[ { "title": "Hyperphosphorylation of polycystin-2 at a critical residue in disease reveals an essential role for polycystin-1-regulated dephosphorylation.", "journal": "Human molecular genetics", "date": "2013", "authors": "Streets AJ, Wessely O, Peters DJ, Ong AC", "reference": { "type": "PubMed", "id": "23390129", "url": "https://pubmed.ncbi.nlm.nih.gov/23390129" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q13563-1", "protein_name": "Polycystin-2", "gene_name": "PKD2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q13563", "url": "https://www.uniprot.org/uniprotkb/Q13563" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 829, "end_pos": 829, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "Q13563", "url": "https://www.uniprot.org/uniprotkb/Q13563" }, { "database": "PubMed", "id": "26269590", "url": "https://pubmed.ncbi.nlm.nih.gov/26269590" }, { "database": "iPTMnet", "id": "Q13563", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q13563" }, { "database": "PubMed", "id": "21670214", "url": "https://pubmed.ncbi.nlm.nih.gov/21670214" }, { "database": "PubMed", "id": "23390129", "url": "https://pubmed.ncbi.nlm.nih.gov/23390129" } ], "site_lbl": "Ser829", "uniprot_canonical_ac": "Q13563-1" } ], "record_id": "pubmed.23390129", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "A high-resolution structure of the EF-hand domain of human polycystin-2.", "journal": "Protein science : a publication of the Protein Society", "date": "2014", "authors": "Allen MD, Qamar S, Vadivelu MK, Sandford RN, Bycroft M", "reference": { "type": "PubMed", "id": "24990821", "url": "https://pubmed.ncbi.nlm.nih.gov/24990821" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q13563-1", "protein_name": "Polycystin-2", "gene_name": "PKD2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q13563", "url": "https://www.uniprot.org/uniprotkb/Q13563" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 768, "end_pos": 768, "sequence_org": "Q", "sequence_mut": "G", "comment": "Strongly increases calcium binding affinity.", "evidence": [ { "database": "UniProtKB", "id": "Q13563", "url": "https://www.uniprot.org/uniprotkb/Q13563" }, { "database": "PubMed", "id": "24990821", "url": "https://pubmed.ncbi.nlm.nih.gov/24990821" } ], "uniprot_canonical_ac": "Q13563-1" }, { "start_pos": 774, "end_pos": 774, "sequence_org": "E", "sequence_mut": "Q", "comment": "Abolishes calcium binding via the EF-hand.", "evidence": [ { "database": "UniProtKB", "id": "Q13563", "url": "https://www.uniprot.org/uniprotkb/Q13563" }, { "database": "PubMed", "id": "24990821", "url": "https://pubmed.ncbi.nlm.nih.gov/24990821" } ], "uniprot_canonical_ac": "Q13563-1" } ], "record_id": "pubmed.24990821", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The cAMP Signaling Pathway and Direct Protein Kinase A Phosphorylation Regulate Polycystin-2 (TRPP2) Channel Function.", "journal": "The Journal of biological chemistry", "date": "2015", "authors": "Cantero Mdel R, Velazquez IF, Streets AJ, Ong AC, Cantiello HF", "reference": { "type": "PubMed", "id": "26269590", "url": "https://pubmed.ncbi.nlm.nih.gov/26269590" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q13563-1", "protein_name": "Polycystin-2", "gene_name": "PKD2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q13563", "url": "https://www.uniprot.org/uniprotkb/Q13563" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 829, "end_pos": 829, "sequence_org": "S", "sequence_mut": "A", "comment": "Abolishes increased channel opening in response to cAMP and phosphorylation by PKA.", "evidence": [ { "database": "UniProtKB", "id": "Q13563", "url": "https://www.uniprot.org/uniprotkb/Q13563" }, { "database": "PubMed", "id": "26269590", "url": "https://pubmed.ncbi.nlm.nih.gov/26269590" } ], "uniprot_canonical_ac": "Q13563-1" } ], "phosphorylation": [ { "start_pos": 829, "end_pos": 829, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "Q13563", "url": "https://www.uniprot.org/uniprotkb/Q13563" }, { "database": "PubMed", "id": "26269590", "url": "https://pubmed.ncbi.nlm.nih.gov/26269590" }, { "database": "iPTMnet", "id": "Q13563", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q13563" }, { "database": "PubMed", "id": "21670214", "url": "https://pubmed.ncbi.nlm.nih.gov/21670214" }, { "database": "PubMed", "id": "23390129", "url": "https://pubmed.ncbi.nlm.nih.gov/23390129" } ], "site_lbl": "Ser829", "uniprot_canonical_ac": "Q13563-1" } ], "record_id": "pubmed.26269590", "abstract": "", "glycosylation": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Function and regulation of TRPP2 ion channel revealed by a gain-of-function mutant.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2016", "authors": "Arif Pavel M, Lv C, Ng C, Yang L, Kashyap P, Lam C, Valentino V, Fung HY, Campbell T, Moller SG, Zenisek D, Holtzman NG, Yu Y", "reference": { "type": "PubMed", "id": "27071085", "url": "https://pubmed.ncbi.nlm.nih.gov/27071085" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q13563-1", "protein_name": "Polycystin-2", "gene_name": "PKD2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q13563", "url": "https://www.uniprot.org/uniprotkb/Q13563" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 604, "end_pos": 604, "sequence_org": "F", "sequence_mut": "A", "comment": "No effect on channel activation.", "evidence": [ { "database": "UniProtKB", "id": "Q13563", "url": "https://www.uniprot.org/uniprotkb/Q13563" }, { "database": "PubMed", "id": "27071085", "url": "https://pubmed.ncbi.nlm.nih.gov/27071085" } ], "uniprot_canonical_ac": "Q13563-1" }, { "start_pos": 604, "end_pos": 604, "sequence_org": "F", "sequence_mut": "I", "comment": "No effect on channel activation.", "evidence": [ { "database": "UniProtKB", "id": "Q13563", "url": "https://www.uniprot.org/uniprotkb/Q13563" }, { "database": "PubMed", "id": "27071085", "url": "https://pubmed.ncbi.nlm.nih.gov/27071085" } ], "uniprot_canonical_ac": "Q13563-1" }, { "start_pos": 604, "end_pos": 604, "sequence_org": "F", "sequence_mut": "P", "comment": "Gain-of-function mutation resulting in increased channel activity. Absence of gain of function; when associated with F-605 DEL; when associated with A-201; when associated with V-511; when associated with G-414; when associated with G-420; when associated with Y-684 DEL; when associated with A-684; when associated with R-632; when associated with R-632; when associated S-629. Increased channel activity; when associated with 736-L-N-737 DEL. Coexpression of PKD1 with PKD2- F604P dramatically reduces the current in comparison with that measured when PKD2-P-604 is expressed by itself.", "evidence": [ { "database": "UniProtKB", "id": "Q13563", "url": "https://www.uniprot.org/uniprotkb/Q13563" }, { "database": "PubMed", "id": "27071085", "url": "https://pubmed.ncbi.nlm.nih.gov/27071085" }, { "database": "PubMed", "id": "29899465", "url": "https://pubmed.ncbi.nlm.nih.gov/29899465" }, { "database": "PubMed", "id": "36420836", "url": "https://pubmed.ncbi.nlm.nih.gov/36420836" }, { "database": "PubMed", "id": "39009345", "url": "https://pubmed.ncbi.nlm.nih.gov/39009345" } ], "uniprot_canonical_ac": "Q13563-1" }, { "start_pos": 605, "end_pos": 605, "sequence_org": "F", "sequence_mut": "", "comment": "Abolishes increased channel activity due to a gain of function mutation; when associated with P-604.", "evidence": [ { "database": "UniProtKB", "id": "Q13563", "url": "https://www.uniprot.org/uniprotkb/Q13563" }, { "database": "PubMed", "id": "27071085", "url": "https://pubmed.ncbi.nlm.nih.gov/27071085" } ], "uniprot_canonical_ac": "Q13563-1" }, { "start_pos": 736, "end_pos": 737, "sequence_org": "LN", "sequence_mut": "", "comment": "Increased channel activity; when associated with P-604.", "evidence": [ { "database": "UniProtKB", "id": "Q13563", "url": "https://www.uniprot.org/uniprotkb/Q13563" }, { "database": "PubMed", "id": "27071085", "url": "https://pubmed.ncbi.nlm.nih.gov/27071085" } ], "uniprot_canonical_ac": "Q13563-1" } ], "record_id": "pubmed.27071085", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The polycystin complex mediates Wnt/Ca(2+) signalling.", "journal": "Nature cell biology", "date": "2016", "authors": "Kim S, Nie H, Nesin V, Tran U, Outeda P, Bai CX, Keeling J, Maskey D, Watnick T, Wessely O, Tsiokas L", "reference": { "type": "PubMed", "id": "27214281", "url": "https://pubmed.ncbi.nlm.nih.gov/27214281" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q13563-1", "protein_name": "Polycystin-2", "gene_name": "PKD2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q60838-1", "protein_name": "Segment polarity protein dishevelled homolog DVL-2", "gene_name": "Dvl2", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "O14905-1", "protein_name": "Protein Wnt-9b", "gene_name": "WNT9B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51141-1", "protein_name": "Segment polarity protein dishevelled homolog DVL-1", "gene_name": "Dvl1", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "O14640-1", "protein_name": "Segment polarity protein dishevelled homolog DVL-1", "gene_name": "DVL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14641-1", "protein_name": "Segment polarity protein dishevelled homolog DVL-2", "gene_name": "DVL2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P56704-1", "protein_name": "Protein Wnt-3a", "gene_name": "WNT3A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O08852-1", "protein_name": "Polycystin-1", "gene_name": "Pkd1", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "O35245-1", "protein_name": "Polycystin-2", "gene_name": "Pkd2", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "P22725-1", "protein_name": "Protein Wnt-5a", "gene_name": "Wnt5a", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "P56705-1", "protein_name": "Protein Wnt-4", "gene_name": "WNT4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P41221-1", "protein_name": "Protein Wnt-5a", "gene_name": "WNT5A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P98161-1", "protein_name": "Polycystin-1", "gene_name": "PKD1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q13563", "url": "https://www.uniprot.org/uniprotkb/Q13563" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.27214281", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 13 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Mutations in GANAB, encoding the glucosidase IIalpha subunit, cause autosomal-dominant polycystic kidney and liver disease.", "journal": "Am. J. Hum. Genet.", "date": "2016", "authors": "Porath B, Gainullin VG, Cornec-Le Gall E, Dillinger EK, Heyer CM, Hopp K, Edwards ME, Madsen CD, Mauritz SR, Banks CJ, Baheti S, Reddy B, Herrero JI, Banales JM, Hogan MC, Tasic V, Watnick TJ, Chapman AB, Vigneau C, Lavainne F, Audrezet MP, Ferec C, Le Meur Y, Torres VE, Harris PC", "reference": { "type": "PubMed", "id": "27259053", "url": "https://pubmed.ncbi.nlm.nih.gov/27259053" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q13563-1", "protein_name": "Polycystin-2", "gene_name": "PKD2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14697-1", "protein_name": "Neutral alpha-glucosidase AB", "gene_name": "GANAB", "tax_name": "Human" }, { "uniprot_canonical_ac": "P98161-1", "protein_name": "Polycystin-1", "gene_name": "PKD1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q13563", "url": "https://www.uniprot.org/uniprotkb/Q13563" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "snv": [ { "evidence": [ { "id": "rs879255642", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs879255642" }, { "id": "rs879255642", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs879255642" }, { "id": "27259053", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/27259053" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 383, "end_pos": 383, "sequence_org": "T", "sequence_mut": "R", "comment": "Germline mutation passed 1 filters: glycogene of type=glycogene, glycosylhydrolase.", "chr_id": "11", "chr_pos": "62631032", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T383", "keywords": [ "ebi", "germline", "disease" ], "disease": [ { "disease_id": "DOID:0110860", "recommended_name": { "id": "DOID:0110860", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0110860", "name": "polycystic kidney disease 3", "description": "A autosomal dominant polycystic kidney disease that has_material_basis_in autosomal dominant inheritance of mutation in the GANAB gene on chromosome 11q12.3." }, "synonyms": [ { "id": "DOID:0110860", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0110860", "name": "Polycystic Kidney Disease, Adult, Type III", "description": "" }, { "id": "DOID:0110860", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0110860", "name": "APKD3", "description": "" }, { "id": "DOID:0110860", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0110860", "name": "PKD3", "description": "" }, { "id": "MONDO:0010916", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010916", "name": "polycystic kidney disease 3 with or without polycystic liver disease", "description": "Any autosomal dominant polycystic kidney disease in which the cause of the disease is a mutation in the GANAB gene." }, { "id": "MONDO:0010916", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010916", "name": "APKD3", "description": "" }, { "id": "MONDO:0010916", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010916", "name": "Apkd3", "description": "" }, { "id": "MONDO:0010916", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010916", "name": "GANAB autosomal dominant polycystic kidney disease", "description": "" }, { "id": "MONDO:0010916", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010916", "name": "PKD3", "description": "" }, { "id": "MONDO:0010916", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010916", "name": "Pkd3", "description": "" }, { "id": "MONDO:0010916", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010916", "name": "autosomal dominant polycystic kidney disease caused by mutation in GANAB", "description": "" }, { "id": "MONDO:0010916", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010916", "name": "polycystic kidney disease 3 with or without polycystic liver disease", "description": "" }, { "id": "MONDO:0010916", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010916", "name": "polycystic kidney disease 3, autosomal dominant", "description": "" }, { "id": "MONDO:0010916", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010916", "name": "polycystic kidney disease type 3", "description": "" }, { "id": "MONDO:0010916", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010916", "name": "polycystic kidney disease, adult, type 3", "description": "" }, { "id": "MONDO:0010916", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010916", "name": "polycystic kidney disease, type 3", "description": "" }, { "id": "MIM:600666", "resource": "MIM", "url": "https://www.omim.org/entry/600666", "name": "Polycystic kidney disease 3 with or without polycystic liver disease", "description": "Polycystic kidney disease 3 with or without polycystic liver disease" } ], "unlinked_id_list": [], "evidence": [ { "id": "0010916", "database": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010916" }, { "id": "600666", "database": "MIM", "url": "https://www.omim.org/entry/600666" }, { "id": "0110860", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110860" } ] } ], "filter_code": "000000000000000010000.00000000000000.000000000001000000.00001.10.000.001", "uniprot_canonical_ac": "Q14697-1" }, { "evidence": [ { "id": "rs770519542", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs770519542" }, { "id": "rs770519542", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs770519542" }, { "id": "rs770519542", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs770519542" }, { "id": "27259053", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/27259053" } ], "glycoeffect": [], "start_pos": 400, "end_pos": 400, "sequence_org": "R", "sequence_mut": "L", "comment": "Germline mutation passed 1 filters: glycogene of type=glycogene, glycosylhydrolase.", "chr_id": "11", "chr_pos": "62630788", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "R400", "keywords": [ "ebi", "germline", "disease" ], "disease": [ { "disease_id": "DOID:0110860", "recommended_name": { "id": "DOID:0110860", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0110860", "name": "polycystic kidney disease 3", "description": "A autosomal dominant polycystic kidney disease that has_material_basis_in autosomal dominant inheritance of mutation in the GANAB gene on chromosome 11q12.3." }, "synonyms": [ { "id": "DOID:0110860", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0110860", "name": "Polycystic Kidney Disease, Adult, Type III", "description": "" }, { "id": "DOID:0110860", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0110860", "name": "APKD3", "description": "" }, { "id": "DOID:0110860", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0110860", "name": "PKD3", "description": "" }, { "id": "MONDO:0010916", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010916", "name": "polycystic kidney disease 3 with or without polycystic liver disease", "description": "Any autosomal dominant polycystic kidney disease in which the cause of the disease is a mutation in the GANAB gene." }, { "id": "MONDO:0010916", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010916", "name": "APKD3", "description": "" }, { "id": "MONDO:0010916", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010916", "name": "Apkd3", "description": "" }, { "id": "MONDO:0010916", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010916", "name": "GANAB autosomal dominant polycystic kidney disease", "description": "" }, { "id": "MONDO:0010916", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010916", "name": "PKD3", "description": "" }, { "id": "MONDO:0010916", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010916", "name": "Pkd3", "description": "" }, { "id": "MONDO:0010916", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010916", "name": "autosomal dominant polycystic kidney disease caused by mutation in GANAB", "description": "" }, { "id": "MONDO:0010916", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010916", "name": "polycystic kidney disease 3 with or without polycystic liver