZ and MATH domain-containing protein 3", "gene_name": "BPM3", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "Q1EBV6", "url": "https://www.uniprot.org/uniprotkb/Q1EBV6" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.14693377", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 11 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Arabidopsis AtCUL3a and AtCUL3b form complexes with members of the BTB/POZ-MATH protein family.", "journal": "Plant Physiol.", "date": "2005", "authors": "Weber Henriette, Bernhardt Anne, Dieterle Monika, Hano Perdita, Mutlu Ayseg\u00fcl, Estelle Mark, Genschik Pascal, Hellmann Hanjo", "reference": { "type": "PubMed", "id": "15618422", "url": "https://pubmed.ncbi.nlm.nih.gov/15618422" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q1EBV6-1", "protein_name": "BTB/POZ and MATH domain-containing protein 5", "gene_name": "BPM5", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9M8J9-1", "protein_name": "BTB/POZ and MATH domain-containing protein 2", "gene_name": "BPM2", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9ZVH4-1", "protein_name": "Cullin-3A", "gene_name": "CUL3A", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "A1L4W5-1", "protein_name": "BTB/POZ and MATH domain-containing protein 6", "gene_name": "BPM6", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9SRV1-1", "protein_name": "BTB/POZ and MATH domain-containing protein 4", "gene_name": "BPM4", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q8L765-1", "protein_name": "BTB/POZ and MATH domain-containing protein 1", "gene_name": "BPM1", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9C9L0-1", "protein_name": "Cullin-3B", "gene_name": "CUL3B", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "O22286-1", "protein_name": "BTB/POZ and MATH domain-containing protein 3", "gene_name": "BPM3", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "Q1EBV6", "url": "https://www.uniprot.org/uniprotkb/Q1EBV6" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.15618422", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 8 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Arabidopsis thaliana BTB/ POZ-MATH proteins interact with members of the ERF/AP2 transcription factor family.", "journal": "FEBS J.", "date": "2009", "authors": "Weber Henriette, Hellmann Hanjo", "reference": { "type": "PubMed", "id": "19843165", "url": "https://pubmed.ncbi.nlm.nih.gov/19843165" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q1EBV6-1", "protein_name": "BTB/POZ and MATH domain-containing protein 5", "gene_name": "BPM5", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9M8J9-1", "protein_name": "BTB/POZ and MATH domain-containing protein 2", "gene_name": "BPM2", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q8H1E4-1", "protein_name": "Ethylene-responsive transcription factor RAP2-4", "gene_name": "RAP2-4", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "A1L4W5-1", "protein_name": "BTB/POZ and MATH domain-containing protein 6", "gene_name": "BPM6", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9SRV1-1", "protein_name": "BTB/POZ and MATH domain-containing protein 4", "gene_name": "BPM4", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q8L765-1", "protein_name": "BTB/POZ and MATH domain-containing protein 1", "gene_name": "BPM1", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9LM15-1", "protein_name": "Ethylene-responsive transcription factor RAP2-13", "gene_name": "RAP2-13", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "O22286-1", "protein_name": "BTB/POZ and MATH domain-containing protein 3", "gene_name": "BPM3", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "Q1EBV6", "url": "https://www.uniprot.org/uniprotkb/Q1EBV6" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.19843165", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 8 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Genome-wide analysis of LIM gene family in Populus trichocarpa, Arabidopsis thaliana, and Oryza sativa.", "journal": "DNA Res.", "date": "2007", "authors": "Arnaud Dominique, D\u00e9jardin Annabelle, Lepl\u00e9 Jean-Charles, Lesage-Descauses Marie-Claude, Pilate Gilles", "reference": { "type": "PubMed", "id": "17573466", "url": "https://pubmed.ncbi.nlm.nih.gov/17573466" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q1ECF5-1", "protein_name": "LIM domain-containing protein PLIM2b", "gene_name": "PLIM2B", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q500W4-1", "protein_name": "LIM domain-containing protein PLIM2c", "gene_name": "PLIM2C", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9M047-1", "protein_name": "LIM domain-containing protein WLIM2b", "gene_name": "WLIM2B", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "O04193-1", "protein_name": "LIM domain-containing protein WLIM2a", "gene_name": "WLIN2A", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "O80839-1", "protein_name": "LIM domain-containing protein PLIM2a", "gene_name": "PLIM2A", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q94JX5-1", "protein_name": "LIM domain-containing protein WLIM1", "gene_name": "WLIM1", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "Q1ECF5", "url": "https://www.uniprot.org/uniprotkb/Q1ECF5" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.17573466", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 6 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Arabidopsis LIM proteins: a family of actin bundlers with distinct expression patterns and modes of regulation.", "journal": "The Plant cell", "date": "2010-09", "authors": "Papuga Jessica, Hoffmann C\u00e9line, Dieterle Monika, Moes Dani\u00e8le, Moreau Flora, Tholl St\u00e9phane, Steinmetz Andr\u00e9, Thomas Cl\u00e9ment", "reference": { "type": "PubMed", "id": "20817848", "url": "https://pubmed.ncbi.nlm.nih.gov/20817848" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q1ECF5-1", "protein_name": "LIM domain-containing protein PLIM2b", "gene_name": "PLIM2B", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q500W4-1", "protein_name": "LIM domain-containing protein PLIM2c", "gene_name": "PLIM2C", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9M047-1", "protein_name": "LIM domain-containing protein WLIM2b", "gene_name": "WLIM2B", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "O04193-1", "protein_name": "LIM domain-containing protein WLIM2a", "gene_name": "WLIN2A", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "O80839-1", "protein_name": "LIM domain-containing protein PLIM2a", "gene_name": "PLIM2A", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q94JX5-1", "protein_name": "LIM domain-containing protein WLIM1", "gene_name": "WLIM1", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "Q1ECF5", "url": "https://www.uniprot.org/uniprotkb/Q1ECF5" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.20817848", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 6 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "SD3, an Arabidopsis thaliana homolog of TIM21, affects intracellular ATP levels and seedling development.", "journal": "Mol. Plant", "date": "2012", "authors": "Hamasaki Hidefumi, Yoshizumi Takeshi, Takahashi Naoki, Higuchi Mieko, Kuromori Takashi, Imura Yuko, Shimada Hiroaki, Matsui Minami", "reference": { "type": "PubMed", "id": "22131050", "url": "https://pubmed.ncbi.nlm.nih.gov/22131050" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q1G3L1-1", "protein_name": "Probable mitochondrial import inner membrane translocase subunit TIM21", "gene_name": "TIM21", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "Q1G3L1", "url": "https://www.uniprot.org/uniprotkb/Q1G3L1" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.22131050", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Dual location of the mitochondrial preprotein transporters B14.7 and Tim23-2 in complex I and the TIM17:23 complex in Arabidopsis links mitochondrial activity and biogenesis.", "journal": "Plant Cell", "date": "2012", "authors": "Wang Yan, Carrie Chris, Giraud Estelle, Elhafez Dina, Narsai Reena, Duncan Owen, Whelan James, Murcha Monika W", "reference": { "type": "PubMed", "id": "22730406", "url": "https://pubmed.ncbi.nlm.nih.gov/22730406" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q1G3L1-1", "protein_name": "Probable mitochondrial import inner membrane translocase subunit TIM21", "gene_name": "TIM21", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "O04308-1", "protein_name": "Probable mitochondrial-processing peptidase subunit alpha-2, chloroplastic/mitochondrial", "gene_name": "MPPalpha2", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q8VYE2-1", "protein_name": "Mitochondrial import inner membrane translocase subunit TIM50", "gene_name": "TIM50", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q38820-1", "protein_name": "Mitochondrial import inner membrane translocase subunit TIM23-2", "gene_name": "TIM23-2", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "O48528-1", "protein_name": "Outer envelope pore protein 16-3, chloroplastic/mitochondrial", "gene_name": "OEP163", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9SP35-1", "protein_name": "Mitochondrial import inner membrane translocase subunit TIM17-2", "gene_name": "TIM17-2", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "Q1G3L1", "url": "https://www.uniprot.org/uniprotkb/Q1G3L1" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.22730406", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 6 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "A role for diacylglycerol kinase\u00a04 in signalling crosstalk during Arabidopsis pollen tube growth.", "journal": "The New phytologist", "date": "2019-05", "authors": "Vaz Dias Fernando, Serrazina Susana, Vitorino Miguel, Marchese Dario, Heilmann Ingo, Godinho Margarida, Rodrigues M\u00e1rio, Malh\u00f3 Rui", "reference": { "type": "PubMed", "id": "30628082", "url": "https://pubmed.ncbi.nlm.nih.gov/30628082" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q1PDI2-1", "protein_name": "Diacylglycerol kinase 4", "gene_name": "DGK4", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "Q1PDI2", "url": "https://www.uniprot.org/uniprotkb/Q1PDI2" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.30628082", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Arabidopsis DIACYLGLYCEROL KINASE4 is involved in nitric oxide-dependent pollen tube guidance and fertilization.", "journal": "Development (Cambridge, England)", "date": "2020-04-27", "authors": "Wong Aloysius, Donaldson Lara, Portes Maria Teresa, Eppinger J\u00f6rg, Feij\u00f3 Jos\u00e9 A, Gehring Christoph", "reference": { "type": "PubMed", "id": "32220864", "url": "https://pubmed.ncbi.nlm.nih.gov/32220864" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q1PDI2-1", "protein_name": "Diacylglycerol kinase 4", "gene_name": "DGK4", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "Q1PDI2", "url": "https://www.uniprot.org/uniprotkb/Q1PDI2" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.32220864", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "A Pair of Arabidopsis Diacylglycerol Kinases Essential for Gametogenesis and Endoplasmic Reticulum Phospholipid Metabolism in Leaves and Flowers.", "journal": "The Plant cell", "date": "2020-08", "authors": "Angkawijaya Artik Elisa, Nguyen Van Cam, Gunawan Farrel, Nakamura Yuki", "reference": { "type": "PubMed", "id": "32471859", "url": "https://pubmed.ncbi.nlm.nih.gov/32471859" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q1PDI2-1", "protein_name": "Diacylglycerol kinase 4", "gene_name": "DGK4", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9FFN7-1", "protein_name": "Diacylglycerol kinase 2", "gene_name": "DGK2", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "Q1PDI2", "url": "https://www.uniprot.org/uniprotkb/Q1PDI2" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.32471859", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "A mitochondrial magnesium transporter functions in Arabidopsis pollen development.", "journal": "Molecular plant", "date": "2008-07", "authors": "Li Le-Gong, Sokolov Lubomir N, Yang Yong-Hua, Li Dong-Ping, Ting Julie, Pandy Girdhar K, Luan Sheng", "reference": { "type": "PubMed", "id": "19825572", "url": "https://pubmed.ncbi.nlm.nih.gov/19825572" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q1PE39-1", "protein_name": "Magnesium transporter MRS2-6, mitochondrial", "gene_name": "MRS2-6", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "Q1PE39", "url": "https://www.uniprot.org/uniprotkb/Q1PE39" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.19825572", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The secreted peptide PIP1 amplifies immunity through receptor-like kinase 7.", "journal": "PLoS pathogens", "date": "2014-09", "authors": "Hou Shuguo, Wang Xin, Chen Donghua, Yang Xue, Wang Mei, Turr\u00e0 David, Di Pietro Antonio, Zhang Wei", "reference": { "type": "PubMed", "id": "25188390", "url": "https://pubmed.ncbi.nlm.nih.gov/25188390" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q1PE40-1", "protein_name": "PAMP-induced secreted peptide 1", "gene_name": "PIP1", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "F4JRC5-1", "protein_name": "PAMP-induced secreted peptide 2", "gene_name": "PIP2", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "F4I2N7-1", "protein_name": "Receptor-like protein kinase 7", "gene_name": "RLK7", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "Q1PE40", "url": "https://www.uniprot.org/uniprotkb/Q1PE40" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.25188390", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Two closely related genes of Arabidopsis encode plastidial cytidinediphosphate diacylglycerol synthases essential for photoautotrophic growth.", "journal": "Plant physiology", "date": "2010-07", "authors": "Haselier Andr\u00e9, Akbari Hana, Weth Agnes, Baumgartner Werner, Frentzen Margrit", "reference": { "type": "PubMed", "id": "20442275", "url": "https://pubmed.ncbi.nlm.nih.gov/20442275" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q1PE48-1", "protein_name": "Phosphatidate cytidylyltransferase 3", "gene_name": "CDS3", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "O04928-1", "protein_name": "Phosphatidate cytidylyltransferase 1", "gene_name": "CDS1", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "O49639-1", "protein_name": "Phosphatidate cytidylyltransferase 2", "gene_name": "CDS2", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q94A03-1", "protein_name": "Phosphatidate cytidylyltransferase 4, chloroplastic", "gene_name": "CDS4", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9M001-1", "protein_name": "Phosphatidate cytidylyltransferase 5, chloroplastic", "gene_name": "CDS5", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "Q1PE48", "url": "https://www.uniprot.org/uniprotkb/Q1PE48" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.20442275", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 5 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Heat stress- and heat shock transcription factor-dependent expression and activity of ascorbate peroxidase in Arabidopsis.", "journal": "Plant Physiol.", "date": "2002", "authors": "Panchuk Irina I, Volkov Roman A, Sch\u00f6ffl Friedrich", "reference": { "type": "PubMed", "id": "12068123", "url": "https://pubmed.ncbi.nlm.nih.gov/12068123" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q1PER6-1", "protein_name": "L-ascorbate peroxidase 2, cytosolic", "gene_name": "APX2", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q7XZP5-1", "protein_name": "L-ascorbate peroxidase 5, peroxisomal", "gene_name": "APX5", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "P82281-1", "protein_name": "Thylakoid lumenal 29 kDa protein, chloroplastic", "gene_name": "TL29", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "Q1PER6", "url": "https://www.uniprot.org/uniprotkb/Q1PER6" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.12068123", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Control of Ascorbate Peroxidase 2 expression by hydrogen peroxide and leaf water status during excess light stress reveals a functional organisation of Arabidopsis leaves.", "journal": "The Plant journal : for cell and molecular biology", "date": "2003-02", "authors": "Fryer Michael J, Ball Louise, Oxborough Kevin, Karpinski Stanislaw, Mullineaux Philip M, Baker Neil R", "reference": { "type": "PubMed", "id": "12609042", "url": "https://pubmed.ncbi.nlm.nih.gov/12609042" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q1PER6-1", "protein_name": "L-ascorbate peroxidase 2, cytosolic", "gene_name": "APX2", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "P49597-1", "protein_name": "Protein phosphatase 2C 56", "gene_name": "ABI1", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "O04719-1", "protein_name": "Protein phosphatase 2C 77", "gene_name": "ABI2", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "Q1PER6", "url": "https://www.uniprot.org/uniprotkb/Q1PER6" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.12609042", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Induction of ASCORBATE PEROXIDASE 2 expression in wounded Arabidopsis leaves does not involve known wound-signalling pathways but is associated with changes in photosynthesis.", "journal": "Plant J.", "date": "2004", "authors": "Chang Christine Chi-Chen, Ball Louise, Fryer Michael J, Baker Neil R, Karpinski Stanislaw, Mullineaux Philip M", "reference": { "type": "PubMed", "id": "15086807", "url": "https://pubmed.ncbi.nlm.nih.gov/15086807" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q1PER6-1", "protein_name": "L-ascorbate peroxidase 2, cytosolic", "gene_name": "APX2", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "Q1PER6", "url": "https://www.uniprot.org/uniprotkb/Q1PER6" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.15086807", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Cytosolic ascorbate peroxidase from Arabidopsis thaliana L. is encoded by a small multigene family.", "journal": "Planta", "date": "1996", "authors": "Santos M, Gousseau H, Lister C, Foyer C, Creissen G, Mullineaux P", "reference": { "type": "PubMed", "id": "8580771", "url": "https://pubmed.ncbi.nlm.nih.gov/8580771" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q1PER6-1", "protein_name": "L-ascorbate peroxidase 2, cytosolic", "gene_name": "APX2", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "Q1PER6", "url": "https://www.uniprot.org/uniprotkb/Q1PER6" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.8580771", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Photosynthetic electron transport regulates the expression of cytosolic ascorbate peroxidase genes in Arabidopsis during excess light stress.", "journal": "Plant Cell", "date": "1997", "authors": "Karpinski S, Escobar C, Karpinska B, Creissen G, Mullineaux P M", "reference": { "type": "PubMed", "id": "9144965", "url": "https://pubmed.ncbi.nlm.nih.gov/9144965" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q1PER6-1", "protein_name": "L-ascorbate peroxidase 2, cytosolic", "gene_name": "APX2", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q05431-1", "protein_name": "L-ascorbate peroxidase 1, cytosolic", "gene_name": "APX1", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q42564-1", "protein_name": "L-ascorbate peroxidase 3", "gene_name": "APX3", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "Q1PER6", "url": "https://www.uniprot.org/uniprotkb/Q1PER6" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.9144965", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Identification of genes involved in the ACC-mediated control of root cell elongation in Arabidopsis thaliana.", "journal": "BMC Plant Biol.", "date": "2012", "authors": "Markakis Marios Nektarios, De Cnodder Tinne, Lewandowski Michal, Simon Damien, Boron Agnieszka, Balcerowicz Daria, Doubbo Thanaa, Taconnat Ludivine, Renou Jean-Pierre, H\u00f6fte Herman, Verbelen Jean-Pierre, Vissenberg Kris", "reference": { "type": "PubMed", "id": "23134674", "url": "https://pubmed.ncbi.nlm.nih.gov/23134674" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q29PU2-1", "protein_name": "Auxin-responsive protein SAUR76", "gene_name": "SAUR76", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q6NMD6-1", "protein_name": "Protein AUXIN-REGULATED GENE INVOLVED IN ORGAN