disease", "description": "" }, { "id": "MONDO:0010916", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010916", "name": "polycystic kidney disease 3, autosomal dominant", "description": "" }, { "id": "MONDO:0010916", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010916", "name": "polycystic kidney disease type 3", "description": "" }, { "id": "MONDO:0010916", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010916", "name": "polycystic kidney disease, adult, type 3", "description": "" }, { "id": "MONDO:0010916", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010916", "name": "polycystic kidney disease, type 3", "description": "" }, { "id": "MIM:600666", "resource": "MIM", "url": "https://www.omim.org/entry/600666", "name": "Polycystic kidney disease 3 with or without polycystic liver disease", "description": "Polycystic kidney disease 3 with or without polycystic liver disease" } ], "unlinked_id_list": [], "evidence": [ { "id": "0010916", "database": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010916" }, { "id": "600666", "database": "MIM", "url": "https://www.omim.org/entry/600666" }, { "id": "0110860", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110860" } ] } ], "filter_code": "010000000000000000000.00000000000000.000000000001000000.00001.10.000.000", "uniprot_canonical_ac": "Q14697-1" }, { "evidence": [ { "id": "rs752158933", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs752158933" }, { "id": "27259053", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/27259053" } ], "glycoeffect": [], "start_pos": 51, "end_pos": 51, "sequence_org": "R", "sequence_mut": "null", "comment": "Germline mutation passed 1 filters: glycogene of type=glycogene, glycosylhydrolase.", "chr_id": "11", "chr_pos": "62639459CT", "ref_nt": "]", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "R51", "keywords": [ "ebi", "germline", "disease" ], "disease": [ { "disease_id": "DOID:0110860", "recommended_name": { "id": "DOID:0110860", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0110860", "name": "polycystic kidney disease 3", "description": "A autosomal dominant polycystic kidney disease that has_material_basis_in autosomal dominant inheritance of mutation in the GANAB gene on chromosome 11q12.3." }, "synonyms": [ { "id": "DOID:0110860", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0110860", "name": "Polycystic Kidney Disease, Adult, Type III", "description": "" }, { "id": "DOID:0110860", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0110860", "name": "APKD3", "description": "" }, { "id": "DOID:0110860", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0110860", "name": "PKD3", "description": "" }, { "id": "MONDO:0010916", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010916", "name": "polycystic kidney disease 3 with or without polycystic liver disease", "description": "Any autosomal dominant polycystic kidney disease in which the cause of the disease is a mutation in the GANAB gene." }, { "id": "MONDO:0010916", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010916", "name": "APKD3", "description": "" }, { "id": "MONDO:0010916", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010916", "name": "Apkd3", "description": "" }, { "id": "MONDO:0010916", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010916", "name": "GANAB autosomal dominant polycystic kidney disease", "description": "" }, { "id": "MONDO:0010916", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010916", "name": "PKD3", "description": "" }, { "id": "MONDO:0010916", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010916", "name": "Pkd3", "description": "" }, { "id": "MONDO:0010916", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010916", "name": "autosomal dominant polycystic kidney disease caused by mutation in GANAB", "description": "" }, { "id": "MONDO:0010916", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010916", "name": "polycystic kidney disease 3 with or without polycystic liver disease", "description": "" }, { "id": "MONDO:0010916", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010916", "name": "polycystic kidney disease 3, autosomal dominant", "description": "" }, { "id": "MONDO:0010916", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010916", "name": "polycystic kidney disease type 3", "description": "" }, { "id": "MONDO:0010916", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010916", "name": "polycystic kidney disease, adult, type 3", "description": "" }, { "id": "MONDO:0010916", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010916", "name": "polycystic kidney disease, type 3", "description": "" }, { "id": "MIM:600666", "resource": "MIM", "url": "https://www.omim.org/entry/600666", "name": "Polycystic kidney disease 3 with or without polycystic liver disease", "description": "Polycystic kidney disease 3 with or without polycystic liver disease" } ], "unlinked_id_list": [], "evidence": [ { "id": "0010916", "database": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010916" }, { "id": "600666", "database": "MIM", "url": "https://www.omim.org/entry/600666" }, { "id": "0110860", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110860" } ] } ], "filter_code": "010000000000000000000.00000000000000.000000000001000000.00001.11.000.000", "uniprot_canonical_ac": "Q14697-1" }, { "evidence": [ { "id": "rs879255641", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs879255641" }, { "id": "27259053", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/27259053" } ], "glycoeffect": [], "start_pos": 618, "end_pos": 618, "sequence_org": "D", "sequence_mut": "null", "comment": "Germline mutation passed 1 filters: glycogene of type=glycogene, glycosylhydrolase.", "chr_id": "11", "chr_pos": "62629281_62629282", "ref_nt": "l", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "D618", "disease": [ { "disease_id": "DOID:0110860", "recommended_name": { "id": "DOID:0110860", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0110860", "name": "polycystic kidney disease 3", "description": "A autosomal dominant polycystic kidney disease that has_material_basis_in autosomal dominant inheritance of mutation in the GANAB gene on chromosome 11q12.3." }, "synonyms": [ { "id": "DOID:0110860", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0110860", "name": "Polycystic Kidney Disease, Adult, Type III", "description": "" }, { "id": "DOID:0110860", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0110860", "name": "APKD3", "description": "" }, { "id": "DOID:0110860", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0110860", "name": "PKD3", "description": "" }, { "id": "MONDO:0010916", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010916", "name": "polycystic kidney disease 3 with or without polycystic liver disease", "description": "Any autosomal dominant polycystic kidney disease in which the cause of the disease is a mutation in the GANAB gene." }, { "id": "MONDO:0010916", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010916", "name": "APKD3", "description": "" }, { "id": "MONDO:0010916", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010916", "name": "Apkd3", "description": "" }, { "id": "MONDO:0010916", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010916", "name": "GANAB autosomal dominant polycystic kidney disease", "description": "" }, { "id": "MONDO:0010916", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010916", "name": "PKD3", "description": "" }, { "id": "MONDO:0010916", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010916", "name": "Pkd3", "description": "" }, { "id": "MONDO:0010916", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010916", "name": "autosomal dominant polycystic kidney disease caused by mutation in GANAB", "description": "" }, { "id": "MONDO:0010916", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010916", "name": "polycystic kidney disease 3 with or without polycystic liver disease", "description": "" }, { "id": "MONDO:0010916", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010916", "name": "polycystic kidney disease 3, autosomal dominant", "description": "" }, { "id": "MONDO:0010916", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010916", "name": "polycystic kidney disease type 3", "description": "" }, { "id": "MONDO:0010916", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010916", "name": "polycystic kidney disease, adult, type 3", "description": "" }, { "id": "MONDO:0010916", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010916", "name": "polycystic kidney disease, type 3", "description": "" }, { "id": "MIM:600666", "resource": "MIM", "url": "https://www.omim.org/entry/600666", "name": "Polycystic kidney disease 3 with or without polycystic liver disease", "description": "Polycystic kidney disease 3 with or without polycystic liver disease" } ], "unlinked_id_list": [], "evidence": [ { "id": "0010916", "database": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010916" }, { "id": "600666", "database": "MIM", "url": "https://www.omim.org/entry/600666" }, { "id": "0110860", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110860" } ] } ], "keywords": [ "ebi", "germline", "disease" ], "filter_code": "000100000000000000000.00000000000000.000000000001000000.00001.10.000.000", "uniprot_canonical_ac": "Q14697-1" }, { "evidence": [ { "id": "Q14697", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/Q14697" }, { "id": "rs879255643", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs879255643" }, { "id": "rs879255643", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs879255643" }, { "id": "27259053", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/27259053" }, { "id": "rs879255643", "database": "COSMIC", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs879255643" } ], "glycoeffect": [], "start_pos": 817, "end_pos": 817, "subjects_tested": "3601", "subjects_positive": "1", "frequency": "0.0", "sequence_org": "R", "sequence_mut": "W", "comment": "Somatic mutation passed 1 filters: protein-of-interest(glycogene, glycosylhydrolase).", "chr_id": "11", "chr_pos": "62626633", "ref_nt": "G", "alt_nt": "A", "minor_allelic_frequency": "", "site_lbl": "R817", "disease": [ { "disease_id": "DOID:9256", "recommended_name": { "id": "DOID:9256", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:9256", "name": "colorectal cancer", "description": "A large intestine cancer that is located_in the colon and/or located_in the rectum." }, "synonyms": [ { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "A primary or metastatic malignant neoplasm that affects the colon or rectum. Representative examples include carcinoma, lymphoma, and sarcoma." }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, advanced, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer with chromosomal instability, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectum cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectum neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "CRC", "description": "" }, { "id": "MIM:114500", "resource": "MIM", "url": "https://www.omim.org/entry/114500", "name": "Colorectal cancer", "description": "Colorectal cancer" } ], "unlinked_id_list": [], "evidence": [ { "id": "9256", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:9256" } ] }, { "disease_id": "DOID:0110860", "recommended_name": { "id": "DOID:0110860", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0110860", "name": "polycystic kidney disease 3", "description": "A autosomal dominant polycystic kidney disease that has_material_basis_in autosomal dominant inheritance of mutation in the GANAB gene on chromosome 11q12.3." }, "synonyms": [ { "id": "DOID:0110860", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0110860", "name": "Polycystic Kidney Disease, Adult, Type III", "description": "" }, { "id": "DOID:0110860", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0110860", "name": "APKD3", "description": "" }, { "id": "DOID:0110860", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0110860", "name": "PKD3", "description": "" }, { "id": "MONDO:0010916", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010916", "name": "polycystic kidney disease 3 with or without polycystic liver disease", "description": "Any autosomal dominant polycystic kidney disease in which the cause of the disease is a mutation in the GANAB gene." }, { "id": "MONDO:0010916", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010916", "name": "APKD3", "description": "" }, { "id": "MONDO:0010916", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010916", "name": "Apkd3", "description": "" }, { "id": "MONDO:0010916", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010916", "name": "GANAB autosomal dominant polycystic kidney disease", "description": "" }, { "id": "MONDO:0010916", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010916", "name": "PKD3", "description": "" }, { "id": "MONDO:0010916", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010916", "name": "Pkd3", "description": "" }, { "id": "MONDO:0010916", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010916", "name": "autosomal dominant polycystic kidney disease caused by mutation in GANAB", "description": "" }, { "id": "MONDO:0010916", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010916", "name": "polycystic kidney disease 3 with or without polycystic liver disease", "description": "" }, { "id": "MONDO:0010916", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010916", "name": "polycystic kidney disease 3, autosomal dominant", "description": "" }, { "id": "MONDO:0010916", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010916", "name": "polycystic kidney disease type 3", "description": "" }, { "id": "MONDO:0010916", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010916", "name": "polycystic kidney disease, adult, type 3", "description": "" }, { "id": "MONDO:0010916", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010916", "name": "polycystic kidney disease, type 3", "description": "" }, { "id": "MIM:600666", "resource": "MIM", "url": "https://www.omim.org/entry/600666", "name": "Polycystic kidney disease 3 with or without polycystic liver disease", "description": "Polycystic kidney disease 3 with or without polycystic liver disease" } ], "unlinked_id_list": [], "evidence": [ { "id": "0010916", "database": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010916" }, { "id": "600666", "database": "MIM", "url": "https://www.omim.org/entry/600666" }, { "id": "0110860", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110860" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease", "ebi" ], "filter_code": "010000000000000000000.00000000000000.000000000001000000.00001.01.000.000", "uniprot_canonical_ac": "Q14697-1" } ], "record_id": "pubmed.27259053", "abstract": "", "glycosylation": [], "mutagenesis": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The Structure of the Polycystic Kidney Disease Channel PKD2 in Lipid Nanodiscs.", "journal": "Cell", "date": "2016", "authors": "Shen PS, Yang X, DeCaen PG, Liu X, Bulkley D, Clapham DE, Cao E", "reference": { "type": "PubMed", "id": "27768895", "url": "https://pubmed.ncbi.nlm.nih.gov/27768895" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q13563-1", "protein_name": "Polycystin-2", "gene_name": "PKD2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q13563", "url": "https://www.uniprot.org/uniprotkb/Q13563" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "glycosylation": [ { "glytoucan_ac": "", "type": "N-linked", "subtype": "Complex", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) (complex) asparagine;Complex", "icn3d_view": { "label": "iCn3D", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?bcifid=5K47&bu=0&command=select+.D:328;+center+selection;+zoom+selection" }, "start_pos": 328, "start_aa": "Asn", "end_pos": 328, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn328", "evidence": [ { "id": "Q13563", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/Q13563#ptm_processing" }, { "id": "28092368", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/28092368" }, { "id": "27991905", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/27991905" }, { "id": "27768895", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/27768895" }, { "id": "19139490", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19139490" }, { "id": "6WB8", "database": "PDB", "url": "https://www.rcsb.org/sequence/6WB8" }, { "id": "8HK7", "database": "PDB", "url": "https://www.rcsb.org/sequence/8HK7" }, { "id": "38483987", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/38483987" }, { "id": "32332171", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32332171" }, { "id": "5K47", "database": "PDB", "url": "https://www.rcsb.org/structure/5K47" }, { "id": "5MKF", "database": "PDB", "url": "https://www.rcsb.org/structure/5MKF" }, { "id": "5T4D", "database": "PDB", "url": "https://www.rcsb.org/structure/5T4D" }, { "id": "6D1W", "database": "PDB", "url": "https://www.rcsb.org/structure/6D1W" }, { "id": "6T9O", "database": "PDB", "url": "https://www.rcsb.org/structure/6T9O" }, { "id": "6T9N", "database": "PDB", "url": "https://www.rcsb.org/structure/6T9N" }, { "id": "8K3S", "database": "PDB", "url": "https://www.rcsb.org/structure/8K3S" }, { "id": "8Z6B", "database": "PDB", "url": "https://www.rcsb.org/structure/8Z6B" }, { "id": "8Z6H", "database": "PDB", "url": "https://www.rcsb.org/structure/8Z6H" }, { "id": "8ZKH", "database": "PDB", "url": "https://www.rcsb.org/structure/8ZKH" }, { "id": "8ZKR", "database": "PDB", "url": "https://www.rcsb.org/structure/8ZKR" }, { "id": "8ZKS", "database": "PDB", "url": "https://www.rcsb.org/structure/8ZKS" }, { "id": "8ZKT", "database": "PDB", "url": "https://www.rcsb.org/structure/8ZKT" }, { "id": "8ZKU", "database": "PDB", "url": "https://www.rcsb.org/structure/8ZKU" }, { "id": "8ZL8", "database": "PDB", "url": "https://www.rcsb.org/structure/8ZL8" }, { "id": "9L0M", "database": "PDB", "url": "https://www.rcsb.org/structure/9L0M" }, { "id": "9L0W", "database": "PDB", "url": "https://www.rcsb.org/structure/9L0W" } ], "filter_code": "001000000000000000000.10000000000000.00.01001", "uniprot_canonical_ac": "Q13563-1" }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "icn3d_view": { "label": "iCn3D", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?bcifid=5K47&bu=0&command=select+.D:362;+center+selection;+zoom+selection" }, "start_pos": 