SIZE", "gene_name": "ARGOS", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "Q29PU2", "url": "https://www.uniprot.org/uniprotkb/Q29PU2" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.23134674", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Characterization of a small auxin-up RNA (SAUR)-like gene involved in Arabidopsis thaliana development.", "journal": "PloS one", "date": "2013", "authors": "Markakis Marios Nektarios, Boron Agnieszka Karolina, Van Loock Bram, Saini Kumud, Cirera Susanna, Verbelen Jean-Pierre, Vissenberg Kris", "reference": { "type": "PubMed", "id": "24312429", "url": "https://pubmed.ncbi.nlm.nih.gov/24312429" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q29PU2-1", "protein_name": "Auxin-responsive protein SAUR76", "gene_name": "SAUR76", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "Q29PU2", "url": "https://www.uniprot.org/uniprotkb/Q29PU2" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.24312429", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Three SAUR proteins SAUR76, SAUR77 and SAUR78 promote plant growth in Arabidopsis.", "journal": "Scientific reports", "date": "2015-07-24", "authors": "Li Zhi-Gang, Chen Hao-Wei, Li Qing-Tian, Tao Jian-Jun, Bian Xiao-Hua, Ma Biao, Zhang Wan-Ke, Chen Shou-Yi, Zhang Jin-Song", "reference": { "type": "PubMed", "id": "26207341", "url": "https://pubmed.ncbi.nlm.nih.gov/26207341" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q29PU2-1", "protein_name": "Auxin-responsive protein SAUR76", "gene_name": "SAUR76", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9LQI6-1", "protein_name": "Auxin-responsive protein SAUR77", "gene_name": "SAUR77", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9C9E1-1", "protein_name": "Auxin-responsive protein SAUR78", "gene_name": "SAUR78", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9ZTP3-1", "protein_name": "Protein EIN4", "gene_name": "EIN4", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q0WPQ2-1", "protein_name": "Ethylene receptor 2", "gene_name": "ETR2", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "Q29PU2", "url": "https://www.uniprot.org/uniprotkb/Q29PU2" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.26207341", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 5 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "ANKYRIN REPEAT-CONTAINING PROTEIN 2A is an essential molecular chaperone for peroxisomal membrane-bound ASCORBATE PEROXIDASE3 in Arabidopsis.", "journal": "Plant Cell", "date": "2010", "authors": "Shen Guoxin, Kuppu Sundaram, Venkataramani Sujatha, Wang Jing, Yan Juqiang, Qiu Xiaoyun, Zhang Hong", "reference": { "type": "PubMed", "id": "20215589", "url": "https://pubmed.ncbi.nlm.nih.gov/20215589" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q29Q26-1", "protein_name": "Ankyrin repeat domain-containing protein 2B", "gene_name": "AKR2B", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9ZNT1-1", "protein_name": "NADH--cytochrome b5 reductase 1", "gene_name": "CBR1", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q7XZP5-1", "protein_name": "L-ascorbate peroxidase 5, peroxisomal", "gene_name": "APX5", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q38906-1", "protein_name": "Translocase of chloroplast 34, chloroplastic", "gene_name": "TOC34", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "P82805-1", "protein_name": "Mitochondrial import receptor subunit TOM20-4", "gene_name": "TOM20-4", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q42342-1", "protein_name": "Cytochrome b5 isoform E", "gene_name": "CYTB5-E", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q42564-1", "protein_name": "L-ascorbate peroxidase 3", "gene_name": "APX3", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9SAR5-1", "protein_name": "Ankyrin repeat domain-containing protein 2A", "gene_name": "AKR2A; AKR2", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "Q29Q26", "url": "https://www.uniprot.org/uniprotkb/Q29Q26" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "mutagenesis": [ { "start_pos": 113, "end_pos": 113, "sequence_org": "P", "sequence_mut": "L", "comment": "In akr2a-3; small plants with small and curled rosette leaves, as well as delayed flowering, especially in chilling temperature conditions. Abnormal abaxial epidermal wavy cell shape and absence of cell boundaries between the neighboring surface cells. Impaired interaction with APX3.", "evidence": [ { "database": "UniProtKB", "id": "Q9SAR5", "url": "https://www.uniprot.org/uniprotkb/Q9SAR5" }, { "database": "PubMed", "id": "20215589", "url": "https://pubmed.ncbi.nlm.nih.gov/20215589" } ], "uniprot_canonical_ac": "Q9SAR5-1" }, { "start_pos": 150, "end_pos": 150, "sequence_org": "E", "sequence_mut": "K", "comment": "In akr2a-6; small plants with small and curled rosette leaves, as well as delayed flowering, especially in chilling temperature conditions. Reduced interaction with APX3.", "evidence": [ { "database": "UniProtKB", "id": "Q9SAR5", "url": "https://www.uniprot.org/uniprotkb/Q9SAR5" }, { "database": "PubMed", "id": "20215589", "url": "https://pubmed.ncbi.nlm.nih.gov/20215589" } ], "uniprot_canonical_ac": "Q9SAR5-1" }, { "start_pos": 25, "end_pos": 25, "sequence_org": "S", "sequence_mut": "F", "comment": "In akr2a-1; small plants with small and curled rosette leaves, as well as delayed flowering, especially in chilling temperature conditions. Abnormal abaxial epidermal wavy cell shape and absence of cell boundaries between the neighboring surface cells. Impaired interaction with APX3.", "evidence": [ { "database": "UniProtKB", "id": "Q9SAR5", "url": "https://www.uniprot.org/uniprotkb/Q9SAR5" }, { "database": "PubMed", "id": "20215589", "url": "https://pubmed.ncbi.nlm.nih.gov/20215589" } ], "uniprot_canonical_ac": "Q9SAR5-1" } ], "record_id": "pubmed.20215589", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 8 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Transport of UDP-galactose in plants. Identification and functional characterization of AtUTr1, an Arabidopsis thaliana UDP-galactose/UDP-glucose transporter.", "journal": "J. Biol. Chem.", "date": "2002", "authors": "Norambuena Lorena, Marchant Lorena, Berninsone Patricia, Hirschberg Carlos B, Silva Herman, Orellana Ariel", "reference": { "type": "PubMed", "id": "12042319", "url": "https://pubmed.ncbi.nlm.nih.gov/12042319" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q29Q28-1", "protein_name": "UDP-galactose/UDP-glucose transporter 2", "gene_name": "UTR2", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9LDX3-1", "protein_name": "UDP-galactose/UDP-glucose transporter 4", "gene_name": "UTR4", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "O64503-1", "protein_name": "UDP-galactose/UDP-glucose transporter 1", "gene_name": "UTR1", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q6NM25-1", "protein_name": "UDP-galactose/UDP-glucose transporter 5", "gene_name": "UTR5", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q6NMB6-1", "protein_name": "UDP-galactose/UDP-glucose transporter 5B", "gene_name": "UTR5B", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9C5H6-1", "protein_name": "CMP-sialic acid transporter 3", "gene_name": "UTR6", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9M9S6-1", "protein_name": "UDP-galactose/UDP-glucose transporter 3", "gene_name": "UTR3", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "Q29Q28", "url": "https://www.uniprot.org/uniprotkb/Q29Q28" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.12042319", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 7 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "AtUTr2 is an Arabidopsis thaliana nucleotide sugar transporter located in the Golgi apparatus capable of transporting UDP-galactose.", "journal": "Planta", "date": "2005-10", "authors": "Norambuena Lorena, Nilo Ricardo, Handford Michael, Reyes Francisca, Marchant Lorena, Meisel Lee, Orellana Ariel", "reference": { "type": "PubMed", "id": "15891899", "url": "https://pubmed.ncbi.nlm.nih.gov/15891899" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q29Q28-1", "protein_name": "UDP-galactose/UDP-glucose transporter 2", "gene_name": "UTR2", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "Q29Q28", "url": "https://www.uniprot.org/uniprotkb/Q29Q28" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.15891899", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Expression and genome-wide analysis of the xylogen-type gene family.", "journal": "Plant Cell Physiol.", "date": "2011", "authors": "Kobayashi Yuuki, Motose Hiroyasu, Iwamoto Kuninori, Fukuda Hiroo", "reference": { "type": "PubMed", "id": "21558309", "url": "https://pubmed.ncbi.nlm.nih.gov/21558309" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q2PE59-1", "protein_name": "Non-specific lipid transfer protein GPI-anchored 26", "gene_name": "LTPG26", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q2PE70-1", "protein_name": "Non-specific lipid transfer protein GPI-anchored 4", "gene_name": "LTPG4", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9ZQI8-1", "protein_name": "Non-specific lipid transfer protein GPI-anchored 11", "gene_name": "LTPG11; XYP2", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "F4I082-1", "protein_name": "Non-specific lipid transfer protein GPI-anchored 6", "gene_name": "LTPG6", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "O64864-1", "protein_name": "Non-specific lipid transfer protein GPI-anchored 13", "gene_name": "LTPG13", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "O64865-1", "protein_name": "Non-specific lipid transfer protein GPI-anchored 14", "gene_name": "LTPG14", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9ZVC7-1", "protein_name": "Non-specific lipid transfer protein GPI-anchored 12", "gene_name": "LTPG12", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q2PE60-1", "protein_name": "Non-specific lipid transfer protein GPI-anchored 23", "gene_name": "LTPG23", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q8VYI9-1", "protein_name": "Non-specific lipid transfer protein GPI-anchored 31", "gene_name": "LTPG31", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9LJ86-1", "protein_name": "Non-specific lipid transfer protein GPI-anchored 5", "gene_name": "LTPG5", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9LZH5-1", "protein_name": "Non-specific lipid transfer protein