362, "start_aa": "Asn", "end_pos": 362, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn362", "evidence": [ { "id": "Q13563", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/Q13563#ptm_processing" }, { "id": "28092368", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/28092368" }, { "id": "27991905", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/27991905" }, { "id": "27768895", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/27768895" }, { "id": "6WB8", "database": "PDB", "url": "https://www.rcsb.org/sequence/6WB8" }, { "id": "38483987", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/38483987" }, { "id": "32332171", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32332171" }, { "id": "5K47", "database": "PDB", "url": "https://www.rcsb.org/structure/5K47" }, { "id": "5MKE", "database": "PDB", "url": "https://www.rcsb.org/structure/5MKE" }, { "id": "5MKF", "database": "PDB", "url": "https://www.rcsb.org/structure/5MKF" }, { "id": "5T4D", "database": "PDB", "url": "https://www.rcsb.org/structure/5T4D" }, { "id": "6D1W", "database": "PDB", "url": "https://www.rcsb.org/structure/6D1W" }, { "id": "6T9O", "database": "PDB", "url": "https://www.rcsb.org/structure/6T9O" }, { "id": "6T9N", "database": "PDB", "url": "https://www.rcsb.org/structure/6T9N" }, { "id": "8HK7", "database": "PDB", "url": "https://www.rcsb.org/structure/8HK7" }, { "id": "8K3S", "database": "PDB", "url": "https://www.rcsb.org/structure/8K3S" }, { "id": "8ZKH", "database": "PDB", "url": "https://www.rcsb.org/structure/8ZKH" }, { "id": "8ZKR", "database": "PDB", "url": "https://www.rcsb.org/structure/8ZKR" }, { "id": "8ZKS", "database": "PDB", "url": "https://www.rcsb.org/structure/8ZKS" }, { "id": "8ZKT", "database": "PDB", "url": "https://www.rcsb.org/structure/8ZKT" }, { "id": "8ZKU", "database": "PDB", "url": "https://www.rcsb.org/structure/8ZKU" }, { "id": "8ZL8", "database": "PDB", "url": "https://www.rcsb.org/structure/8ZL8" }, { "id": "9L0M", "database": "PDB", "url": "https://www.rcsb.org/structure/9L0M" }, { "id": "9L0W", "database": "PDB", "url": "https://www.rcsb.org/structure/9L0W" } ], "filter_code": "001000000000000000000.00010000000000.00.01001", "uniprot_canonical_ac": "Q13563-1" }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "icn3d_view": { "label": "iCn3D", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?bcifid=5MKE&bu=0&command=select+.D:375;+center+selection;+zoom+selection" }, "start_pos": 375, "start_aa": "Asn", "end_pos": 375, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn375", "evidence": [ { "id": "Q13563", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/Q13563#ptm_processing" }, { "id": "28092368", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/28092368" }, { "id": "27991905", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/27991905" }, { "id": "27768895", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/27768895" }, { "id": "6WB8", "database": "PDB", "url": "https://www.rcsb.org/sequence/6WB8" }, { "id": "8HK7", "database": "PDB", "url": "https://www.rcsb.org/sequence/8HK7" }, { "id": "38483987", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/38483987" }, { "id": "32332171", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32332171" }, { "id": "5MKE", "database": "PDB", "url": "https://www.rcsb.org/structure/5MKE" }, { "id": "5T4D", "database": "PDB", "url": "https://www.rcsb.org/structure/5T4D" }, { "id": "6D1W", "database": "PDB", "url": "https://www.rcsb.org/structure/6D1W" }, { "id": "8K3S", "database": "PDB", "url": "https://www.rcsb.org/structure/8K3S" }, { "id": "8Z6B", "database": "PDB", "url": "https://www.rcsb.org/structure/8Z6B" }, { "id": "8Z6H", "database": "PDB", "url": "https://www.rcsb.org/structure/8Z6H" }, { "id": "8ZKH", "database": "PDB", "url": "https://www.rcsb.org/structure/8ZKH" }, { "id": "8ZKR", "database": "PDB", "url": "https://www.rcsb.org/structure/8ZKR" }, { "id": "8ZKS", "database": "PDB", "url": "https://www.rcsb.org/structure/8ZKS" }, { "id": "8ZKT", "database": "PDB", "url": "https://www.rcsb.org/structure/8ZKT" }, { "id": "8ZKU", "database": "PDB", "url": "https://www.rcsb.org/structure/8ZKU" }, { "id": "8ZL8", "database": "PDB", "url": "https://www.rcsb.org/structure/8ZL8" }, { "id": "9L0M", "database": "PDB", "url": "https://www.rcsb.org/structure/9L0M" }, { "id": "9L0W", "database": "PDB", "url": "https://www.rcsb.org/structure/9L0W" } ], "filter_code": "001000000000000000000.00010000000000.00.01001", "uniprot_canonical_ac": "Q13563-1" } ], "record_id": "pubmed.27768895", "abstract": "", "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 3 }, { "field": "total_sites", "count": 3 }, { "field": "n_linked_sites", "count": 3 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "exact_sites", "count": 3 }, { "field": "exact_n_linked_sites", "count": 3 }, { "field": "fuzzy_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "icn3d_view.label", "icn3d_view.url", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl", "filter_code", "uniprot_canonical_ac" ] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 3 }, { "field": "total_sites", "count": 3 }, { "field": "n_linked_sites", "count": 3 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "exact_sites", "count": 3 }, { "field": "exact_n_linked_sites", "count": 3 }, { "field": "fuzzy_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "icn3d_view.label", "icn3d_view.url", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl", "filter_code", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Structure of the polycystic kidney disease TRP channel Polycystin-2 (PC2).", "journal": "Nature structural & molecular biology", "date": "2017", "authors": "Grieben M, Pike AC, Shintre CA, Venturi E, El-Ajouz S, Tessitore A, Shrestha L, Mukhopadhyay S, Mahajan P, Chalk R, Burgess-Brown NA, Sitsapesan R, Huiskonen JT, Carpenter EP", "reference": { "type": "PubMed", "id": "27991905", "url": "https://pubmed.ncbi.nlm.nih.gov/27991905" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q13563-1", "protein_name": "Polycystin-2", "gene_name": "PKD2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q13563", "url": "https://www.uniprot.org/uniprotkb/Q13563" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "glycosylation": [ { "glytoucan_ac": "", "type": "N-linked", "subtype": "Complex", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) (complex) asparagine;Complex", "icn3d_view": { "label": "iCn3D", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?bcifid=5K47&bu=0&command=select+.D:328;+center+selection;+zoom+selection" }, "start_pos": 328, "start_aa": "Asn", "end_pos": 328, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn328", "evidence": [ { "id": "Q13563", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/Q13563#ptm_processing" }, { "id": "28092368", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/28092368" }, { "id": "27991905", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/27991905" }, { "id": "27768895", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/27768895" }, { "id": "19139490", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19139490" }, { "id": "6WB8", "database": "PDB", "url": "https://www.rcsb.org/sequence/6WB8" }, { "id": "8HK7", "database": "PDB", "url": "https://www.rcsb.org/sequence/8HK7" }, { "id": "38483987", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/38483987" }, { "id": "32332171", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32332171" }, { "id": "5K47", "database": "PDB", "url": "https://www.rcsb.org/structure/5K47" }, { "id": "5MKF", "database": "PDB", "url": "https://www.rcsb.org/structure/5MKF" }, { "id": "5T4D", "database": "PDB", "url": "https://www.rcsb.org/structure/5T4D" }, { "id": "6D1W", "database": "PDB", "url": "https://www.rcsb.org/structure/6D1W" }, { "id": "6T9O", "database": "PDB", "url": "https://www.rcsb.org/structure/6T9O" }, { "id": "6T9N", "database": "PDB", "url": "https://www.rcsb.org/structure/6T9N" }, { "id": "8K3S", "database": "PDB", "url": "https://www.rcsb.org/structure/8K3S" }, { "id": "8Z6B", "database": "PDB", "url": "https://www.rcsb.org/structure/8Z6B" }, { "id": "8Z6H", "database": "PDB", "url": "https://www.rcsb.org/structure/8Z6H" }, { "id": "8ZKH", "database": "PDB", "url": "https://www.rcsb.org/structure/8ZKH" }, { "id": "8ZKR", "database": "PDB", "url": "https://www.rcsb.org/structure/8ZKR" }, { "id": "8ZKS", "database": "PDB", "url": "https://www.rcsb.org/structure/8ZKS" }, { "id": "8ZKT", "database": "PDB", "url": "https://www.rcsb.org/structure/8ZKT" }, { "id": "8ZKU", "database": "PDB", "url": "https://www.rcsb.org/structure/8ZKU" }, { "id": "8ZL8", "database": "PDB", "url": "https://www.rcsb.org/structure/8ZL8" }, { "id": "9L0M", "database": "PDB", "url": "https://www.rcsb.org/structure/9L0M" }, { "id": "9L0W", "database": "PDB", "url": "https://www.rcsb.org/structure/9L0W" } ], "filter_code": "001000000000000000000.10000000000000.00.01001", "uniprot_canonical_ac": "Q13563-1" }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "icn3d_view": { "label": "iCn3D", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?bcifid=5K47&bu=0&command=select+.D:362;+center+selection;+zoom+selection" }, "start_pos": 362, "start_aa": "Asn", "end_pos": 362, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn362", "evidence": [ { "id": "Q13563", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/Q13563#ptm_processing" }, { "id": "28092368", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/28092368" }, { "id": "27991905", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/27991905" }, { "id": "27768895", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/27768895" }, { "id": "6WB8", "database": "PDB", "url": "https://www.rcsb.org/sequence/6WB8" }, { "id": "38483987", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/38483987" }, { "id": "32332171", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32332171" }, { "id": "5K47", "database": "PDB", "url": "https://www.rcsb.org/structure/5K47" }, { "id": "5MKE", "database": "PDB", "url": "https://www.rcsb.org/structure/5MKE" }, { "id": "5MKF", "database": "PDB", "url": "https://www.rcsb.org/structure/5MKF" }, { "id": "5T4D", "database": "PDB", "url": "https://www.rcsb.org/structure/5T4D" }, { "id": "6D1W", "database": "PDB", "url": "https://www.rcsb.org/structure/6D1W" }, { "id": "6T9O", "database": "PDB", "url": "https://www.rcsb.org/structure/6T9O" }, { "id": "6T9N", "database": "PDB", "url": "https://www.rcsb.org/structure/6T9N" }, { "id": "8HK7", "database": "PDB", "url": "https://www.rcsb.org/structure/8HK7" }, { "id": "8K3S", "database": "PDB", "url": "https://www.rcsb.org/structure/8K3S" }, { "id": "8ZKH", "database": "PDB", "url": "https://www.rcsb.org/structure/8ZKH" }, { "id": "8ZKR", "database": "PDB", "url": "https://www.rcsb.org/structure/8ZKR" }, { "id": "8ZKS", "database": "PDB", "url": "https://www.rcsb.org/structure/8ZKS" }, { "id": "8ZKT", "database": "PDB", "url": "https://www.rcsb.org/structure/8ZKT" }, { "id": "8ZKU", "database": "PDB", "url": "https://www.rcsb.org/structure/8ZKU" }, { "id": "8ZL8", "database": "PDB", "url": "https://www.rcsb.org/structure/8ZL8" }, { "id": "9L0M", "database": "PDB", "url": "https://www.rcsb.org/structure/9L0M" }, { "id": "9L0W", "database": "PDB", "url": "https://www.rcsb.org/structure/9L0W" } ], "filter_code": "001000000000000000000.00010000000000.00.01001", "uniprot_canonical_ac": "Q13563-1" }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "icn3d_view": { "label": "iCn3D", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?bcifid=5MKE&bu=0&command=select+.D:375;+center+selection;+zoom+selection" }, "start_pos": 375, "start_aa": "Asn", "end_pos": 375, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn375", "evidence": [ { "id": "Q13563", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/Q13563#ptm_processing" }, { "id": "28092368", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/28092368" }, { "id": "27991905", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/27991905" }, { "id": "27768895", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/27768895" }, { "id": "6WB8", "database": "PDB", "url": "https://www.rcsb.org/sequence/6WB8" }, { "id": "8HK7", "database": "PDB", "url": "https://www.rcsb.org/sequence/8HK7" }, { "id": "38483987", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/38483987" }, { "id": "32332171", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32332171" }, { "id": "5MKE", "database": "PDB", "url": "https://www.rcsb.org/structure/5MKE" }, { "id": "5T4D", "database": "PDB", "url": "https://www.rcsb.org/structure/5T4D" }, { "id": "6D1W", "database": "PDB", "url": "https://www.rcsb.org/structure/6D1W" }, { "id": "8K3S", "database": "PDB", "url": "https://www.rcsb.org/structure/8K3S" }, { "id": "8Z6B", "database": "PDB", "url": "https://www.rcsb.org/structure/8Z6B" }, { "id": "8Z6H", "database": "PDB", "url": "https://www.rcsb.org/structure/8Z6H" }, { "id": "8ZKH", "database": "PDB", "url": "https://www.rcsb.org/structure/8ZKH" }, { "id": "8ZKR", "database": "PDB", "url": "https://www.rcsb.org/structure/8ZKR" }, { "id": "8ZKS", "database": "PDB", "url": "https://www.rcsb.org/structure/8ZKS" }, { "id": "8ZKT", "database": "PDB", "url": "https://www.rcsb.org/structure/8ZKT" }, { "id": "8ZKU", "database": "PDB", "url": "https://www.rcsb.org/structure/8ZKU" }, { "id": "8ZL8", "database": "PDB", "url": "https://www.rcsb.org/structure/8ZL8" }, { "id": "9L0M", "database": "PDB", "url": "https://www.rcsb.org/structure/9L0M" }, { "id": "9L0W", "database": "PDB", "url": "https://www.rcsb.org/structure/9L0W" } ], "filter_code": "001000000000000000000.00010000000000.00.01001", "uniprot_canonical_ac": "Q13563-1" } ], "record_id": "pubmed.27991905", "abstract": "", "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 3 }, { "field": "total_sites", "count": 3 }, { "field": "n_linked_sites", "count": 3 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "exact_sites", "count": 3 }, { "field": "exact_n_linked_sites", "count": 3 }, { "field": "fuzzy_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "icn3d_view.label", "icn3d_view.url", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl", "filter_code", "uniprot_canonical_ac" ] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 3 }, { "field": "total_sites", "count": 3 }, { "field": "n_linked_sites", "count": 3 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "exact_sites", "count": 3 }, { "field": "exact_n_linked_sites", "count": 3 }, { "field": "fuzzy_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "icn3d_view.label", "icn3d_view.url", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl", "filter_code", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Molecular insights into lipid-assisted Ca(2+) regulation of the TRP channel Polycystin-2.", "journal": "Nature structural & molecular biology", "date": "2017", "authors": "Wilkes M, Madej MG, Kreuter L, Rhinow D, Heinz V, De Sanctis S, Ruppel S, Richter RM, Joos F, Grieben M, Pike AC, Huiskonen JT, Carpenter EP, Kuhlbrandt W, Witzgall R, Ziegler C", "reference": { "type": "PubMed", "id": "28092368", "url": "https://pubmed.ncbi.nlm.nih.gov/28092368" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q13563-1", "protein_name": "Polycystin-2", "gene_name": "PKD2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q13563", "url": "https://www.uniprot.org/uniprotkb/Q13563" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "glycosylation": [ { "glytoucan_ac": "", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "icn3d_view": {}, "start_pos": 299, "start_aa": "Asn", "end_pos": 299, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn299", "evidence": [ { "id": "Q13563", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/Q13563#ptm_processing" }, { "id": "28092368", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/28092368" }, { "id": "24190977", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24190977" }, { "id": "GLY_000143", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000143" } ], "filter_code": "001000000000000000000.00010000000000.00.01000", "uniprot_canonical_ac": "Q13563-1" }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "icn3d_view": { "label": "iCn3D", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?bcifid=5MKE&bu=0&command=select+.D:305;+center+selection;+zoom+selection" }, "start_pos": 305, "start_aa": "Asn", "end_pos": 305, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn305", "evidence": [ { "id": "Q13563", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/Q13563#ptm_processing" }, { "id": "28092368", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/28092368" }, { "id": "24190977", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24190977" }, { "id": "GLY_000143", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000143" }, { "id": "5MKE", "database": "PDB", "url": "https://www.rcsb.org/structure/5MKE" } ], "filter_code": "001000000000000000000.00010000000000.00.01001", "uniprot_canonical_ac": "Q13563-1" }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "Complex", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) (complex) asparagine;Complex", "icn3d_view": { "label": "iCn3D", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?bcifid=5K47&bu=0&command=select+.D:328;+center+selection;+zoom+selection" }, "start_pos": 328, "start_aa": "Asn", "end_pos": 328, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn328", "evidence": [ { "id": "Q13563", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/Q13563#ptm_processing" }, { "id": "28092368", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/28092368" }, { "id": "27991905", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/27991905" }, { "id": "27768895", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/27768895" }, { "id": "19139490", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19139490" }, { "id": "6WB8", "database": "PDB", "url": "https://www.rcsb.org/sequence/6WB8" }, { "id": "8HK7", "database": "PDB", "url": "https://www.rcsb.org/sequence/8HK7" }, { "id": "38483987", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/38483987" }, { "id": "32332171", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32332171" }, { "id": "5K47", "database": "PDB", "url": "https://www.rcsb.org/structure/5K47" }, { "id": "5MKF", "database": "PDB", "url": "https://www.rcsb.org/structure/5MKF" }, { "id": "5T4D", "database": "PDB", "url": "https://www.rcsb.org/structure/5T4D" }, { "id": "6D1W", "database": "PDB", "url": "https://www.rcsb.org/structure/6D1W" }, { "id": "6T9O", "database": "PDB", "url": "https://www.rcsb.org/structure/6T9O" }, { "id": "6T9N", "database": "PDB", "url": "https://www.rcsb.org/structure/6T9N" }, { "id": "8K3S", "database": "PDB", "url": "https://www.rcsb.org/structure/8K3S" }, { "id": "8Z6B", "database": "PDB", "url": "https://www.rcsb.org/structure/8Z6B" }, { "id": "8Z6H", "database": "PDB", "url": "https://www.rcsb.org/structure/8Z6H" }, { "id": "8ZKH", "database": "PDB", "url": "https://www.rcsb.org/structure/8ZKH" }, { "id": "8ZKR", "database": "PDB", "url": "https://www.rcsb.org/structure/8ZKR" }, { "id": "8ZKS", "database": "PDB", "url": "https://www.rcsb.org/structure/8ZKS" }, { "id": "8ZKT", "database": "PDB", "url": "https://www.rcsb.org/structure/8ZKT" }, { "id": "8ZKU", "database": "PDB", "url": "https://www.rcsb.org/structure/8ZKU" }, { "id": "8ZL8", "database": "PDB", "url": "https://www.rcsb.org/structure/8ZL8" }, { "id": "9L0M", "database": "PDB", "url": "https://www.rcsb.org/structure/9L0M" }, { "id": "9L0W", "database": "PDB", "url": "https://www.rcsb.org/structure/9L0W" } ], "filter_code": "001000000000000000000.10000000000000.00.01001", "uniprot_canonical_ac": "Q13563-1" }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "icn3d_view": { "label": "iCn3D", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?bcifid=5K47&bu=0&command=select+.D:362;+center+selection;+zoom+selection" }, "start_pos": 362, "start_aa": "Asn", "end_pos": 362, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn362", "evidence": [ { "id": "Q13563", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/Q13563#ptm_processing" }, { "id": "28092368", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/28092368" }, { "id": "27991905", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/27991905" }, { "id": "27768895", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/27768895" }, { "id": "6WB8", "database": "PDB", "url": "https://www.rcsb.org/sequence/6WB8" }, { "id": "38483987", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/38483987" }, { "id": "32332171", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32332171" }, { "id": "5K47", "database": "PDB", "url": "https://www.rcsb.org/structure/5K47" }, { "id": "5MKE", "database": "PDB", "url": "https://www.rcsb.org/structure/5MKE" }, { "id": "5MKF", "database": "PDB", "url": "https://www.rcsb.org/structure/5MKF" }, { "id": "5T4D", "database": "PDB", "url": "https://www.rcsb.org/structure/5T4D" }, { "id": "6D1W", "database": "PDB", "url": "https://www.rcsb.org/structure/6D1W" }, { "id": "6T9O", "database": "PDB", "url": "https://www.rcsb.org/structure/6T9O" }, { "id": "6T9N", "database": "PDB", "url": "https://www.rcsb.org/structure/6T9N" }, { "id": "8HK7", "database": "PDB", "url": "https://www.rcsb.org/structure/8HK7" }, { "id": "8K3S", "database": "PDB", "url": "https://www.rcsb.org/structure/8K3S" }, { "id": "8ZKH", "database": "PDB", "url": "https://www.rcsb.org/structure/8ZKH" }, { "id": "8ZKR", "database": "PDB", "url": "https://www.rcsb.org/structure/8ZKR" }, { "id": "8ZKS", "database": "PDB", "url": "https://www.rcsb.org/structure/8ZKS" }, { "id": "8ZKT", "database": "PDB", "url": "https://www.rcsb.org/structure/8ZKT" }, { "id": "8ZKU", "database": "PDB", "url": "https://www.rcsb.org/structure/8ZKU" }, { "id": "8ZL8", "database": "PDB", "url": "https://www.rcsb.org/structure/8ZL8" }, { "id": "9L0M", "database": "PDB", "url": "https://www.rcsb.org/structure/9L0M" }, { "id": "9L0W", "database": "PDB", "url": "https://www.rcsb.org/structure/9L0W" } ], "filter_code": "001000000000000000000.00010000000000.00.01001", "uniprot_canonical_ac": "Q13563-1" }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "icn3d_view": { "label": "iCn3D", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?bcifid=5MKE&bu=0&command=select+.D:375;+center+selection;+zoom+selection" }, "start_pos": 375, "start_aa": "Asn", "end_pos": 375, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn375", "evidence": [ { "id": "Q13563", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/Q13563#ptm_processing" }, { "id": "28092368", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/28092368" }, { "id": "27991905", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/27991905" }, { "id": "27768895", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/27768895" }, { "id": "6WB8", "database": "PDB", "url": "https://www.rcsb.org/sequence/6WB8" }, { "id": "8HK7", "database": "PDB", "url": "https://www.rcsb.org/sequence/8HK7" }, { "id": "38483987", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/38483987" }, { "id": "32332171", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32332171" }, { "id": "5MKE", "database": "PDB", "url": "https://www.rcsb.org/structure/5MKE" }, { "id": "5T4D", "database": "PDB", "url": "https://www.rcsb.org/structure/5T4D" }, { "id": "6D1W", "database": "PDB", "url": "https://www.rcsb.org/structure/6D1W" }, { "id": "8K3S", "database": "PDB", "url": "https://www.rcsb.org/structure/8K3S" }, { "id": "8Z6B", "database": "PDB", "url": "https://www.rcsb.org/structure/8Z6B" }, { "id": "8Z6H", "database": "PDB", "url": "https://www.rcsb.org/structure/8Z6H" }, { "id": "8ZKH", "database": "PDB", "url": "https://www.rcsb.org/structure/8ZKH" }, { "id": "8ZKR", "database": "PDB", "url": "https://www.rcsb.org/structure/8ZKR" }, { "id": "8ZKS", "database": "PDB", "url": "https://www.rcsb.org/structure/8ZKS" }, { "id": "8ZKT", "database": "PDB", "url": "https://www.rcsb.org/structure/8ZKT" }, { "id": "8ZKU", "database": "PDB", "url": "https://www.rcsb.org/structure/8ZKU" }, { "id": "8ZL8", "database": "PDB", "url": "https://www.rcsb.org/structure/8ZL8" }, { "id": "9L0M", "database": "PDB", "url": "https://www.rcsb.org/structure/9L0M" }, { "id": "9L0W", "database": "PDB", "url": "https://www.rcsb.org/structure/9L0W" } ], "filter_code": "001000000000000000000.00010000000000.00.01001", "uniprot_canonical_ac": "Q13563-1" } ], "record_id": "pubmed.28092368", "abstract": "", "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 5 }, { "field": "total_sites", "count": 5 }, { "field": "n_linked_sites", "count": 5 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "exact_sites", "count": 5 }, { "field": "exact_n_linked_sites", "count": 5 }, { "field": "fuzzy_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl", "filter_code", "uniprot_canonical_ac", "icn3d_view.label", "icn3d_view.url" ] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 5 }, { "field": "total_sites", "count": 5 }, { "field": "n_linked_sites", "count": 5 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "exact_sites", "count": 5 }, { "field": "exact_n_linked_sites", "count": 5 }, { "field": "fuzzy_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl", "filter_code", "uniprot_canonical_ac", "icn3d_view.label", "icn3d_view.url" ] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Hydrophobic pore gates regulate ion permeation in polycystic kidney disease 2 and 2L1 channels.", "journal": "Nature communications", "date": "2018", "authors": "Zheng W, Yang X, Hu R, Cai R, Hofmann L, Wang Z, Hu Q, Liu X, Bulkley D, Yu Y, Tang J, Flockerzi V, Cao Y, Cao E, Chen XZ", "reference": { "type": "PubMed", "id": "29899465", "url": "https://pubmed.ncbi.nlm.nih.gov/29899465" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q13563-1", "protein_name": "Polycystin-2", "gene_name": "PKD2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q13563", "url": "https://www.uniprot.org/uniprotkb/Q13563" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 201, "end_pos": 201, "sequence_org": "W", "sequence_mut": "A", "comment": "Abolishes increased channel activity due to a gain of function mutation; when associated with P-604.", "evidence": [ { "database": "UniProtKB", "id": "Q13563", "url": "https://www.uniprot.org/uniprotkb/Q13563" }, { "database": "PubMed", "id": "29899465", "url": "https://pubmed.ncbi.nlm.nih.gov/29899465" } ], "uniprot_canonical_ac": "Q13563-1" }, { "start_pos": 604, "end_pos": 604, "sequence_org": "F", "sequence_mut": "P", "comment": "Gain-of-function mutation resulting in increased channel activity. Absence of gain of function; when associated with F-605 DEL; when associated with A-201; when associated with V-511; when associated with G-414; when associated with G-420; when associated with Y-684 DEL; when associated with A-684; when associated with R-632; when associated with R-632; when associated S-629. Increased channel activity; when associated with 736-L-N-737 DEL. Coexpression of PKD1 with PKD2- F604P dramatically reduces the current in comparison with that measured when PKD2-P-604 is expressed by itself.", "evidence": [ { "database": "UniProtKB", "id": "Q13563", "url": "https://www.uniprot.org/uniprotkb/Q13563" }, { "database": "PubMed", "id": "27071085", "url": "https://pubmed.ncbi.nlm.nih.gov/27071085" }, { "database": "PubMed", "id": "29899465", "url": "https://pubmed.ncbi.nlm.nih.gov/29899465" }, { "database": "PubMed", "id": "36420836", "url": "https://pubmed.ncbi.nlm.nih.gov/36420836" }, { "database": "PubMed", "id": "39009345", "url": "https://pubmed.ncbi.nlm.nih.gov/39009345" } ], "uniprot_canonical_ac": "Q13563-1" }, { "start_pos": 677, "end_pos": 677, "sequence_org": "L", "sequence_mut": "N", "comment": "Gain of function mutation.", "evidence": [ { "database": "UniProtKB", "id": "Q13563", "url": "https://www.uniprot.org/uniprotkb/Q13563" }, { "database": "PubMed", "id": "29899465", "url": "https://pubmed.ncbi.nlm.nih.gov/29899465" } ], "uniprot_canonical_ac": "Q13563-1" }, { "start_pos": 684, "end_pos": 684, "sequence_org": "Y", "sequence_mut": "A", "comment": "Abolishes increased channel activity due to a gain of function mutation; when associated with P-604.", "evidence": [ { "database": "UniProtKB", "id": "Q13563", "url": "https://www.uniprot.org/uniprotkb/Q13563" }, { "database": "PubMed", "id": "29899465", "url": "https://pubmed.ncbi.nlm.nih.gov/29899465" } ], "uniprot_canonical_ac": "Q13563-1" }, { "start_pos": 688, "end_pos": 688, "sequence_org": "K", "sequence_mut": "A", "comment": "Abolishes increased channel activity due to a gain of function mutation; when associated with P-604.", "evidence": [ { "database": "UniProtKB", "id": "Q13563", "url": "https://www.uniprot.org/uniprotkb/Q13563" }, { "database": "PubMed", "id": "29899465", "url": "https://pubmed.ncbi.nlm.nih.gov/29899465" } ], "uniprot_canonical_ac": "Q13563-1" } ], "record_id": "pubmed.29899465", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The ion channel function of polycystin-1 in the polycystin-1/polycystin-2 complex.", "journal": "EMBO reports", "date": "2019-11-05", "authors": "Wang Zhifei, Ng Courtney, Liu Xiong, Wang Yan, Li Bin, Kashyap Parul, Chaudhry Haroon A, Castro Alexis, Kalontar Enessa M, Ilyayev Leah, Walker Rebecca, Alexander R Todd, Qian Feng, Chen Xing-Zhen, Yu Yong", "reference": { "type": "PubMed", "id": "31441214", "url": "https://pubmed.ncbi.nlm.nih.gov/31441214" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q13563-1", "protein_name": "Polycystin-2", "gene_name": "PKD2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q13563", "url": "https://www.uniprot.org/uniprotkb/Q13563" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 677, "end_pos": 677, "sequence_org": "L", "sequence_mut": "A", "comment": "Constitutive active channel; when associated with A-681. Reduces but do not abolish ion channel function; when associated with S-629 and A-681. Reduces but do not abolish ion channel function; when associated with C-638 and A-681.", "evidence": [ { "database": "UniProtKB", "id": "Q13563", "url": "https://www.uniprot.org/uniprotkb/Q13563" }, { "database": "PubMed", "id": "31441214", "url": "https://pubmed.ncbi.nlm.nih.gov/31441214" }, { "database": "PubMed", "id": "39009345", "url": "https://pubmed.ncbi.nlm.nih.gov/39009345" } ], "uniprot_canonical_ac": "Q13563-1" }, { "start_pos": 681, "end_pos": 681, "sequence_org": "N", "sequence_mut": "A", "comment": "Constitutive active channel; when associated with A-677. Reduces but do not abolish ion channel function; when associated with S-629 and A-677. Reduces but do not abolish ion channel function; when associated with C-638 and A-677.", "evidence": [ { "database": "UniProtKB", "id": "Q13563", "url": "https://www.uniprot.org/uniprotkb/Q13563" }, { "database": "PubMed", "id": "31441214", "url": "https://pubmed.ncbi.nlm.nih.gov/31441214" }, { "database": "PubMed", "id": "39009345", "url": "https://pubmed.ncbi.nlm.nih.gov/39009345" } ], "uniprot_canonical_ac": "Q13563-1" } ], "record_id": "pubmed.31441214", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Lipid Interactions of a Ciliary Membrane TRP Channel: Simulation and Structural Studies of Polycystin-2.", "journal": "Structure", "date": "2020", "authors": "Wang Qinrui, Corey Robin A, Hedger George, Aryal Prafulla, Grieben Mariana, Nasrallah Chady, Baronina Agnese, Pike Ashley C W, Shi Jiye, Carpenter Elisabeth P, Sansom Mark S P", "reference": { "type": "PubMed", "id": "31806353", "url": "https://pubmed.ncbi.nlm.nih.gov/31806353" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q13563-1", "protein_name": "Polycystin-2", "gene_name": "PKD2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q13563", "url": "https://www.uniprot.org/uniprotkb/Q13563" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.31806353", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Molecular dysregulation of ciliary polycystin-2 channels caused by variants in the TOP domain.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2020", "authors": "Vien TN, Wang J, Ng LCT, Cao E, DeCaen PG", "reference": { "type": "PubMed", "id": "32332171", "url": "https://pubmed.ncbi.nlm.nih.gov/32332171" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q13563-1", "protein_name": "Polycystin-2", "gene_name": "PKD2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q13563", "url": "https://www.uniprot.org/uniprotkb/Q13563" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "glycosylation": [ { "glytoucan_ac": "", "type": "N-linked", "subtype": "Complex", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) (complex) asparagine;Complex", "icn3d_view": { "label": "iCn3D", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?bcifid=5K47&bu=0&command=select+.D:328;+center+selection;+zoom+selection" }, "start_pos": 328, "start_aa": "Asn", "end_pos": 328, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn328", "evidence": [ { "id": "Q13563", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/Q13563#ptm_processing" }, { "id": "28092368", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/28092368" }, { "id": "27991905", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/27991905" }, { "id": "27768895", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/27768895" }, { "id": "19139490", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19139490" }, { "id": "6WB8", "database": "PDB", "url": "https://www.rcsb.org/sequence/6WB8" }, { "id": "8HK7", "database": "PDB", "url": "https://www.rcsb.org/sequence/8HK7" }, { "id": "38483987", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/38483987" }, { "id": "32332171", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32332171" }, { "id": "5K47", "database": "PDB", "url": "https://www.rcsb.org/structure/5K47" }, { "id": "5MKF", "database": "PDB", "url": "https://www.rcsb.org/structure/5MKF" }, { "id": "5T4D", "database": "PDB", "url": "https://www.rcsb.org/structure/5T4D" }, { "id": "6D1W", "database": "PDB", "url": "https://www.rcsb.org/structure/6D1W" }, { "id": "6T9O", "database": "PDB", "url": "https://www.rcsb.org/structure/6T9O" }, { "id": "6T9N", "database": "PDB", "url": "https://www.rcsb.org/structure/6T9N" }, { "id": "8K3S", "database": "PDB", "url": "https://www.rcsb.org/structure/8K3S" }, { "id": "8Z6B", "database": "PDB", "url": "https://www.rcsb.org/structure/8Z6B" }, { "id": "8Z6H", "database": "PDB", "url": "https://www.rcsb.org/structure/8Z6H" }, { "id": "8ZKH", "database": "PDB", "url": "https://www.rcsb.org/structure/8ZKH" }, { "id": "8ZKR", "database": "PDB", "url": "https://www.rcsb.org/structure/8ZKR" }, { "id": "8ZKS", "database": "PDB", "url": "https://www.rcsb.org/structure/8ZKS" }, { "id": "8ZKT", "database": "PDB", "url": "https://www.rcsb.org/structure/8ZKT" }, { "id": "8ZKU", "database": "PDB", "url": "https://www.rcsb.org/structure/8ZKU" }, { "id": "8ZL8", "database": "PDB", "url": "https://www.rcsb.org/structure/8ZL8" }, { "id": "9L0M", "database": "PDB", "url": "https://www.rcsb.org/structure/9L0M" }, { "id": "9L0W", "database": "PDB", "url": "https://www.rcsb.org/structure/9L0W" } ], "filter_code": "001000000000000000000.10000000000000.00.01001", "uniprot_canonical_ac": "Q13563-1" }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "icn3d_view": { "label": "iCn3D", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?bcifid=5K47&bu=0&command=select+.D:362;+center+selection;+zoom+selection" }, "start_pos": 362, "start_aa": "Asn", "end_pos": 362, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn362", "evidence": [ { "id": "Q13563", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/Q13563#ptm_processing" }, { "id": "28092368", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/28092368" }, { "id": "27991905", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/27991905" }, { "id": "27768895", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/27768895" }, { "id": "6WB8", "database": "PDB", "url": "https://www.rcsb.org/sequence/6WB8" }, { "id": "38483987", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/38483987" }, { "id": "32332171", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32332171" }, { "id": "5K47", "database": "PDB", "url": "https://www.rcsb.org/structure/5K47" }, { "id": "5MKE", "database": "PDB", "url": "https://www.rcsb.org/structure/5MKE" }, { "id": "5MKF", "database": "PDB", "url": "https://www.rcsb.org/structure/5MKF" }, { "id": "5T4D", "database": "PDB", "url": "https://www.rcsb.org/structure/5T4D" }, { "id": "6D1W", "database": "PDB", "url": "https://www.rcsb.org/structure/6D1W" }, { "id": "6T9O", "database": "PDB", "url": "https://www.rcsb.org/structure/6T9O" }, { "id": "6T9N", "database": "PDB", "url": "https://www.rcsb.org/structure/6T9N" }, { "id": "8HK7", "database": "PDB", "url": "https://www.rcsb.org/structure/8HK7" }, { "id": "8K3S", "database": "PDB", "url": "https://www.rcsb.org/structure/8K3S" }, { "id": "8ZKH", "database": "PDB", "url": "https://www.rcsb.org/structure/8ZKH" }, { "id": "8ZKR", "database": "PDB", "url": "https://www.rcsb.org/structure/8ZKR" }, { "id": "8ZKS", "database": "PDB", "url": "https://www.rcsb.org/structure/8ZKS" }, { "id": "8ZKT", "database": "PDB", "url": "https://www.rcsb.org/structure/8ZKT" }, { "id": "8ZKU", "database": "PDB", "url": "https://www.rcsb.org/structure/8ZKU" }, { "id": "8ZL8", "database": "PDB", "url": "https://www.rcsb.org/structure/8ZL8" }, { "id": "9L0M", "database": "PDB", "url": "https://www.rcsb.org/structure/9L0M" }, { "id": "9L0W", "database": "PDB", "url": "https://www.rcsb.org/structure/9L0W" } ], "filter_code": "001000000000000000000.00010000000000.00.01001", "uniprot_canonical_ac": "Q13563-1" }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "icn3d_view": { "label": "iCn3D", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?bcifid=5MKE&bu=0&command=select+.D:375;+center+selection;+zoom+selection" }, "start_pos": 375, "start_aa": "Asn", "end_pos": 375, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn375", "evidence": [ { "id": "Q13563", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/Q13563#ptm_processing" }, { "id": "28092368", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/28092368" }, { "id": "27991905", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/27991905" }, { "id": "27768895", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/27768895" }, { "id": "6WB8", "database": "PDB", "url": "https://www.rcsb.org/sequence/6WB8" }, { "id": "8HK7", "database": "PDB", "url": "https://www.rcsb.org/sequence/8HK7" }, { "id": "38483987", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/38483987" }, { "id": "32332171", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32332171" }, { "id": "5MKE", "database": "PDB", "url": "https://www.rcsb.org/structure/5MKE" }, { "id": "5T4D", "database": "PDB", "url": "https://www.rcsb.org/structure/5T4D" }, { "id": "6D1W", "database": "PDB", "url": "https://www.rcsb.org/structure/6D1W" }, { "id": "8K3S", "database": "PDB", "url": "https://www.rcsb.org/structure/8K3S" }, { "id": "8Z6B", "database": "PDB", "url": "https://www.rcsb.org/structure/8Z6B" }, { "id": "8Z6H", "database": "PDB", "url": "https://www.rcsb.org/structure/8Z6H" }, { "id": "8ZKH", "database": "PDB", "url": "https://www.rcsb.org/structure/8ZKH" }, { "id": "8ZKR", "database": "PDB", "url": "https://www.rcsb.org/structure/8ZKR" }, { "id": "8ZKS", "database": "PDB", "url": "https://www.rcsb.org/structure/8ZKS" }, { "id": "8ZKT", "database": "PDB", "url": "https://www.rcsb.org/structure/8ZKT" }, { "id": "8ZKU", "database": "PDB", "url": "https://www.rcsb.org/structure/8ZKU" }, { "id": "8ZL8", "database": "PDB", "url": "https://www.rcsb.org/structure/8ZL8" }, { "id": "9L0M", "database": "PDB", "url": "https://www.rcsb.org/structure/9L0M" }, { "id": "9L0W", "database": "PDB", "url": "https://www.rcsb.org/structure/9L0W" } ], "filter_code": "001000000000000000000.00010000000000.00.01001", "uniprot_canonical_ac": "Q13563-1" } ], "mutagenesis": [ { "start_pos": 331, "end_pos": 331, "sequence_org": "C", "sequence_mut": "S", "comment": "Does not affect localization to the cilium. Loss of ion channel function.", "evidence": [ { "database": "UniProtKB", "id": "Q13563", "url": "https://www.uniprot.org/uniprotkb/Q13563" }, { "database": "PubMed", "id": "32332171", "url": "https://pubmed.ncbi.nlm.nih.gov/32332171" } ], "uniprot_canonical_ac": "Q13563-1" } ], "record_id": "pubmed.32332171", "abstract": "", "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 3 }, { "field": "total_sites", "count": 3 }, { "field": "n_linked_sites", "count": 3 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "exact_sites", "count": 3 }, { "field": "exact_n_linked_sites", "count": 3 }, { "field": "fuzzy_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "icn3d_view.label", "icn3d_view.url", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl", "filter_code", "uniprot_canonical_ac" ] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 3 }, { "field": "total_sites", "count": 3 }, { "field": "n_linked_sites", "count": 3 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "exact_sites", "count": 3 }, { "field": "exact_n_linked_sites", "count": 3 }, { "field": "fuzzy_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "icn3d_view.label", "icn3d_view.url", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl", "filter_code", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The heteromeric PC-1/PC-2 polycystin complex is activated by the PC-1 N-terminus.", "journal": "eLife", "date": "2020-11-09", "authors": "Ha Kotdaji, Nobuhara Mai, Wang Qinzhe, Walker Rebecca V, Qian Feng, Schartner Christoph, Cao Erhu, Delling Markus", "reference": { "type": "PubMed", "id": "33164752", "url": "https://pubmed.ncbi.nlm.nih.gov/33164752" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q13563-1", "protein_name": "Polycystin-2", "gene_name": "PKD2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q13563", "url": "https://www.uniprot.org/uniprotkb/Q13563" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.33164752", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Regulation of PKD2 channel function by TACAN.", "journal": "The Journal of physiology", "date": "2023-01", "authors": "Liu Xiong, Zhang Rui, Fatehi Mohammad, Wang Yifang, Long Wentong, Tian Rui, Deng Xiaoling, Weng Ziyi, Xu Qinyi, Light Peter E, Tang Jingfeng, Chen Xing-Zhen", "reference": { "type": "PubMed", "id": "36420836", "url": "https://pubmed.ncbi.nlm.nih.gov/36420836" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q13563-1", "protein_name": "Polycystin-2", "gene_name": "PKD2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BXJ8-1", "protein_name": "Transmembrane protein 120A", "gene_name": "TMEM120A", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q13563", "url": "https://www.uniprot.org/uniprotkb/Q13563" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 604, "end_pos": 604, "sequence_org": "F", "sequence_mut": "P", "comment": "Gain-of-function mutation resulting in increased channel activity. Absence of gain of function; when associated with F-605 DEL; when associated with A-201; when associated with V-511; when associated with G-414; when associated with G-420; when associated with Y-684 DEL; when associated with A-684; when associated with R-632; when associated with R-632; when associated S-629. Increased channel activity; when associated with 736-L-N-737 DEL. Coexpression of PKD1 with PKD2- F604P dramatically reduces the current in comparison with that measured when PKD2-P-604 is expressed by itself.", "evidence": [ { "database": "UniProtKB", "id": "Q13563", "url": "https://www.uniprot.org/uniprotkb/Q13563" }, { "database": "PubMed", "id": "27071085", "url": "https://pubmed.ncbi.nlm.nih.gov/27071085" }, { "database": "PubMed", "id": "29899465", "url": "https://pubmed.ncbi.nlm.nih.gov/29899465" }, { "database": "PubMed", "id": "36420836", "url": "https://pubmed.ncbi.nlm.nih.gov/36420836" }, { "database": "PubMed", "id": "39009345", "url": "https://pubmed.ncbi.nlm.nih.gov/39009345" } ], "uniprot_canonical_ac": "Q13563-1" } ], "record_id": "pubmed.36420836", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Molecular and structural basis of the dual regulation of the polycystin-2 ion channel by small-molecule ligands.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2024-03-19", "authors": "Wang Zhifei, Chen Mengying, Su Qiang, Morais Tiago D C, Wang Yan, Nazginov Elianna, Pillai Akhilraj R, Qian Feng, Shi Yigong, Yu Yong", "reference": { "type": "PubMed", "id": "38483987", "url": "https://pubmed.ncbi.nlm.nih.gov/38483987" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q13563-1", "protein_name": "Polycystin-2", "gene_name": "PKD2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q13563", "url": "https://www.uniprot.org/uniprotkb/Q13563" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "glycosylation": [ { "glytoucan_ac": "", "type": "N-linked", "subtype": "Complex", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) (complex) asparagine;Complex", "icn3d_view": { "label": "iCn3D", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?bcifid=5K47&bu=0&command=select+.D:328;+center+selection;+zoom+selection" }, "start_pos": 328, "start_aa": "Asn", "end_pos": 328, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn328", "evidence": [ { "id": "Q13563", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/Q13563#ptm_processing" }, { "id": "28092368", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/28092368" }, { "id": "27991905", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/27991905" }, { "id": "27768895", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/27768895" }, { "id": "19139490", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19139490" }, { "id": "6WB8", "database": "PDB", "url": "https://www.rcsb.org/sequence/6WB8" }, { "id": "8HK7", "database": "PDB", "url": "https://www.rcsb.org/sequence/8HK7" }, { "id": "38483987", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/38483987" }, { "id": "32332171", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32332171" }, { "id": "5K47", "database": "PDB", "url": "https://www.rcsb.org/structure/5K47" }, { "id": "5MKF", "database": "PDB", "url": "https://www.rcsb.org/structure/5MKF" }, { "id": "5T4D", "database": "PDB", "url": "https://www.rcsb.org/structure/5T4D" }, { "id": "6D1W", "database": "PDB", "url": "https://www.rcsb.org/structure/6D1W" }, { "id": "6T9O", "database": "PDB", "url": "https://www.rcsb.org/structure/6T9O" }, { "id": "6T9N", "database": "PDB", "url": "https://www.rcsb.org/structure/6T9N" }, { "id": "8K3S", "database": "PDB", "url": "https://www.rcsb.org/structure/8K3S" }, { "id": "8Z6B", "database": "PDB", "url": "https://www.rcsb.org/structure/8Z6B" }, { "id": "8Z6H", "database": "PDB", "url": "https://www.rcsb.org/structure/8Z6H" }, { "id": "8ZKH", "database": "PDB", "url": "https://www.rcsb.org/structure/8ZKH" }, { "id": "8ZKR", "database": "PDB", "url": "https://www.rcsb.org/structure/8ZKR" }, { "id": "8ZKS", "database": "PDB", "url": "https://www.rcsb.org/structure/8ZKS" }, { "id": "8ZKT", "database": "PDB", "url": "https://www.rcsb.org/structure/8ZKT" }, { "id": "8ZKU", "database": "PDB", "url": "https://www.rcsb.org/structure/8ZKU" }, { "id": "8ZL8", "database": "PDB", "url": "https://www.rcsb.org/structure/8ZL8" }, { "id": "9L0M", "database": "PDB", "url": "https://www.rcsb.org/structure/9L0M" }, { "id": "9L0W", "database": "PDB", "url": "https://www.rcsb.org/structure/9L0W" } ], "filter_code": "001000000000000000000.10000000000000.00.01001", "uniprot_canonical_ac": "Q13563-1" }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "icn3d_view": { "label": "iCn3D", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?bcifid=5K47&bu=0&command=select+.D:362;+center+selection;+zoom+selection" }, "start_pos": 362, "start_aa": "Asn", "end_pos": 362, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn362", "evidence": [ { "id": "Q13563", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/Q13563#ptm_processing" }, { "id": "28092368", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/28092368" }, { "id": "27991905", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/27991905" }, { "id": "27768895", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/27768895" }, { "id": "6WB8", "database": "PDB", "url": "https://www.rcsb.org/sequence/6WB8" }, { "id": "38483987", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/38483987" }, { "id": "32332171", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32332171" }, { "id": "5K47", "database": "PDB", "url": "https://www.rcsb.org/structure/5K47" }, { "id": "5MKE", "database": "PDB", "url": "https://www.rcsb.org/structure/5MKE" }, { "id": "5MKF", "database": "PDB", "url": "https://www.rcsb.org/structure/5MKF" }, { "id": "5T4D", "database": "PDB", "url": "https://www.rcsb.org/structure/5T4D" }, { "id": "6D1W", "database": "PDB", "url": "https://www.rcsb.org/structure/6D1W" }, { "id": "6T9O", "database": "PDB", "url": "https://www.rcsb.org/structure/6T9O" }, { "id": "6T9N", "database": "PDB", "url": "https://www.rcsb.org/structure/6T9N" }, { "id": "8HK7", "database": "PDB", "url": "https://www.rcsb.org/structure/8HK7" }, { "id": "8K3S", "database": "PDB", "url": "https://www.rcsb.org/structure/8K3S" }, { "id": "8ZKH", "database": "PDB", "url": "https://www.rcsb.org/structure/8ZKH" }, { "id": "8ZKR", "database": "PDB", "url": "https://www.rcsb.org/structure/8ZKR" }, { "id": "8ZKS", "database": "PDB", "url": "https://www.rcsb.org/structure/8ZKS" }, { "id": "8ZKT", "database": "PDB", "url": "https://www.rcsb.org/structure/8ZKT" }, { "id": "8ZKU", "database": "PDB", "url": "https://www.rcsb.org/structure/8ZKU" }, { "id": "8ZL8", "database": "PDB", "url": "https://www.rcsb.org/structure/8ZL8" }, { "id": "9L0M", "database": "PDB", "url": "https://www.rcsb.org/structure/9L0M" }, { "id": "9L0W", "database": "PDB", "url": "https://www.rcsb.org/structure/9L0W" } ], "filter_code": "001000000000000000000.00010000000000.00.01001", "uniprot_canonical_ac": "Q13563-1" }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "icn3d_view": { "label": "iCn3D", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?bcifid=5MKE&bu=0&command=select+.D:375;+center+selection;+zoom+selection" }, "start_pos": 375, "start_aa": "Asn", "end_pos": 375, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn375", "evidence": [ { "id": "Q13563", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/Q13563#ptm_processing" }, { "id": "28092368", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/28092368" }, { "id": "27991905", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/27991905" }, { "id": "27768895", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/27768895" }, { "id": "6WB8", "database": "PDB", "url": "https://www.rcsb.org/sequence/6WB8" }, { "id": "8HK7", "database": "PDB", "url": "https://www.rcsb.org/sequence/8HK7" }, { "id": "38483987", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/38483987" }, { "id": "32332171", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32332171" }, { "id": "5MKE", "database": "PDB", "url": "https://www.rcsb.org/structure/5MKE" }, { "id": "5T4D", "database": "PDB", "url": "https://www.rcsb.org/structure/5T4D" }, { "id": "6D1W", "database": "PDB", "url": "https://www.rcsb.org/structure/6D1W" }, { "id": "8K3S", "database": "PDB", "url": "https://www.rcsb.org/structure/8K3S" }, { "id": "8Z6B", "database": "PDB", "url": "https://www.rcsb.org/structure/8Z6B" }, { "id": "8Z6H", "database": "PDB", "url": "https://www.rcsb.org/structure/8Z6H" }, { "id": "8ZKH", "database": "PDB", "url": "https://www.rcsb.org/structure/8ZKH" }, { "id": "8ZKR", "database": "PDB", "url": "https://www.rcsb.org/structure/8ZKR" }, { "id": "8ZKS", "database": "PDB", "url": "https://www.rcsb.org/structure/8ZKS" }, { "id": "8ZKT", "database": "PDB", "url": "https://www.rcsb.org/structure/8ZKT" }, { "id": "8ZKU", "database": "PDB", "url": "https://www.rcsb.org/structure/8ZKU" }, { "id": "8ZL8", "database": "PDB", "url": "https://www.rcsb.org/structure/8ZL8" }, { "id": "9L0M", "database": "PDB", "url": "https://www.rcsb.org/structure/9L0M" }, { "id": "9L0W", "database": "PDB", "url": "https://www.rcsb.org/structure/9L0W" } ], "filter_code": "001000000000000000000.00010000000000.00.01001", "uniprot_canonical_ac": "Q13563-1" } ], "record_id": "pubmed.38483987", "abstract": "", "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 3 }, { "field": "total_sites", "count": 3 }, { "field": "n_linked_sites", "count": 3 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "exact_sites", "count": 3 }, { "field": "exact_n_linked_sites", "count": 3 }, { "field": "fuzzy_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "icn3d_view.label", "icn3d_view.url", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl", "filter_code", "uniprot_canonical_ac" ] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 3 }, { "field": "total_sites", "count": 3 }, { "field": "n_linked_sites", "count": 3 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "exact_sites", "count": 3 }, { "field": "exact_n_linked_sites", "count": 3 }, { "field": "fuzzy_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "icn3d_view.label", "icn3d_view.url", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl", "filter_code", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Comprehensive Analysis of PKD1 and PKD2 by Long-Read Sequencing in Autosomal Dominant Polycystic Kidney Disease.", "journal": "Clinical chemistry", "date": "2024-06-03", "authors": "Xu Dechao, Mao Aiping, Chen Libao, Wu Le, Ma Yiyi, Mei Changlin", "reference": { "type": "PubMed", "id": "38527221", "url": "https://pubmed.ncbi.nlm.nih.gov/38527221" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q13563-1", "protein_name": "Polycystin-2", "gene_name": "PKD2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P98161-1", "protein_name": "Polycystin-1", "gene_name": "PKD1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q13563", "url": "https://www.uniprot.org/uniprotkb/Q13563" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.38527221", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Disease-associated missense mutations in the pore loop of polycystin-2 alter its ion channel function in a heterologous expression system.", "journal": "The Journal of biological chemistry", "date": "2024-08", "authors": "Staudner Tobias, Geiges Linda, Khamseekaew Juthamas, Sure Florian, Korbmacher Christoph, Ilyaskin Alexandr V", "reference": { "type": "PubMed", "id": "39009345", "url": "https://pubmed.ncbi.nlm.nih.gov/39009345" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q13563-1", "protein_name": "Polycystin-2", "gene_name": "PKD2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q13563", "url": "https://www.uniprot.org/uniprotkb/Q13563" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 