GPI-anchored 2", "gene_name": "LTPG2", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q7EB72-1", "protein_name": "Non-specific lipid transfer protein GPI-anchored 15", "gene_name": "LTPG15", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9FY78-1", "protein_name": "Non-specific lipid transfer protein GPI-anchored 29", "gene_name": "LTPG29", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "Q2PE59", "url": "https://www.uniprot.org/uniprotkb/Q2PE59" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.21558309", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 13 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "SETH1 and SETH2, two components of the glycosylphosphatidylinositol anchor biosynthetic pathway, are required for pollen germination and tube growth in Arabidopsis.", "journal": "Plant Cell", "date": "2004", "authors": "Lalanne Eric, Honys David, Johnson Andrew, Borner Georg H H, Lilley Kathryn S, Dupree Paul, Grossniklaus Ueli, Twell David", "reference": { "type": "PubMed", "id": "14671020", "url": "https://pubmed.ncbi.nlm.nih.gov/14671020" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q2PE70-1", "protein_name": "Non-specific lipid transfer protein GPI-anchored 4", "gene_name": "LTPG4", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "O64761-1", "protein_name": "Phosphatidylinositol N-acetylglucosaminyltransferase subunit C", "gene_name": "PIGC", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q94BX4-1", "protein_name": "Phosphatidylinositol N-acetylglucosaminyltransferase subunit A", "gene_name": "PIGA", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9LE56-1", "protein_name": "Non-specific lipid transfer protein GPI-anchored 3", "gene_name": "LTPG3", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "Q2PE70", "url": "https://www.uniprot.org/uniprotkb/Q2PE70" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.14671020", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 4 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Involvement of GPI-anchored lipid transfer proteins in the development of seed coats and pollen in Arabidopsis thaliana.", "journal": "Physiologia plantarum", "date": "2014-09", "authors": "Edstam Monika M, Edqvist Johan", "reference": { "type": "PubMed", "id": "24460633", "url": "https://pubmed.ncbi.nlm.nih.gov/24460633" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q2PE70-1", "protein_name": "Non-specific lipid transfer protein GPI-anchored 4", "gene_name": "LTPG4", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "F4I082-1", "protein_name": "Non-specific lipid transfer protein GPI-anchored 6", "gene_name": "LTPG6", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9LE56-1", "protein_name": "Non-specific lipid transfer protein GPI-anchored 3", "gene_name": "LTPG3", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9C7F7-1", "protein_name": "Non-specific lipid transfer protein GPI-anchored 1", "gene_name": "LTPG1", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9LJ86-1", "protein_name": "Non-specific lipid transfer protein GPI-anchored 5", "gene_name": "LTPG5", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9LZH5-1", "protein_name": "Non-specific lipid transfer protein GPI-anchored 2", "gene_name": "LTPG2", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "Q2PE70", "url": "https://www.uniprot.org/uniprotkb/Q2PE70" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.24460633", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 6 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Involvement of lipid transfer proteins in resistance against a non-host powdery mildew in Arabidopsis thaliana.", "journal": "Mol. Plant Pathol.", "date": "2019", "authors": "Fahlberg Per, Buhot Nathalie, Johansson Oskar N, Andersson Mats X", "reference": { "type": "PubMed", "id": "30102837", "url": "https://pubmed.ncbi.nlm.nih.gov/30102837" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q2PE70-1", "protein_name": "Non-specific lipid transfer protein GPI-anchored 4", "gene_name": "LTPG4", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "F4I082-1", "protein_name": "Non-specific lipid transfer protein GPI-anchored 6", "gene_name": "LTPG6", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9LE56-1", "protein_name": "Non-specific lipid transfer protein GPI-anchored 3", "gene_name": "LTPG3", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9C7F7-1", "protein_name": "Non-specific lipid transfer protein GPI-anchored 1", "gene_name": "LTPG1", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9LJ86-1", "protein_name": "Non-specific lipid transfer protein GPI-anchored 5", "gene_name": "LTPG5", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9LZH5-1", "protein_name": "Non-specific lipid transfer protein GPI-anchored 2", "gene_name": "LTPG2", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "Q2PE70", "url": "https://www.uniprot.org/uniprotkb/Q2PE70" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.30102837", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 6 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Characterization of a Mis12 homologue in Arabidopsis thaliana.", "journal": "Chromosome research : an international journal on the molecular, supramolecular and evolutionary aspects of chromosome biology", "date": "2005", "authors": "Sato Hiroshi, Shibata Fukashi, Murata Minoru", "reference": { "type": "PubMed", "id": "16331414", "url": "https://pubmed.ncbi.nlm.nih.gov/16331414" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q2V0Z5-1", "protein_name": "Protein MIS12 homolog", "gene_name": "MIS12", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "Q2V0Z5", "url": "https://www.uniprot.org/uniprotkb/Q2V0Z5" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.16331414", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Meiosis-specific loading of the centromere-specific histone CENH3 in Arabidopsis thaliana.", "journal": "PLoS genetics", "date": "2011-06", "authors": "Ravi Maruthachalam, Shibata Fukashi, Ramahi Joseph S, Nagaki Kiyotaka, Chen Changbin, Murata Minoru, Chan Simon W L", "reference": { "type": "PubMed", "id": "21695238", "url": "https://pubmed.ncbi.nlm.nih.gov/21695238" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q2V0Z5-1", "protein_name": "Protein MIS12 homolog", "gene_name": "MIS12", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q8RVQ9-1", "protein_name": "Histone H3-like centromeric protein CENH3", "gene_name": "CENH3", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "Q2V0Z5", "url": "https://www.uniprot.org/uniprotkb/Q2V0Z5" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.21695238", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Three PsbQ-like proteins are required for the function of the chloroplast NAD(P)H dehydrogenase complex in Arabidopsis.", "journal": "Plant & cell physiology", "date": "2010-06", "authors": "Yabuta Shinya, Ifuku Kentaro, Takabayashi Atsushi, Ishihara Seiko, Ido Kunio, Ishikawa Noriko, Endo Tsuyoshi, Sato Fumihiko", "reference": { "type": "PubMed", "id": "20430763", "url": "https://pubmed.ncbi.nlm.nih.gov/20430763" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q2V4B2-1", "protein_name": "PsbQ-like protein 3, chloroplastic", "gene_name": "PQL3", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9XI73-1", "protein_name": "Photosynthetic NDH subunit of lumenal location 2, chloroplastic", "gene_name": "PNSL2", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9SGH4-1", "protein_name": "Photosynthetic NDH subunit of lumenal location 3, chloroplastic", "gene_name": "PNSL3", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "Q2V4B2", "url": "https://www.uniprot.org/uniprotkb/Q2V4B2" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.20430763", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Fine sequence analysis of 60 kb around the Arabidopsis thaliana AtEm1 locus on chromosome III.", "journal": "Plant Mol. Biol.", "date": "1999", "authors": "Comella P, Wu H J, Laudie M, Berger C, Cooke R, Delseny M, Grellet F", "reference": { "type": "PubMed", "id": "10645728", "url": "https://pubmed.ncbi.nlm.nih.gov/10645728" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q38833-1", "protein_name": "Chlorophyll synthase, chloroplastic", "gene_name": "CHLG", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9SV13-1", "protein_name": "Sulfate transporter 3.1", "gene_name": "1; SULTR3", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q96328-1", "protein_name": "Phosphoinositide phosphatase SAC8", "gene_name": "SAC8", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q96326-1", "protein_name": "Cytochrome c-type biogenesis protein CcmE homolog, mitochondrial", "gene_name": "CCME", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "F4J5M9-1", "protein_name": "Clathrin light chain 3", "gene_name": "ATEM1.14", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "O65023-1", "protein_name": "Probable envelope ADP,ATP carrier protein, chloroplastic", "gene_name": "EAAC", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q07187-1", "protein_name": "Em-like protein GEA1", "gene_name": "EM1", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q8RX71-1", "protein_name": "BAG family molecular chaperone regulator 4", "gene_name": "BAG4", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q8W4I7-1", "protein_name": "Calcium-dependent protein kinase 13", "gene_name": "CPK13", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "O65020-1", "protein_name": "Ethylene-overproduction protein 1", "gene_name": "ETO1", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "O49595-1", "protein_name": "High mobility group B protein 1", "gene_name": "HMGB1", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q96327-1", "protein_name": "ERBB-3 BINDING PROTEIN 1", "gene_name": "EBP1", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q96329-1", "protein_name": "Acyl-coenzyme A oxidase 4, peroxisomal", "gene_name": "ACX4", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q93Z81-1", "protein_name": "Vacuolar cation/proton exchanger 3", "gene_name": "CAX3", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "Q38833", "url": "https://www.uniprot.org/uniprotkb/Q38833" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.10645728", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 14 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "A chlorophyll synthetase gene from Arabidopsis thaliana.", "journal": "Mol. Gen. Genet.", "date": "1995", "authors": "Gaubier P, Wu H J, Laudi\u00e9 M, Delseny M, Grellet F", "reference": { "type": "PubMed", "id": "8552034", "url": "https://pubmed.ncbi.nlm.nih.gov/8552034" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q38833-1", "protein_name": "Chlorophyll synthase, chloroplastic", "gene_name": "CHLG", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "Q38833", "url": "https://www.uniprot.org/uniprotkb/Q38833" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.8552034", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "A novel myb-related gene from Arabidopsis thaliana.", "journal": "FEBS Lett.", "date": "1996", "authors": "Li S F, Santini J M, Nicolaou O, Parish R W", "reference": { "type": "PubMed", "id": "8635574", "url": "https://pubmed.ncbi.nlm.nih.gov/8635574" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q38850-1", "protein_name": "Transcription repressor MYB5", "gene_name": "MYB5", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "Q38850", "url": "https://www.uniprot.org/uniprotkb/Q38850" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.8635574", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Identification of a light-regulated MYB gene from an Arabidopsis transcription factor gene collection.", "journal": "Plant Mol. Biol.", "date": "1996", "authors": "Quaedvlieg N, Dockx J, Keultjes G, Kock P, Wilmering J, Weisbeek P, Smeekens S", "reference": { "type": "PubMed", "id": "8980549", "url": "https://pubmed.ncbi.nlm.nih.gov/8980549" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q38850-1", "protein_name": "Transcription repressor MYB5", "gene_name": "MYB5", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9LDR8-1", "protein_name": "Transcription factor MYB102", "gene_name": "MYB102", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9LTC4-1", "protein_name": "Transcription factor MYB15", "gene_name": "MYB15", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q42379-1", "protein_name": "Transcription factor MYB7", "gene_name": "MYB7", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "Q38850", "url": "https://www.uniprot.org/uniprotkb/Q38850" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.8980549", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 4 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Characterization of the cyclophilin gene family of Arabidopsis thaliana and phylogenetic analysis of known cyclophilin proteins.", "journal": "Plant Mol. Biol.", "date": "1997", "authors": "Chou I T, Gasser C S", "reference": { "type": "PubMed", "id": "9426607", "url": "https://pubmed.ncbi.nlm.nih.gov/9426607" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q38867-1", "protein_name": "Peptidyl-prolyl cis-trans isomerase CYP19-3", "gene_name": "CYP19-3", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "P34791-1", "protein_name": "Peptidyl-prolyl cis-trans isomerase CYP20-3, chloroplastic", "gene_name": "CYP20-3; ROC4", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "P34790-1", "protein_name": "Peptidyl-prolyl cis-trans isomerase CYP18-3", "gene_name": "CYP18-3", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q38900-1", "protein_name": "Peptidyl-prolyl cis-trans isomerase CYP19-1", "gene_name": "CYP19-1", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q42406-1", "protein_name": "Peptidyl-prolyl cis-trans isomerase CYP18-4", "gene_name": "CYP18-4", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "Q38867", "url": "https://www.uniprot.org/uniprotkb/Q38867" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.9426607", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 5 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Genetic structure and evolution of RAC-GTPases in Arabidopsis thaliana.", "journal": "Genetics", "date": "2000", "authors": "Winge P, Brembu T, Kristensen R, Bones A M", "reference": { "type": "PubMed", "id": "11102387", "url": "https://pubmed.ncbi.nlm.nih.gov/11102387" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q38903-1", "protein_name": "Rac-like GTP-binding protein ARAC2", "gene_name": "ARAC2", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9XGU0-1", "protein_name": "Rac-like GTP-binding protein ARAC9", "gene_name": "ARAC9", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "O82481-1", "protein_name": "Rac-like GTP-binding protein ARAC10", "gene_name": "ARAC10; RAC10", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "O82480-1", "protein_name": "Rac-like GTP-binding protein ARAC7", "gene_name": "ARAC7", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q38912-1", "protein_name": "Rac-like GTP-binding protein ARAC3", "gene_name": "ARAC3; RAC3", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "P92978-1", "protein_name": "Rac-like GTP-binding protein ARAC11", "gene_name": "ARAC11", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q38902-1", "protein_name": "Rac-like GTP-binding protein ARAC1", "gene_name": "ARAC1", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q38919-1", "protein_name": "Rac-like GTP-binding protein ARAC4", "gene_name": "ARAC4", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q38937-1", "protein_name": "Rac-like GTP-binding protein ARAC5", "gene_name": "ARAC5", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9SBJ6-1", "protein_name": "Rac-like GTP-binding protein ARAC6", "gene_name": "ARAC6", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9SU67-1", "protein_name": "Rac-like GTP-binding protein ARAC8", "gene_name": "ARAC8; ROP10", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "Q38903", "url": "https://www.uniprot.org/uniprotkb/Q38903" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.11102387", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 11 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Cloning and characterization of rac-like cDNAs from Arabidopsis thaliana.", "journal": "Plant Mol. Biol.", "date": "1997", "authors": "Winge P, Brembu T, Bones A M", "reference": { "type": "PubMed", "id": "9349271", "url": "https://pubmed.ncbi.nlm.nih.gov/9349271" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q38903-1", "protein_name": "Rac-like GTP-binding protein ARAC2", "gene_name": "ARAC2", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "O82481-1", "protein_name": "Rac-like GTP-binding protein ARAC10", "gene_name": "ARAC10; RAC10", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q38912-1", "protein_name": "Rac-like GTP-binding protein ARAC3", "gene_name": "ARAC3; RAC3", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q38902-1", "protein_name": "Rac-like GTP-binding protein ARAC1", "gene_name": "ARAC1", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q38919-1", "protein_name": "Rac-like GTP-binding protein ARAC4", "gene_name": "ARAC4", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q38937-1", "protein_name": "Rac-like GTP-binding protein ARAC5", "gene_name": "ARAC5", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "Q38903", "url": "https://www.uniprot.org/uniprotkb/Q38903" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.9349271", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 6 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Plant profilin isovariants are distinctly regulated in vegetative and reproductive tissues.", "journal": "Cell Motil. Cytoskeleton", "date": "2002", "authors": "Kandasamy Muthugapatti K, McKinney Elizabeth C, Meagher Richard B", "reference": { "type": "PubMed", "id": "11977080", "url": "https://pubmed.ncbi.nlm.nih.gov/11977080" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q38904-1", "protein_name": "Profilin-4", "gene_name": "PRF4", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q38905-1", "protein_name": "Profilin-5", "gene_name": "PRF5", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "Q38904", "url": "https://www.uniprot.org/uniprotkb/Q38904" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.11977080", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Arabidopsis group Ie formins localize to specific cell membrane domains, interact with actin-binding proteins and cause defects in cell expansion upon aberrant expression.", "journal": "The New phytologist", "date": "2005-12", "authors": "Deeks Michael J, Cvrckov\u00e1 Fatima, Machesky Laura M, Mikitov\u00e1 Veronika, Ketelaar Tijs, Z\u00e1rsky Viktor, Davies Brendan, Hussey Patrick J", "reference": { "type": "PubMed", "id": "16313636", "url": "https://pubmed.ncbi.nlm.nih.gov/16313636" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q38904-1", "protein_name": "Profilin-4", "gene_name": "PRF4", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "O48682-1", "protein_name": "Formin-like protein 4", "gene_name": "FH4", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "O04532-1", "protein_name": "Formin-like protein 8", "gene_name": "FH8", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q42418-1", "protein_name": "Profilin-2", "gene_name": "PRF2", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "Q38904", "url": "https://www.uniprot.org/uniprotkb/Q38904" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.16313636", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 4 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Class-specific interaction of profilin and ADF isovariants with actin in the regulation of plant development.", "journal": "Plant Cell", "date": "2007", "authors": "Kandasamy Muthugapatti K, Burgos-Rivera Brunil\u00eds, McKinney Elizabeth C, Ruzicka Daniel R, Meagher Richard B", "reference": { "type": "PubMed", "id": "17933902", "url": "https://pubmed.ncbi.nlm.nih.gov/17933902" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q38904-1", "protein_name": "Profilin-4", "gene_name": "PRF4", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q570Y6-1", "protein_name": "Actin-depolymerizing factor 8", "gene_name": "ADF8", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q42449-1", "protein_name": "Profilin-1", "gene_name": "PRF1", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "Q38904", "url": "https://www.uniprot.org/uniprotkb/Q38904" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.17933902", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Profilin