604, "end_pos": 604, "sequence_org": "F", "sequence_mut": "P", "comment": "Gain-of-function mutation resulting in increased channel activity. Absence of gain of function; when associated with F-605 DEL; when associated with A-201; when associated with V-511; when associated with G-414; when associated with G-420; when associated with Y-684 DEL; when associated with A-684; when associated with R-632; when associated with R-632; when associated S-629. Increased channel activity; when associated with 736-L-N-737 DEL. Coexpression of PKD1 with PKD2- F604P dramatically reduces the current in comparison with that measured when PKD2-P-604 is expressed by itself.", "evidence": [ { "database": "UniProtKB", "id": "Q13563", "url": "https://www.uniprot.org/uniprotkb/Q13563" }, { "database": "PubMed", "id": "27071085", "url": "https://pubmed.ncbi.nlm.nih.gov/27071085" }, { "database": "PubMed", "id": "29899465", "url": "https://pubmed.ncbi.nlm.nih.gov/29899465" }, { "database": "PubMed", "id": "36420836", "url": "https://pubmed.ncbi.nlm.nih.gov/36420836" }, { "database": "PubMed", "id": "39009345", "url": "https://pubmed.ncbi.nlm.nih.gov/39009345" } ], "uniprot_canonical_ac": "Q13563-1" }, { "start_pos": 629, "end_pos": 629, "sequence_org": "F", "sequence_mut": "S", "comment": "Abolishes increased channel activity due to a gain of function mutation; when associated with P-604. Reduces but do not abolish ion channel function; when associated with A-677 and A-681.", "evidence": [ { "database": "UniProtKB", "id": "Q13563", "url": "https://www.uniprot.org/uniprotkb/Q13563" }, { "database": "PubMed", "id": "39009345", "url": "https://pubmed.ncbi.nlm.nih.gov/39009345" } ], "uniprot_canonical_ac": "Q13563-1" }, { "start_pos": 638, "end_pos": 638, "sequence_org": "R", "sequence_mut": "C", "comment": "Abolishes increased channel activity due to a gain of function mutation; when associated with P-604. Reduces but do not abolish ion channel function; when associated with A-677 and A-681. Abolishes the Ca(2+) permeability and alters its monovalent cation selectivity; when associated with A-677 and A-681.", "evidence": [ { "database": "UniProtKB", "id": "Q13563", "url": "https://www.uniprot.org/uniprotkb/Q13563" }, { "database": "PubMed", "id": "39009345", "url": "https://pubmed.ncbi.nlm.nih.gov/39009345" } ], "uniprot_canonical_ac": "Q13563-1" }, { "start_pos": 677, "end_pos": 677, "sequence_org": "L", "sequence_mut": "A", "comment": "Constitutive active channel; when associated with A-681. Reduces but do not abolish ion channel function; when associated with S-629 and A-681. Reduces but do not abolish ion channel function; when associated with C-638 and A-681.", "evidence": [ { "database": "UniProtKB", "id": "Q13563", "url": "https://www.uniprot.org/uniprotkb/Q13563" }, { "database": "PubMed", "id": "31441214", "url": "https://pubmed.ncbi.nlm.nih.gov/31441214" }, { "database": "PubMed", "id": "39009345", "url": "https://pubmed.ncbi.nlm.nih.gov/39009345" } ], "uniprot_canonical_ac": "Q13563-1" }, { "start_pos": 681, "end_pos": 681, "sequence_org": "N", "sequence_mut": "A", "comment": "Constitutive active channel; when associated with A-677. Reduces but do not abolish ion channel function; when associated with S-629 and A-677. Reduces but do not abolish ion channel function; when associated with C-638 and A-677.", "evidence": [ { "database": "UniProtKB", "id": "Q13563", "url": "https://www.uniprot.org/uniprotkb/Q13563" }, { "database": "PubMed", "id": "31441214", "url": "https://pubmed.ncbi.nlm.nih.gov/31441214" }, { "database": "PubMed", "id": "39009345", "url": "https://pubmed.ncbi.nlm.nih.gov/39009345" } ], "uniprot_canonical_ac": "Q13563-1" } ], "record_id": "pubmed.39009345", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "PKD2, a gene for polycystic kidney disease that encodes an integral membrane protein.", "journal": "Science", "date": "1996", "authors": "Mochizuki T, Wu G, Hayashi T, Xenophontos S L, Veldhuisen B, Saris J J, Reynolds D M, Cai Y, Gabow P A, Pierides A, Kimberling W J, Breuning M H, Deltas C C, Peters D J, Somlo S", "reference": { "type": "PubMed", "id": "8650545", "url": "https://pubmed.ncbi.nlm.nih.gov/8650545" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q13563-1", "protein_name": "Polycystin-2", "gene_name": "PKD2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q13563", "url": "https://www.uniprot.org/uniprotkb/Q13563" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "snv": [ { "evidence": [ { "id": "Q13563", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/Q13563" }, { "id": "rs121918040", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs121918040" }, { "id": "rs121918040", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs121918040#frequency_tab" }, { "id": "rs121918040", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs121918040" }, { "id": "8650545", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/8650545" }, { "id": "rs121918040", "database": "COSMIC", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs121918040" } ], "glycoeffect": [], "start_pos": 742, "end_pos": 742, "subjects_tested": "1704", "subjects_positive": "1", "frequency": "0.1", "sequence_org": "R", "sequence_mut": "*", "comment": "Somatic mutation passed 2 filters: num. of cancers (5); protein-of-interest(glycogene, lectin/c-type/polycystin).", "chr_id": "4", "chr_pos": "88065479", "ref_nt": "C", "alt_nt": "T", "minor_allelic_frequency": "", "site_lbl": "R742", "disease": [ { "disease_id": "DOID:363", "recommended_name": { "id": "DOID:363", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus." }, "synonyms": [ { "id": "DOID:363", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:363", "name": "CA - cancer of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:363", "name": "Tumour of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:363", "name": "malignant neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:363", "name": "malignant uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:363", "name": "neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:363", "name": "uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:363", "name": "uterus neoplasm", "description": "" } ], "unlinked_id_list": [ "DOID:9460", "DOID:5166", "DOID:2021", "DOID:4114" ], "evidence": [ { "id": "363", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:363" } ] }, { "disease_id": "DOID:4362", "recommended_name": { "id": "DOID:4362", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:4362", "name": "cervical cancer", "description": "A female reproductive organ cancer that is located_in the cervix." }, "synonyms": [ { "id": "DOID:4362", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:4362", "name": "cervical neoplasm", "description": "" }, { "id": "DOID:4362", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:4362", "name": "cervix cancer", "description": "" }, { "id": "DOID:4362", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:4362", "name": "cervix uteri cancer", "description": "" }, { "id": "DOID:4362", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:4362", "name": "neoplasm of uterine cervix", "description": "" }, { "id": "DOID:4362", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:4362", "name": "tumor of the Cervix Uteri", "description": "" }, { "id": "DOID:4362", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:4362", "name": "uterine cervical neoplasm", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "cervical cancer", "description": "A primary or metastatic malignant neoplasm involving the cervix." }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "cervical neoplasm", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "tumor of the cervix uteri", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "tumour of the cervix uteri", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "uterine cervical neoplasm", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "cancer of uterine cervix", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "cervical cancer, somatic", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant cervical neoplasm", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant cervical tumor", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant cervical tumour", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant cervix neoplasm", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant cervix tumor", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant cervix tumour", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant cervix uteri neoplasm", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant cervix uteri tumor", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant cervix uteri tumour", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant neoplasm of cervix", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant neoplasm of cervix uteri", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant neoplasm of the cervix", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant neoplasm of the cervix uteri", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant neoplasm of the uterine cervix", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant neoplasm of uterine cervix", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant tumor of cervix", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant tumor of cervix uteri", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant tumor of the cervix", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant tumor of the cervix uteri", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant tumor of the uterine cervix", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant tumor of uterine cervix", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant tumour of cervix", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant tumour of cervix uteri", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant tumour of the cervix", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant tumour of the cervix uteri", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant tumour of the uterine cervix", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant tumour of uterine cervix", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant uterine cervix neoplasm", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant uterine cervix tumor", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant uterine cervix tumour", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "uterine cervix cancer", "description": "" }, { "id": "MIM:603956", "resource": "MIM", "url": "https://www.omim.org/entry/603956", "name": "Cervical cancer", "description": "Cervical cancer" } ], "unlinked_id_list": [], "evidence": [ { "id": "4362", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:4362" } ] }, { "disease_id": "DOID:263", "recommended_name": { "id": "DOID:263", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:263", "name": "kidney cancer", "description": "A urinary system cancer that is located_in the kidney." }, "synonyms": [ { "id": "DOID:263", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:263", "name": "malignant neoplasm of kidney except pelvis", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:263", "name": "malignant tumour of kidney", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:263", "name": "renal cancer", "description": "" } ], "unlinked_id_list": [ "DOID:3675", "DOID:4455" ], "evidence": [ { "id": "263", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:263" } ] }, { "disease_id": "DOID:4159", "recommended_name": { "id": "DOID:4159", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:4159", "name": "skin cancer", "description": "An integumentary system cancer located_in the skin that is the uncontrolled growth of abnormal skin cells." }, "synonyms": [ { "id": "DOID:4159", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:4159", "name": "CA - skin cancer", "description": "" }, { "id": "DOID:4159", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:4159", "name": "malignant neoplasm of skin", "description": "" }, { "id": "DOID:4159", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:4159", "name": "melanoma and Non-melanoma skin cancer", "description": "" } ], "unlinked_id_list": [ "DOID:3149", "DOID:3451" ], "evidence": [ { "id": "4159", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:4159" } ] }, { "disease_id": "DOID:9256", "recommended_name": { "id": "DOID:9256", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:9256", "name": "colorectal cancer", "description": "A large intestine cancer that is located_in the colon and/or located_in the rectum." }, "synonyms": [ { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "A primary or metastatic malignant neoplasm that affects the colon or rectum. Representative examples include carcinoma, lymphoma, and sarcoma." }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, advanced, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer with chromosomal instability, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectum cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectum neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "CRC", "description": "" }, { "id": "MIM:114500", "resource": "MIM", "url": "https://www.omim.org/entry/114500", "name": "Colorectal cancer", "description": "Colorectal cancer" } ], "unlinked_id_list": [], "evidence": [ { "id": "9256", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:9256" } ] }, { "disease_id": "DOID:0110859", "recommended_name": { "id": "DOID:0110859", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0110859", "name": "polycystic kidney disease 2", "description": "A autosomal dominant polycystic kidney disease that has_material_basis_in autosomal dominant inheritance of mutation in the PKD2 gene on chromosome 4q22.1." }, "synonyms": [ { "id": "DOID:0110859", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0110859", "name": "Polycystic Kidney Disease, Adult, Type II", "description": "" }, { "id": "DOID:0110859", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0110859", "name": "APKD2", "description": "" }, { "id": "DOID:0110859", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0110859", "name": "PKD2", "description": "" }, { "id": "MONDO:0013131", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013131", "name": "polycystic kidney disease 2", "description": "Autosomal dominant polycystic kidney disease caused by a mutation in PKD2." }, { "id": "MONDO:0013131", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013131", "name": "APKD2", "description": "" }, { "id": "MONDO:0013131", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013131", "name": "Autosomal dominant polycystic kidney disease type 2", "description": "" }, { "id": "MONDO:0013131", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013131", "name": "PKD2", "description": "" }, { "id": "MONDO:0013131", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013131", "name": "PKD2 autosomal dominant polycystic kidney disease", "description": "" }, { "id": "MONDO:0013131", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013131", "name": "autosomal dominant polycystic kidney disease caused by mutation in PKD2", "description": "" }, { "id": "MONDO:0013131", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013131", "name": "polycystic kidney disease 2", "description": "" }, { "id": "MONDO:0013131", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013131", "name": "polycystic kidney disease type 2", "description": "" }, { "id": "MIM:613095", "resource": "MIM", "url": "https://www.omim.org/entry/613095", "name": "Polycystic kidney disease 2 with or without polycystic liver disease", "description": "Polycystic kidney disease 2 with or without polycystic liver disease" } ], "unlinked_id_list": [], "evidence": [ { "id": "0110859", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110859" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease", "ebi" ], "filter_code": "010000000000000000000.00000000000000.000000000001000000.00001.01.000.000", "uniprot_canonical_ac": "Q13563-1" }, { "evidence": [ { "id": "rs2475915541", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs2475915541" }, { "id": "rs121918039", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs121918039" }, { "id": "rs121918039", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs121918039" }, { "id": "8650545", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/8650545" } ], "glycoeffect": [], "start_pos": 380, "end_pos": 380, "sequence_org": "W", "sequence_mut": "*", "comment": "Germline mutation passed 1 filters: glycogene of type=glycogene, lectin/c-type/polycystin.", "chr_id": "4", "chr_pos": "88043278", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "W380", "disease": [ { "disease_id": "DOID:0110859", "recommended_name": { "id": "DOID:0110859", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0110859", "name": "polycystic kidney disease 2", "description": "A autosomal dominant polycystic kidney disease that has_material_basis_in autosomal dominant inheritance of mutation in the PKD2 gene on chromosome 4q22.1." }, "synonyms": [ { "id": "DOID:0110859", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0110859", "name": "Polycystic Kidney Disease, Adult, Type II", "description": "" }, { "id": "DOID:0110859", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0110859", "name": "APKD2", "description": "" }, { "id": "DOID:0110859", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0110859", "name": "PKD2", "description": "" }, { "id": "MONDO:0013131", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013131", "name": "polycystic kidney disease 2", "description": "Autosomal dominant polycystic kidney disease caused by a mutation in PKD2." }, { "id": "MONDO:0013131", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013131", "name": "APKD2", "description": "" }, { "id": "MONDO:0013131", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013131", "name": "Autosomal dominant polycystic kidney disease type 2", "description": "" }, { "id": "MONDO:0013131", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013131", "name": "PKD2", "description": "" }, { "id": "MONDO:0013131", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013131", "name": "PKD2 autosomal dominant polycystic kidney