Regulates Apical Actin Polymerization to Control Polarized Pollen Tube Growth.", "journal": "Molecular plant", "date": "2015-12-07", "authors": "Liu Xiaonan, Qu Xiaolu, Jiang Yuxiang, Chang Ming, Zhang Ruihui, Wu Youjun, Fu Ying, Huang Shanjin", "reference": { "type": "PubMed", "id": "26433093", "url": "https://pubmed.ncbi.nlm.nih.gov/26433093" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q38904-1", "protein_name": "Profilin-4", "gene_name": "PRF4", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q38905-1", "protein_name": "Profilin-5", "gene_name": "PRF5", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "Q38904", "url": "https://www.uniprot.org/uniprotkb/Q38904" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.26433093", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "A Processive Arabidopsis Formin Modulates Actin Filament Dynamics in Association with Profilin.", "journal": "Molecular plant", "date": "2016-06-06", "authors": "Zhang Sha, Liu Chang, Wang Jiaojiao, Ren Zhanhong, Staiger Christopher J, Ren Haiyun", "reference": { "type": "PubMed", "id": "26996265", "url": "https://pubmed.ncbi.nlm.nih.gov/26996265" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q38904-1", "protein_name": "Profilin-4", "gene_name": "PRF4", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q42418-1", "protein_name": "Profilin-2", "gene_name": "PRF2", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "Q38904", "url": "https://www.uniprot.org/uniprotkb/Q38904" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.26996265", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Profilin Negatively Regulates Formin-Mediated Actin Assembly to Modulate PAMP-Triggered Plant Immunity.", "journal": "Current biology : CB", "date": "2018-06-18", "authors": "Sun He, Qiao Zhu, Chua Khi Pin, Tursic Alma, Liu Xu, Gao Yong-Gui, Mu Yuguang, Hou Xingliang, Miao Yansong", "reference": { "type": "PubMed", "id": "29861135", "url": "https://pubmed.ncbi.nlm.nih.gov/29861135" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q38904-1", "protein_name": "Profilin-4", "gene_name": "PRF4", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9FE63-1", "protein_name": "Profilin-3", "gene_name": "PRF3", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q38905-1", "protein_name": "Profilin-5", "gene_name": "PRF5", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q42418-1", "protein_name": "Profilin-2", "gene_name": "PRF2", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q42449-1", "protein_name": "Profilin-1", "gene_name": "PRF1", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "Q38904", "url": "https://www.uniprot.org/uniprotkb/Q38904" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "mutagenesis": [ { "start_pos": 1, "end_pos": 37, "sequence_org": "MPLPHTHSLVVSTLSLEHSDKPQRRSRAKVKKKKKTN", "sequence_mut": "", "comment": "Increases binding to G-actin; increases protein thermostability.", "evidence": [ { "database": "UniProtKB", "id": "Q9FE63", "url": "https://www.uniprot.org/uniprotkb/Q9FE63" }, { "database": "PubMed", "id": "23052593", "url": "https://pubmed.ncbi.nlm.nih.gov/23052593" }, { "database": "PubMed", "id": "29861135", "url": "https://pubmed.ncbi.nlm.nih.gov/29861135" } ], "uniprot_canonical_ac": "Q9FE63-1" } ], "record_id": "pubmed.29861135", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 5 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Arabidopsis profilins are functionally similar to yeast profilins: identification of a vascular bundle-specific profilin and a pollen-specific profilin.", "journal": "Plant J.", "date": "1996", "authors": "Christensen H E, Ramachandran S, Tan C T, Surana U, Dong C H, Chua N H", "reference": { "type": "PubMed", "id": "8771785", "url": "https://pubmed.ncbi.nlm.nih.gov/8771785" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q38904-1", "protein_name": "Profilin-4", "gene_name": "PRF4", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q38905-1", "protein_name": "Profilin-5", "gene_name": "PRF5", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q42418-1", "protein_name": "Profilin-2", "gene_name": "PRF2", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q42449-1", "protein_name": "Profilin-1", "gene_name": "PRF1", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "Q38904", "url": "https://www.uniprot.org/uniprotkb/Q38904" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.8771785", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 4 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Expression of endoxyloglucan transferase genes in acaulis mutants of Arabidopsis.", "journal": "Plant Physiol.", "date": "1999", "authors": "Akamatsu T, Hanzawa Y, Ohtake Y, Takahashi T, Nishitani K, Komeda Y", "reference": { "type": "PubMed", "id": "10557219", "url": "https://pubmed.ncbi.nlm.nih.gov/10557219" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q38907-1", "protein_name": "Probable xyloglucan endotransglucosylase/hydrolase protein 25", "gene_name": "XTH25", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9XIW1-1", "protein_name": "Probable xyloglucan endotransglucosylase/hydrolase protein 5", "gene_name": "XTH5", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q8LDS2-1", "protein_name": "Probable xyloglucan endotransglucosylase/hydrolase protein 27", "gene_name": "XTH27", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q39099-1", "protein_name": "Xyloglucan endotransglucosylase/hydrolase protein 4", "gene_name": "XTH4", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q38909-1", "protein_name": "Probable xyloglucan endotransglucosylase/hydrolase protein 28", "gene_name": "XTH28", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "Q38907", "url": "https://www.uniprot.org/uniprotkb/Q38907" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.10557219", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 5 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The XTH family of enzymes involved in xyloglucan endotransglucosylation and endohydrolysis: current perspectives and a new unifying nomenclature.", "journal": "Plant Cell Physiol.", "date": "2002", "authors": "Rose Jocelyn K C, Braam Janet, Fry Stephen C, Nishitani Kazuhiko", "reference": { "type": "PubMed", "id": "12514239", "url": "https://pubmed.ncbi.nlm.nih.gov/12514239" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q38907-1", "protein_name": "Probable xyloglucan endotransglucosylase/hydrolase protein 25", "gene_name": "XTH25", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q38908-1", "protein_name": "Probable xyloglucan endotransglucosylase/hydrolase protein 30", "gene_name": "XTH30", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q38910-1", "protein_name": "Probable xyloglucan endotransglucosylase/hydrolase protein 23", "gene_name": "XTH23", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9ZV40-1", "protein_name": "Probable xyloglucan endotransglucosylase/hydrolase protein 21", "gene_name": "XTH21", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9M0D2-1", "protein_name": "Probable xyloglucan endotransglucosylase/hydrolase protein 18", "gene_name": "XTH18", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9SMP1-1", "protein_name": "Probable xyloglucan endotransglucosylase/hydrolase protein 11", "gene_name": "XTH11", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9ZVK1-1", "protein_name": "Probable xyloglucan endotransglucosylase/hydrolase protein 10", "gene_name": "XTH10", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "O80803-1", "protein_name": "Probable xyloglucan endotransglucosylase/hydrolase protein 17", "gene_name": "XTH17", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9SV60-1", "protein_name": "Xyloglucan endotransglucosylase/hydrolase protein 2", "gene_name": "XTH2", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q8L7H3-1", "protein_name": "Probable xyloglucan endotransglucosylase/hydrolase protein 29", "gene_name": "XTH29", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q8L9A9-1", "protein_name": "Probable xyloglucan endotransglucosylase/hydrolase protein 8", "gene_name": "XTH8", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q8LER3-1", "protein_name": "Probable xyloglucan endotransglucosylase/hydrolase protein 7", "gene_name": "XTH7", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q8LF99-1", "protein_name": "Probable xyloglucan endotransglucosylase/hydrolase protein 6", "gene_name": "XTH6", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q8LG58-1", "protein_name": "Probable xyloglucan endotransglucosylase/hydrolase protein 16", "gene_name": "XTH16", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9FI31-1", "protein_name": "Xyloglucan endotransglucosylase/hydrolase protein 20", "gene_name": "XTH20", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9FKL8-1", "protein_name": "Putative xyloglucan endotransglucosylase/hydrolase protein 13", "gene_name": "XTH13", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9FKL9-1", "protein_name": "Probable xyloglucan endotransglucosylase/hydrolase protein 12", "gene_name": "XTH12", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9SJL9-1", "protein_name": "Probable xyloglucan endotransglucosylase/hydrolase protein 32", "gene_name": "XTH32", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9SV61-1", "protein_name": "Putative xyloglucan endotransglucosylase/hydrolase protein 1", "gene_name": "XTH1", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9SVV2-1", "protein_name": "Probable xyloglucan endotransglucosylase/hydrolase protein 26", "gene_name": "XTH26", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9XIW1-1", "protein_name": "Probable xyloglucan endotransglucosylase/hydrolase protein 5", "gene_name": "XTH5", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9ZSU4-1", "protein_name": "Xyloglucan endotransglucosylase/hydrolase protein 14", "gene_name": "XTH14", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q8LDW9-1", "protein_name": "Xyloglucan endotransglucosylase/hydrolase protein 9", "gene_name": "XTH9", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q8LC45-1", "protein_name": "Probable xyloglucan endotransglucosylase/hydrolase protein 33", "gene_name": "XTH33", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q8LDS2-1", "protein_name": "Probable xyloglucan endotransglucosylase/hydrolase protein 27", "gene_name": "XTH27", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "P24806-1", "protein_name": "Xyloglucan endotransglucosylase/hydrolase protein 24", "gene_name": "XTH24", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9LJR7-1", "protein_name": "Xyloglucan endotransglucosylase/hydrolase protein 3", "gene_name": "XTH3", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q39099-1", "protein_name": "Xyloglucan endotransglucosylase/hydrolase protein 4", "gene_name": "XTH4", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "P93046-1", "protein_name": "Xyloglucan endotransglucosylase/hydrolase protein 31", "gene_name": "XTH31", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q38857-1", "protein_name": "Xyloglucan endotransglucosylase/hydrolase protein 22", "gene_name": "XTH22", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q38909-1", "protein_name": "Probable xyloglucan endotransglucosylase/hydrolase protein 28", "gene_name": "XTH28", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q38911-1", "protein_name": "Xyloglucan endotransglucosylase/hydrolase protein 15", "gene_name": "XTH15", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9M0D1-1", "protein_name": "Xyloglucan endotransglucosylase/hydrolase protein 19", "gene_name": "XTH19", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "Q38907", "url": "https://www.uniprot.org/uniprotkb/Q38907" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.12514239", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 33 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The Arabidopsis XET-related gene family: environmental and hormonal regulation of expression.", "journal": "Plant J.", "date": "1996", "authors": "Xu W, Campbell P, Vargheese A K, Braam J", "reference": { "type": "PubMed", "id": "8696366", "url": "https://pubmed.ncbi.nlm.nih.gov/8696366" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q38907-1", "protein_name": "Probable xyloglucan endotransglucosylase/hydrolase protein 25", "gene_name": "XTH25", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q38908-1", "protein_name": "Probable xyloglucan endotransglucosylase/hydrolase protein 30", "gene_name": "XTH30", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q38910-1", "protein_name": "Probable xyloglucan endotransglucosylase/hydrolase protein 23", "gene_name": "XTH23", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q39099-1", "protein_name": "Xyloglucan endotransglucosylase/hydrolase protein 4", "gene_name": "XTH4", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q38857-1", "protein_name": "Xyloglucan endotransglucosylase/hydrolase protein 22", "gene_name": "XTH22", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q38909-1", "protein_name": "Probable xyloglucan endotransglucosylase/hydrolase protein 28", "gene_name": "XTH28", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q38911-1", "protein_name": "Xyloglucan endotransglucosylase/hydrolase protein 15", "gene_name": "XTH15", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "Q38907", "url": "https://www.uniprot.org/uniprotkb/Q38907" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.8696366", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 7 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "A comprehensive expression analysis of all members of a gene family encoding cell-wall enzymes allowed us to predict cis-regulatory regions involved in cell-wall construction in specific organs of Arabidopsis.", "journal": "Plant Cell Physiol.", "date": "2001", "authors": "Yokoyama R, Nishitani K", "reference": { "type": "PubMed", "id": "11673616", "url": "https://pubmed.ncbi.nlm.nih.gov/11673616" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q38908-1", "protein_name": "Probable xyloglucan endotransglucosylase/hydrolase protein 30", "gene_name": "XTH30", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q38910-1", "protein_name": "Probable xyloglucan endotransglucosylase/hydrolase protein 23", "gene_name": "XTH23", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9ZV40-1", "protein_name": "Probable xyloglucan endotransglucosylase/hydrolase protein 21", "gene_name": "XTH21", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9M0D2-1", "protein_name": "Probable xyloglucan endotransglucosylase/hydrolase protein 18", "gene_name": "XTH18", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "O80803-1", "protein_name": "Probable xyloglucan endotransglucosylase/hydrolase protein 17", "gene_name": "XTH17", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9FI31-1", "protein_name": "Xyloglucan endotransglucosylase/hydrolase protein 20", "gene_name": "XTH20", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9FKL9-1", "protein_name": "Probable xyloglucan endotransglucosylase/hydrolase protein 12", "gene_name": "XTH12", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9SJL9-1", "protein_name": "Probable xyloglucan endotransglucosylase/hydrolase protein 32", "gene_name": "XTH32", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9XIW1-1", "protein_name": "Probable xyloglucan endotransglucosylase/hydrolase protein 5", "gene_name": "XTH5", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9ZSU4-1", "protein_name": "Xyloglucan endotransglucosylase/hydrolase protein 14", "gene_name": "XTH14", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q8LDW9-1", "protein_name": "Xyloglucan endotransglucosylase/hydrolase protein 9", "gene_name": "XTH9", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q8LC45-1", "protein_name": "Probable xyloglucan endotransglucosylase/hydrolase protein 33", "gene_name": "XTH33", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "P24806-1", "protein_name": "Xyloglucan endotransglucosylase/hydrolase protein 24", "gene_name": "XTH24", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9LJR7-1", "protein_name": "Xyloglucan endotransglucosylase/hydrolase protein 3", "gene_name": "XTH3", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q39099-1", "protein_name": "Xyloglucan endotransglucosylase/hydrolase protein 4", "gene_name": "XTH4", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "P93046-1", "protein_name": "Xyloglucan endotransglucosylase/hydrolase protein 31", "gene_name": "XTH31", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q38857-1", "protein_name": "Xyloglucan endotransglucosylase/hydrolase protein 22", "gene_name": "XTH22", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q38911-1", "protein_name": "Xyloglucan endotransglucosylase/hydrolase protein 15", "gene_name": "XTH15", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9M0D1-1", "protein_name": "Xyloglucan endotransglucosylase/hydrolase protein 19", "gene_name": "XTH19", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "Q38908", "url": "https://www.uniprot.org/uniprotkb/Q38908" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.11673616", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 19 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Identification and isoprenylation of plant GTP-binding proteins.", "journal": "Plant Mol. Biol.", "date": "1996", "authors": "Biermann B, Randall S K, Crowell D N", "reference": { "type": "PubMed", "id": "8843944", "url": "https://pubmed.ncbi.nlm.nih.gov/8843944" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q38922-1", "protein_name": "Ras-related protein RABB1b", "gene_name": "RABB1B", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9ZRE2-1", "protein_name": "Ras-related protein RABD1", "gene_name": "RABD1", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q38902-1", "protein_name": "Rac-like GTP-binding protein ARAC1", "gene_name": "ARAC1", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q38937-1", "protein_name": "Rac-like GTP-binding protein ARAC5", "gene_name": "ARAC5", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9SMQ6-1", "protein_name": "Ras-related protein RABA4b", "gene_name": "RABA4B", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "Q38922", "url": "https://www.uniprot.org/uniprotkb/Q38922" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.8843944", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 5 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Lutein accumulation in the absence of zeaxanthin restores nonphotochemical quenching in the Arabidopsis thaliana npq1 mutant.", "journal": "The Plant cell", "date": "2009-06", "authors": "Li Zhirong, Ahn Tae Kyu, Avenson Thomas J, Ballottari Matteo, Cruz Jeffrey A, Kramer David M, Bassi Roberto, Fleming Graham R, Keasling Jay D, Niyogi Krishna K", "reference": { "type": "PubMed", "id": "19549928", "url": "https://pubmed.ncbi.nlm.nih.gov/19549928" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q38933-1", "protein_name": "Lycopene beta cyclase, chloroplastic", "gene_name": "LCY1", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "Q38933", "url": "https://www.uniprot.org/uniprotkb/Q38933" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "mutagenesis": [ { "start_pos": 451, "end_pos": 451, "sequence_org": "G", "sequence_mut": "E", "comment": "In szl1; slight reduction in plant growth, increased content of lutein, and decreased content of xanthophyll pigments (violaxanthin, antheraxanthin and zeaxanthin).", "evidence": [ { "database": "UniProtKB", "id": "Q38933", "url": "https://www.uniprot.org/uniprotkb/Q38933" }, { "database": "PubMed", "id": "19549928", "url": "https://pubmed.ncbi.nlm.nih.gov/19549928" } ], "uniprot_canonical_ac": "Q38933-1" } ], "record_id": "pubmed.19549928", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Transformation of beta-lycopene cyclase genes from Salicornia europaea and Arabidopsis conferred salt tolerance in Arabidopsis and tobacco.", "journal": "Plant & cell physiology", "date": "2011-05", "authors": "Chen Xianyang, Han Heping, Jiang Ping, Nie Lingling, Bao Hexigeduleng, Fan Pengxiang, Lv Sulian, Feng Juanjuan, Li