disease", "description": "" }, { "id": "MONDO:0013131", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013131", "name": "autosomal dominant polycystic kidney disease caused by mutation in PKD2", "description": "" }, { "id": "MONDO:0013131", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013131", "name": "polycystic kidney disease 2", "description": "" }, { "id": "MONDO:0013131", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013131", "name": "polycystic kidney disease type 2", "description": "" }, { "id": "MIM:613095", "resource": "MIM", "url": "https://www.omim.org/entry/613095", "name": "Polycystic kidney disease 2 with or without polycystic liver disease", "description": "Polycystic kidney disease 2 with or without polycystic liver disease" } ], "unlinked_id_list": [], "evidence": [ { "id": "0110859", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110859" } ] } ], "keywords": [ "ebi", "germline", "disease" ], "filter_code": "000000000000000001000.00000000000000.000000000001000000.00001.10.000.000", "uniprot_canonical_ac": "Q13563-1" }, { "evidence": [ { "id": "rs121918041", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs121918041" }, { "id": "rs121918041", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs121918041" }, { "id": "8650545", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/8650545" } ], "glycoeffect": [], "start_pos": 405, "end_pos": 405, "sequence_org": "Q", "sequence_mut": "*", "comment": "Germline mutation passed 1 filters: glycogene of type=glycogene, lectin/c-type/polycystin.", "chr_id": "4", "chr_pos": "88043351", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "Q405", "disease": [ { "disease_id": "DOID:0110859", "recommended_name": { "id": "DOID:0110859", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0110859", "name": "polycystic kidney disease 2", "description": "A autosomal dominant polycystic kidney disease that has_material_basis_in autosomal dominant inheritance of mutation in the PKD2 gene on chromosome 4q22.1." }, "synonyms": [ { "id": "DOID:0110859", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0110859", "name": "Polycystic Kidney Disease, Adult, Type II", "description": "" }, { "id": "DOID:0110859", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0110859", "name": "APKD2", "description": "" }, { "id": "DOID:0110859", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0110859", "name": "PKD2", "description": "" }, { "id": "MONDO:0013131", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013131", "name": "polycystic kidney disease 2", "description": "Autosomal dominant polycystic kidney disease caused by a mutation in PKD2." }, { "id": "MONDO:0013131", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013131", "name": "APKD2", "description": "" }, { "id": "MONDO:0013131", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013131", "name": "Autosomal dominant polycystic kidney disease type 2", "description": "" }, { "id": "MONDO:0013131", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013131", "name": "PKD2", "description": "" }, { "id": "MONDO:0013131", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013131", "name": "PKD2 autosomal dominant polycystic kidney disease", "description": "" }, { "id": "MONDO:0013131", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013131", "name": "autosomal dominant polycystic kidney disease caused by mutation in PKD2", "description": "" }, { "id": "MONDO:0013131", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013131", "name": "polycystic kidney disease 2", "description": "" }, { "id": "MONDO:0013131", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013131", "name": "polycystic kidney disease type 2", "description": "" }, { "id": "MIM:613095", "resource": "MIM", "url": "https://www.omim.org/entry/613095", "name": "Polycystic kidney disease 2 with or without polycystic liver disease", "description": "Polycystic kidney disease 2 with or without polycystic liver disease" } ], "unlinked_id_list": [], "evidence": [ { "id": "0110859", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110859" } ] } ], "keywords": [ "ebi", "germline", "disease" ], "filter_code": "000000100000000000000.00000000000000.000000000001000000.00001.10.000.000", "uniprot_canonical_ac": "Q13563-1" } ], "record_id": "pubmed.8650545", "abstract": "", "glycosylation": [], "mutagenesis": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "A gene similar to PKD1 maps to chromosome 4q22: a candidate gene for PKD2.", "journal": "Genomics", "date": "1996", "authors": "Schneider MC, Rodriguez AM, Nomura H, Zhou J, Morton CC, Reeders ST, Weremowicz S", "reference": { "type": "PubMed", "id": "8954772", "url": "https://pubmed.ncbi.nlm.nih.gov/8954772" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q13563-1", "protein_name": "Polycystin-2", "gene_name": "PKD2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q13563", "url": "https://www.uniprot.org/uniprotkb/Q13563" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.8954772", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "A translation frameshift mutation induced by a cytosine insertion in the polycystic kidney disease 2 gene (PDK2).", "journal": "Human molecular genetics", "date": "1997-06", "authors": "Xenophontos S, Constantinides R, Hayashi T, Mochizuki T, Somlo S, Pierides A, Deltas C C", "reference": { "type": "PubMed", "id": "9175744", "url": "https://pubmed.ncbi.nlm.nih.gov/9175744" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q13563-1", "protein_name": "Polycystin-2", "gene_name": "PKD2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q13563", "url": "https://www.uniprot.org/uniprotkb/Q13563" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "snv": [ { "evidence": [ { "id": "rs2475869464", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs2475869464" }, { "id": "rs1560598042", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1560598042" }, { "id": "9175744", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/9175744" } ], "glycoeffect": [], "start_pos": 232, "end_pos": 232, "sequence_org": "I", "sequence_mut": "null", "comment": "Germline mutation passed 1 filters: glycogene of type=glycogene, lectin/c-type/polycystin.", "chr_id": "4", "chr_pos": "88019557_88019558", "ref_nt": "l", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "I232", "disease": [ { "disease_id": "DOID:0110859", "recommended_name": { "id": "DOID:0110859", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0110859", "name": "polycystic kidney disease 2", "description": "A autosomal dominant polycystic kidney disease that has_material_basis_in autosomal dominant inheritance of mutation in the PKD2 gene on chromosome 4q22.1." }, "synonyms": [ { "id": "DOID:0110859", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0110859", "name": "Polycystic Kidney Disease, Adult, Type II", "description": "" }, { "id": "DOID:0110859", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0110859", "name": "APKD2", "description": "" }, { "id": "DOID:0110859", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0110859", "name": "PKD2", "description": "" }, { "id": "MONDO:0013131", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013131", "name": "polycystic kidney disease 2", "description": "Autosomal dominant polycystic kidney disease caused by a mutation in PKD2." }, { "id": "MONDO:0013131", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013131", "name": "APKD2", "description": "" }, { "id": "MONDO:0013131", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013131", "name": "Autosomal dominant polycystic kidney disease type 2", "description": "" }, { "id": "MONDO:0013131", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013131", "name": "PKD2", "description": "" }, { "id": "MONDO:0013131", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013131", "name": "PKD2 autosomal dominant polycystic kidney disease", "description": "" }, { "id": "MONDO:0013131", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013131", "name": "autosomal dominant polycystic kidney disease caused by mutation in PKD2", "description": "" }, { "id": "MONDO:0013131", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013131", "name": "polycystic kidney disease 2", "description": "" }, { "id": "MONDO:0013131", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013131", "name": "polycystic kidney disease type 2", "description": "" }, { "id": "MIM:613095", "resource": "MIM", "url": "https://www.omim.org/entry/613095", "name": "Polycystic kidney disease 2 with or without polycystic liver disease", "description": "Polycystic kidney disease 2 with or without polycystic liver disease" } ], "unlinked_id_list": [], "evidence": [ { "id": "0110859", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110859" } ] } ], "keywords": [ "ebi", "germline", "disease" ], "filter_code": "000000000100000000000.00000000000000.000000000001000000.00001.10.000.000", "uniprot_canonical_ac": "Q13563-1" } ], "record_id": "pubmed.9175744", "abstract": "", "glycosylation": [], "mutagenesis": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Characterization of the exon structure of the polycystic kidney disease 2 gene (PKD2).", "journal": "Genomics", "date": "1997", "authors": "Hayashi T, Mochizuki T, Reynolds D M, Wu G, Cai Y, Somlo S", "reference": { "type": "PubMed", "id": "9286709", "url": "https://pubmed.ncbi.nlm.nih.gov/9286709" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q13563-1", "protein_name": "Polycystin-2", "gene_name": "PKD2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q13563", "url": "https://www.uniprot.org/uniprotkb/Q13563" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.9286709", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "A spectrum of mutations in the second gene for autosomal dominant polycystic kidney disease (PKD2).", "journal": "American journal of human genetics", "date": "1997", "authors": "Veldhuisen B, Saris JJ, de Haij S, Hayashi T, Reynolds DM, Mochizuki T, Elles R, Fossdal R, Bogdanova N, van Dijk MA, Coto E, Ravine D, Norby S, Verellen-Dumoulin C, Breuning MH, Somlo S, Peters DJ", "reference": { "type": "PubMed", "id": "9326320", "url": "https://pubmed.ncbi.nlm.nih.gov/9326320" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q13563-1", "protein_name": "Polycystin-2", "gene_name": "PKD2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q13563", "url": "https://www.uniprot.org/uniprotkb/Q13563" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.9326320", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Novel stop and frameshifting mutations in the autosomal dominant polycystic kidney disease 2 (PKD2) gene.", "journal": "Human genetics", "date": "1997-12", "authors": "Viribay M, Hayashi T, Teller\u00eda D, Mochizuki T, Reynolds D M, Alonso R, Lens X M, Moreno F, Harris P C, Somlo S, San Mill\u00e1n J L", "reference": { "type": "PubMed", "id": "9402976", "url": "https://pubmed.ncbi.nlm.nih.gov/9402976" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q13563-1", "protein_name": "Polycystin-2", "gene_name": "PKD2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q13563", "url": "https://www.uniprot.org/uniprotkb/Q13563" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "snv": [ { "evidence": [ { "id": "Q13563", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/Q13563" }, { "id": "rs121918042", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs121918042" }, { "id": "rs121918042", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs121918042" }, { "id": "9402976", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/9402976" } ], "glycoeffect": [], "start_pos": 464, "end_pos": 464, "subjects_tested": "1704", "subjects_positive": "1", "frequency": "0.1", "sequence_org": "R", "sequence_mut": "*", "comment": "Somatic mutation passed 1 filters: protein-of-interest(glycogene, lectin/c-type/polycystin).", "chr_id": "4", "chr_pos": "88046712", "ref_nt": "C", "alt_nt": "T", "minor_allelic_frequency": "", "site_lbl": "R464", "disease": [ { "disease_id": "DOID:363", "recommended_name": { "id": "DOID:363", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus." }, "synonyms": [ { "id": "DOID:363", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:363", "name": "CA - cancer of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:363", "name": "Tumour of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:363", "name": "malignant neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:363", "name": "malignant uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:363", "name": "neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:363", "name": "uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:363", "name": "uterus neoplasm", "description": "" } ], "unlinked_id_list": [ "DOID:9460", "DOID:5166", "DOID:2021", "DOID:4114" ], "evidence": [ { "id": "363", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:363" } ] }, { "disease_id": "DOID:0110859", "recommended_name": { "id": "DOID:0110859", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0110859", "name": "polycystic kidney disease 2", "description": "A autosomal dominant polycystic kidney disease that has_material_basis_in autosomal dominant inheritance of mutation in the PKD2 gene on chromosome 4q22.1." }, "synonyms": [ { "id": "DOID:0110859", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0110859", "name": "Polycystic Kidney Disease, Adult, Type II", "description": "" }, { "id": "DOID:0110859", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0110859", "name": "APKD2", "description": "" }, { "id": "DOID:0110859", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0110859", "name": "PKD2", "description": "" }, { "id": "MONDO:0013131", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013131", "name": "polycystic kidney disease 2", "description": "Autosomal dominant polycystic kidney disease caused by a mutation in PKD2." }, { "id": "MONDO:0013131", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013131", "name": "APKD2", "description": "" }, { "id": "MONDO:0013131", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013131", "name": "Autosomal dominant polycystic kidney disease type 2", "description": "" }, { "id": "MONDO:0013131", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013131", "name": "PKD2", "description": "" }, { "id": "MONDO:0013131", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013131", "name": "PKD2 autosomal dominant polycystic kidney disease", "description": "" }, { "id": "MONDO:0013131", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013131", "name": "autosomal dominant polycystic kidney disease caused by mutation in PKD2", "description": "" }, { "id": "MONDO:0013131", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013131", "name": "polycystic kidney disease 2", "description": "" }, { "id": "MONDO:0013131", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013131", "name": "polycystic kidney disease type 2", "description": "" }, { "id": "MIM:613095", "resource": "MIM", "url": "https://www.omim.org/entry/613095", "name": "Polycystic kidney disease 2 with or without polycystic liver disease", "description": "Polycystic kidney disease 2 with or without polycystic liver disease" } ], "unlinked_id_list": [], "evidence": [ { "id": "0110859", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110859" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease", "ebi", "germline" ], "filter_code": "010000000000000000000.00000000000000.000000000001000000.00001.11.000.000", "uniprot_canonical_ac": "Q13563-1" } ], "record_id": "pubmed.9402976", "abstract": "", "glycosylation": [], "mutagenesis": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "A novel frameshift mutation induced by an adenosine insertion in the polycystic kidney disease 2 (PKD2) gene.", "journal": "Kidney international", "date": "1998-05", "authors": "Pei Y, Wang K, Kasenda M, Paterson A D, Liang Y, Huang E, Lian J, Rogovea E, Somlo S, St George-Hyslop P", "reference": { "type": "PubMed", "id": "9573526", "url": "https://pubmed.ncbi.nlm.nih.gov/9573526" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q13563-1", "protein_name": "Polycystin-2", "gene_name": "PKD2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q13563", "url": "https://www.uniprot.org/uniprotkb/Q13563" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "snv": [ { "evidence": [ { "id": "rs757757289", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs757757289" }, { "id": "9573526", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/9573526" } ], "glycoeffect": [], "start_pos": 720, "end_pos": 720, "sequence_org": "N", "sequence_mut": "null", "comment": "Germline mutation passed 1 filters: glycogene of type=glycogene, lectin/c-type/polycystin.", "chr_id": "4", "chr_pos": "88065414", "ref_nt": "l", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "N720", "keywords": [ "ebi", "germline", "disease" ], "disease": [ { "disease_id": "DOID:0110859", "recommended_name": { "id": "DOID:0110859", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0110859", "name": "polycystic kidney disease 2", "description": "A autosomal dominant polycystic kidney disease that has_material_basis_in autosomal dominant inheritance of mutation in the PKD2 gene on chromosome 4q22.1." }, "synonyms": [ { "id": "DOID:0110859", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0110859", "name": "Polycystic Kidney Disease, Adult, Type II", "description": "" }, { "id": "DOID:0110859", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0110859", "name": "APKD2", "description": "" }, { "id": "DOID:0110859", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0110859", "name": "PKD2", "description": "" }, { "id": "MONDO:0013131", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013131", "name": "polycystic kidney disease 2", "description": "Autosomal dominant polycystic kidney disease caused by a mutation in PKD2." }, { "id": "MONDO:0013131", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013131", "name": "APKD2", "description": "" }, { "id": "MONDO:0013131", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013131", "name": "Autosomal dominant polycystic kidney disease type 2", "description": "" }, { "id": "MONDO:0013131", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013131", "name": "PKD2", "description": "" }, { "id": "MONDO:0013131", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013131", "name": "PKD2 