Yinxin", "reference": { "type": "PubMed", "id": "21471119", "url": "https://pubmed.ncbi.nlm.nih.gov/21471119" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q38933-1", "protein_name": "Lycopene beta cyclase, chloroplastic", "gene_name": "LCY1", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "Q38933", "url": "https://www.uniprot.org/uniprotkb/Q38933" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.21471119", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Functional analysis of the beta and epsilon lycopene cyclase enzymes of Arabidopsis reveals a mechanism for control of cyclic carotenoid formation.", "journal": "The Plant cell", "date": "1996-09", "authors": "Cunningham F X, Pogson B, Sun Z, McDonald K A, DellaPenna D, Gantt E", "reference": { "type": "PubMed", "id": "8837512", "url": "https://pubmed.ncbi.nlm.nih.gov/8837512" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q38933-1", "protein_name": "Lycopene beta cyclase, chloroplastic", "gene_name": "LCY1", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q38932-1", "protein_name": "Lycopene epsilon cyclase, chloroplastic", "gene_name": "LUT2", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "Q38933", "url": "https://www.uniprot.org/uniprotkb/Q38933" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.8837512", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Molecular characterization of a FKBP-type immunophilin from higher plants.", "journal": "Proc. Natl. Acad. Sci. U.S.A.", "date": "1996", "authors": "Luan S, Kudla J, Gruissem W, Schreiber S L", "reference": { "type": "PubMed", "id": "8692927", "url": "https://pubmed.ncbi.nlm.nih.gov/8692927" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q38936-1", "protein_name": "Peptidyl-prolyl cis-trans isomerase FKBP15-2", "gene_name": "FKBP15-2", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q38935-1", "protein_name": "Peptidyl-prolyl cis-trans isomerase FKBP15-1", "gene_name": "FKBP15-1", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "Q38936", "url": "https://www.uniprot.org/uniprotkb/Q38936" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.8692927", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The Arabidopsis HAL2-like gene family includes a novel sodium-sensitive phosphatase.", "journal": "The Plant journal : for cell and molecular biology", "date": "1999-02", "authors": "Gil-Mascarell R, L\u00f3pez-Coronado J M, Bell\u00e9s J M, Serrano R, Rodr\u00edguez P L", "reference": { "type": "PubMed", "id": "10205895", "url": "https://pubmed.ncbi.nlm.nih.gov/10205895" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q38945-1", "protein_name": "3',5'-bisphosphate nucleotidase AHL", "gene_name": "AHL", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "O49623-1", "protein_name": "3',5'-bisphosphate nucleotidase 2", "gene_name": "SAL2", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q42546-1", "protein_name": "3'(2'),5'-bisphosphate nucleotidase 1", "gene_name": "SAL1", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "Q38945", "url": "https://www.uniprot.org/uniprotkb/Q38945" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.10205895", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Diverse RNA viruses elicit the expression of common sets of genes in susceptible Arabidopsis thaliana plants.", "journal": "Plant J.", "date": "2003", "authors": "Whitham Steven A, Quan Sheng, Chang Hur-Song, Cooper Bret, Estes Bram, Zhu Tong, Wang Xun, Hou Yu-Ming", "reference": { "type": "PubMed", "id": "12535341", "url": "https://pubmed.ncbi.nlm.nih.gov/12535341" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q38960-1", "protein_name": "WD repeat-containing protein LWD2", "gene_name": "LWD2", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "O24603-1", "protein_name": "Endochitinase CHI", "gene_name": "CHI", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q39224-1", "protein_name": "Protein SRG1", "gene_name": "SRG1", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "Q38960", "url": "https://www.uniprot.org/uniprotkb/Q38960" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.12535341", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Two new clock proteins, LWD1 and LWD2, regulate Arabidopsis photoperiodic flowering.", "journal": "Plant physiology", "date": "2008-10", "authors": "Wu Jing-Fen, Wang Ying, Wu Shu-Hsing", "reference": { "type": "PubMed", "id": "18676661", "url": "https://pubmed.ncbi.nlm.nih.gov/18676661" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q38960-1", "protein_name": "WD repeat-containing protein LWD2", "gene_name": "LWD2", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "O04211-1", "protein_name": "Protein EARLY FLOWERING 4", "gene_name": "ELF4", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9LPV9-1", "protein_name": "WD repeat-containing protein LWD1", "gene_name": "LWD1", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "Q38960", "url": "https://www.uniprot.org/uniprotkb/Q38960" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.18676661", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "LIGHT-REGULATED WD1 and PSEUDO-RESPONSE REGULATOR9 form a positive feedback regulatory loop in the Arabidopsis circadian clock.", "journal": "The Plant cell", "date": "2011-02", "authors": "Wang Ying, Wu Jing-Fen, Nakamichi Norihito, Sakakibara Hitoshi, Nam Hong-Gil, Wu Shu-Hsing", "reference": { "type": "PubMed", "id": "21357491", "url": "https://pubmed.ncbi.nlm.nih.gov/21357491" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q38960-1", "protein_name": "WD repeat-containing protein LWD2", "gene_name": "LWD2", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9LPV9-1", "protein_name": "WD repeat-containing protein LWD1", "gene_name": "LWD1", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q8L500-1", "protein_name": "Two-component response regulator-like APRR9", "gene_name": "APRR9; PRR9", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q93WK5-1", "protein_name": "Two-component response regulator-like APRR7", "gene_name": "APRR7; PRR7", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q6LA42-1", "protein_name": "Two-component response regulator-like APRR5", "gene_name": "APRR5", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "Q38960", "url": "https://www.uniprot.org/uniprotkb/Q38960" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.21357491", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 5 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The an11 locus controlling flower pigmentation in petunia encodes a novel WD-repeat protein conserved in yeast, plants, and animals.", "journal": "Genes Dev.", "date": "1997", "authors": "de Vetten N, Quattrocchio F, Mol J, Koes R", "reference": { "type": "PubMed", "id": "9192870", "url": "https://pubmed.ncbi.nlm.nih.gov/9192870" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q38960-1", "protein_name": "WD repeat-containing protein LWD2", "gene_name": "LWD2", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "P61962-1", "protein_name": "DDB1- and CUL4-associated factor 7", "gene_name": "DCAF7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9LPV9-1", "protein_name": "WD repeat-containing protein LWD1", "gene_name": "LWD1", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "Q38960", "url": "https://www.uniprot.org/uniprotkb/Q38960" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.9192870", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Substrate specificity and expression profile of amino acid transporters (AAPs) in Arabidopsis.", "journal": "The Journal of biological chemistry", "date": "1995-07-07", "authors": "Fischer W N, Kwart M, Hummel S, Frommer W B", "reference": { "type": "PubMed", "id": "7608199", "url": "https://pubmed.ncbi.nlm.nih.gov/7608199" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q38967-1", "protein_name": "Amino acid permease 2", "gene_name": "AAP2", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9FN04-1", "protein_name": "Amino acid permease 4", "gene_name": "AAP4", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q8GUM3-1", "protein_name": "Amino acid permease 5", "gene_name": "AAP5", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q39134-1", "protein_name": "Amino acid permease 3", "gene_name": "AAP3", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q42400-1", "protein_name": "Amino acid permease 1", "gene_name": "AAP1", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "Q38967", "url": "https://www.uniprot.org/uniprotkb/Q38967" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.7608199", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 5 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Differential expression of two related amino acid transporters with differing substrate specificity in Arabidopsis thaliana.", "journal": "The Plant journal : for cell and molecular biology", "date": "1993-12", "authors": "Kwart M, Hirner B, Hummel S, Frommer W B", "reference": { "type": "PubMed", "id": "8281191", "url": "https://pubmed.ncbi.nlm.nih.gov/8281191" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q38967-1", "protein_name": "Amino acid permease 2", "gene_name": "AAP2", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q42400-1", "protein_name": "Amino acid permease 1", "gene_name": "AAP1", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "Q38967", "url": "https://www.uniprot.org/uniprotkb/Q38967" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.8281191", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Seed and vascular expression of a high-affinity transporter for cationic amino acids in Arabidopsis.", "journal": "Proc. Natl. Acad. Sci. U.S.A.", "date": "1995", "authors": "Frommer W B, Hummel S, Unseld M, Ninnemann O", "reference": { "type": "PubMed", "id": "8618839", "url": "https://pubmed.ncbi.nlm.nih.gov/8618839" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q38967-1", "protein_name": "Amino acid permease 2", "gene_name": "AAP2", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q84MA5-1", "protein_name": "Cationic amino acid transporter 1", "gene_name": "AAT1; CAT1", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "Q38967", "url": "https://www.uniprot.org/uniprotkb/Q38967" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.8618839", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] } ]