autosomal dominant polycystic kidney disease", "description": "" }, { "id": "MONDO:0013131", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013131", "name": "autosomal dominant polycystic kidney disease caused by mutation in PKD2", "description": "" }, { "id": "MONDO:0013131", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013131", "name": "polycystic kidney disease 2", "description": "" }, { "id": "MONDO:0013131", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013131", "name": "polycystic kidney disease type 2", "description": "" }, { "id": "MIM:613095", "resource": "MIM", "url": "https://www.omim.org/entry/613095", "name": "Polycystic kidney disease 2 with or without polycystic liver disease", "description": "Polycystic kidney disease 2 with or without polycystic liver disease" } ], "unlinked_id_list": [], "evidence": [ { "id": "0110859", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110859" } ] } ], "filter_code": "001000000000000000000.00000000000000.000000000001000000.00001.10.000.000", "uniprot_canonical_ac": "Q13563-1" } ], "record_id": "pubmed.9573526", "abstract": "", "glycosylation": [], "mutagenesis": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Germinal and somatic mutations in the PKD2 gene of renal cysts in autosomal dominant polycystic kidney disease.", "journal": "Human molecular genetics", "date": "1999-03", "authors": "Koptides M, Hadjimichael C, Koupepidou P, Pierides A, Constantinou Deltas C", "reference": { "type": "PubMed", "id": "9949210", "url": "https://pubmed.ncbi.nlm.nih.gov/9949210" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q13563-1", "protein_name": "Polycystin-2", "gene_name": "PKD2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q13563", "url": "https://www.uniprot.org/uniprotkb/Q13563" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "snv": [ { "evidence": [ { "id": "rs1187336837", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1187336837" }, { "id": "9949210", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/9949210" } ], "glycoeffect": [], "start_pos": 69, "end_pos": 69, "sequence_org": "A", "sequence_mut": "null", "comment": "Germline mutation passed 1 filters: glycogene of type=glycogene, lectin/c-type/polycystin.", "chr_id": "4", "chr_pos": "88007936", "ref_nt": "p", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "A69", "keywords": [ "ebi", "germline", "disease" ], "disease": [ { "disease_id": "DOID:0110859", "recommended_name": { "id": "DOID:0110859", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0110859", "name": "polycystic kidney disease 2", "description": "A autosomal dominant polycystic kidney disease that has_material_basis_in autosomal dominant inheritance of mutation in the PKD2 gene on chromosome 4q22.1." }, "synonyms": [ { "id": "DOID:0110859", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0110859", "name": "Polycystic Kidney Disease, Adult, Type II", "description": "" }, { "id": "DOID:0110859", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0110859", "name": "APKD2", "description": "" }, { "id": "DOID:0110859", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0110859", "name": "PKD2", "description": "" }, { "id": "MONDO:0013131", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013131", "name": "polycystic kidney disease 2", "description": "Autosomal dominant polycystic kidney disease caused by a mutation in PKD2." }, { "id": "MONDO:0013131", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013131", "name": "APKD2", "description": "" }, { "id": "MONDO:0013131", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013131", "name": "Autosomal dominant polycystic kidney disease type 2", "description": "" }, { "id": "MONDO:0013131", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013131", "name": "PKD2", "description": "" }, { "id": "MONDO:0013131", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013131", "name": "PKD2 autosomal dominant polycystic kidney disease", "description": "" }, { "id": "MONDO:0013131", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013131", "name": "autosomal dominant polycystic kidney disease caused by mutation in PKD2", "description": "" }, { "id": "MONDO:0013131", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013131", "name": "polycystic kidney disease 2", "description": "" }, { "id": "MONDO:0013131", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013131", "name": "polycystic kidney disease type 2", "description": "" }, { "id": "MIM:613095", "resource": "MIM", "url": "https://www.omim.org/entry/613095", "name": "Polycystic kidney disease 2 with or without polycystic liver disease", "description": "Polycystic kidney disease 2 with or without polycystic liver disease" } ], "unlinked_id_list": [], "evidence": [ { "id": "0110859", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0110859" } ] } ], "filter_code": "100000000000000000000.00000000000000.000000000001000000.00001.10.000.000", "uniprot_canonical_ac": "Q13563-1" } ], "record_id": "pubmed.9949210", "abstract": "", "glycosylation": [], "mutagenesis": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Selective depletion of donor alloreactive T cells without loss of antiviral or antileukemic responses.", "journal": "Blood", "date": "2003-09-15", "authors": "Amrolia Persis J, Muccioli-Casadei Giada, Yvon Eric, Huls Helen, Sili Uluhan, Wieder Eric D, Bollard Catherine, Michalek Jaroslav, Ghetie Victor, Heslop Helen E, Molldrem Jeffrey J, Rooney Cliona M, Schlinder John, Vitetta Ellen, Brenner Malcolm K", "reference": { "type": "PubMed", "id": "12763937", "url": "https://pubmed.ncbi.nlm.nih.gov/12763937" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P24158-1", "protein_name": "Myeloblastin", "gene_name": "PRTN3", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P24158", "url": "https://www.uniprot.org/uniprotkb/P24158" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.12763937", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Structure, chromosomal assignment, and expression of the gene for proteinase-3. The Wegener's granulomatosis autoantigen.", "journal": "J. Biol. Chem.", "date": "1992", "authors": "Sturrock AB, Franklin KF, Rao G, Marshall BC, Rebentisch MB, Lemons RS, Hoidal JR", "reference": { "type": "PubMed", "id": "1400430", "url": "https://pubmed.ncbi.nlm.nih.gov/1400430" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P24158-1", "protein_name": "Myeloblastin", "gene_name": "PRTN3", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P24158", "url": "https://www.uniprot.org/uniprotkb/P24158" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.1400430", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Frequency of proteinase 3 (PR3)-specific autoreactive T cells determined by cytokine flow cytometry in Wegener's granulomatosis.", "journal": "Journal of autoimmunity", "date": "2004-02", "authors": "Winek Jolanta, Mueller Antje, Csernok Elena, Gross Wolfgang L, Lamprecht Peter", "reference": { "type": "PubMed", "id": "14709416", "url": "https://pubmed.ncbi.nlm.nih.gov/14709416" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P24158-1", "protein_name": "Myeloblastin", "gene_name": "PRTN3", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P24158", "url": "https://www.uniprot.org/uniprotkb/P24158" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.14709416", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Three human elastase-like genes coordinately expressed in the myelomonocyte lineage are organized as a single genetic locus on 19pter.", "journal": "Proc. Natl. Acad. Sci. U.S.A.", "date": "1992", "authors": "Zimmer M, Medcalf RL, Fink TM, Mattmann C, Lichter P, Jenne DE", "reference": { "type": "PubMed", "id": "1518849", "url": "https://pubmed.ncbi.nlm.nih.gov/1518849" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P24158-1", "protein_name": "Myeloblastin", "gene_name": "PRTN3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P20160-1", "protein_name": "Azurocidin", "gene_name": "AZU1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P24158", "url": "https://www.uniprot.org/uniprotkb/P24158" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.1518849", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Wegener autoantigen and myeloblastin are encoded by a single mRNA.", "journal": "Proc. Natl. Acad. Sci. U.S.A.", "date": "1991", "authors": "Labbaye C, Musette P, Cayre YE", "reference": { "type": "PubMed", "id": "1681549", "url": "https://pubmed.ncbi.nlm.nih.gov/1681549" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P24158-1", "protein_name": "Myeloblastin", "gene_name": "PRTN3", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P24158", "url": "https://www.uniprot.org/uniprotkb/P24158" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.1681549", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Anti-neutrophil cytoplasm antibodies in Wegener's granulomatosis recognize an elastinolytic enzyme.", "journal": "J. Exp. Med.", "date": "1990", "authors": "L\u00fcdemann J, Utecht B, Gross W L", "reference": { "type": "PubMed", "id": "1688612", "url": "https://pubmed.ncbi.nlm.nih.gov/1688612" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P24158-1", "protein_name": "Myeloblastin", "gene_name": "PRTN3", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P24158", "url": "https://www.uniprot.org/uniprotkb/P24158" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.1688612", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "NB1 mediates surface expression of the ANCA antigen proteinase 3 on human neutrophils.", "journal": "Blood", "date": "2007", "authors": "von Vietinghoff S, Tunnemann G, Eulenberg C, Wellner M, Cristina Cardoso M, Luft FC, Kettritz R", "reference": { "type": "PubMed", "id": "17244676", "url": "https://pubmed.ncbi.nlm.nih.gov/17244676" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P24158-1", "protein_name": "Myeloblastin", "gene_name": "PRTN3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N6Q3-1", "protein_name": "CD177 antigen", "gene_name": "CD177", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P24158", "url": "https://www.uniprot.org/uniprotkb/P24158" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.17244676", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Neutrophil surface presentation of the anti-neutrophil cytoplasmic antibody-antigen proteinase 3 depends on N-terminal processing.", "journal": "Clin. Exp. Immunol.", "date": "2008", "authors": "von Vietinghoff S, Eulenberg C, Wellner M, Luft FC, Kettritz R", "reference": { "type": "PubMed", "id": "18462208", "url": "https://pubmed.ncbi.nlm.nih.gov/18462208" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P24158-1", "protein_name": "Myeloblastin", "gene_name": "PRTN3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N6Q3-1", "protein_name": "CD177 antigen", "gene_name": "CD177", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P24158", "url": "https://www.uniprot.org/uniprotkb/P24158" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.18462208", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Wegener's autoantigen and leukemia.", "journal": "Blood", "date": "1991", "authors": "Musette P, Labbaye C, Dorner MH, Cayre YE, Casanova JL, Kourilsky P", "reference": { "type": "PubMed", "id": "2001463", "url": "https://pubmed.ncbi.nlm.nih.gov/2001463" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P24158-1", "protein_name": "Myeloblastin", "gene_name": "PRTN3", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P24158", "url": "https://www.uniprot.org/uniprotkb/P24158" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.2001463", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Characterization of proteinase-3 (PR-3), a neutrophil serine proteinase. Structural and functional properties.", "journal": "The Journal of biological chemistry", "date": "1991-05-25", "authors": "Rao N V, Wehner N G, Marshall B C, Gray W R, Gray B H, Hoidal J R", "reference": { "type": "PubMed", "id": "2033050", "url": "https://pubmed.ncbi.nlm.nih.gov/2033050" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P24158-1", "protein_name": "Myeloblastin", "gene_name": "PRTN3", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P24158", "url": "https://www.uniprot.org/uniprotkb/P24158" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.2033050", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "PR1-specific T cells are associated with unmaintained cytogenetic remission of chronic myelogenous leukemia after interferon withdrawal.", "journal": "PloS one", "date": "2010-07-26", "authors": "Kanodia Shreya, Wieder Eric, Lu Sijie, Talpaz Moshe, Alatrash Gheath, Clise-Dwyer Karen, Molldrem Jeffrey J", "reference": { "type": "PubMed", "id": "20668669", "url": "https://pubmed.ncbi.nlm.nih.gov/20668669" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P24158-1", "protein_name": "Myeloblastin", "gene_name": "PRTN3", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P24158", "url": "https://www.uniprot.org/uniprotkb/P24158" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.20668669", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Anti-neutrophil cytoplasmic antibodies target sequential functional proteinase 3 epitopes in the sera of patients with Wegener\u2019s granulomatosis.", "journal": "Clinical and experimental immunology", "date": "2010-11", "authors": "Bruner B F, Vista E S, Wynn D M, Harley J B, James J A", "reference": { "type": "PubMed", "id": "21077276", "url": "https://pubmed.ncbi.nlm.nih.gov/21077276" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P24158-1", "protein_name": "Myeloblastin", "gene_name": "PRTN3", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P24158", "url": "https://www.uniprot.org/uniprotkb/P24158" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.21077276", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Complement receptor Mac-1 is an adaptor for NB1 (CD177)-mediated PR3-ANCA neutrophil activation.", "journal": "J. Biol. Chem.", "date": "2011", "authors": "Jerke Uwe, Rolle Susanne, Dittmar Gunnar, Bayat Behnaz, Santoso Sentot, Sporbert Anje, Luft Friedrich, Kettritz Ralph", "reference": { "type": "PubMed", "id": "21193407", "url": "https://pubmed.ncbi.nlm.nih.gov/21193407" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P24158-1", "protein_name": "Myeloblastin", "gene_name": "PRTN3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N6Q3-1", "protein_name": "CD177 antigen", "gene_name": "CD177", "tax_name": "Human" }, { "uniprot_canonical_ac": "P11215-1", "protein_name": "Integrin alpha-M", "gene_name": "ITGAM", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05107-1", "protein_name": "Integrin beta-2", "gene_name": "ITGB2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P24158", "url": "https://www.uniprot.org/uniprotkb/P24158" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.21193407", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 4 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Monoclonal antibodies specific for neutrophil proteinase 4. Production and use for isolation of the enzyme.", "journal": "Biol. Chem. Hoppe-Seyler", "date": "1990", "authors": "Ohlsson K, Linder C, Rosengren M", "reference": { "type": "PubMed", "id": "2121162", "url": "https://pubmed.ncbi.nlm.nih.gov/2121162" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P24158-1", "protein_name": "Myeloblastin", "gene_name": "PRTN3", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P24158", "url": "https://www.uniprot.org/uniprotkb/P24158" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.2121162", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Proteinase 3 contributes to transendothelial migration of NB1-positive neutrophils.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "2012-03-01", "authors": "Kuckleburg Christopher J, Tilkens Sarah B, Santoso Sentot, Newman Peter J", "reference": { "type": "PubMed", "id": "22266279", "url": "https://pubmed.ncbi.nlm.nih.gov/22266279" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P24158-1", "protein_name": "Myeloblastin", "gene_name": "PRTN3", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P24158", "url": "https://www.uniprot.org/uniprotkb/P24158" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.22266279", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Identity of Wegener's autoantigen (p29) with proteinase 3 and myeloblastin.", "journal": "Blood", "date": "1990", "authors": "Gupta S K, Niles J L, McCluskey R T, Arnaout M A", "reference": { "type": "PubMed", "id": "2242436", "url": "https://pubmed.ncbi.nlm.nih.gov/2242436" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P24158-1", "protein_name": "Myeloblastin", "gene_name": "PRTN3", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P24158", "url": "https://www.uniprot.org/uniprotkb/P24158" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.2242436", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Cloning of cDNA for proteinase 3: a serine protease, antibiotic, and autoantigen from human neutrophils.", "journal": "J. Exp. Med.", "date": "1990", "authors": "Campanelli D, Melchior M, Fu Y, Nakata M, Shuman H, Nathan C, Gabay J E", "reference": { "type": "PubMed", "id": "2258701", "url": "https://pubmed.ncbi.nlm.nih.gov/2258701" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P24158-1", "protein_name": "Myeloblastin", "gene_name": "PRTN3", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P24158", "url": "https://www.uniprot.org/uniprotkb/P24158" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.2258701", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The relation of 29 kD C-ANCA antigen to proteinase 3.", "journal": "APMIS Suppl.", "date": "1990", "authors": "Goldschmeding R, Dolman K M, van den Ende M E, van der Meer-Gerritsen C H, Sonnenberg A, von dem Borne A E", "reference": { "type": "PubMed", "id": "2285532", "url": "https://pubmed.ncbi.nlm.nih.gov/2285532" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P24158-1", "protein_name": "Myeloblastin", "gene_name": "PRTN3", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P24158", "url": "https://www.uniprot.org/uniprotkb/P24158" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.2285532", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Neutrophil proteinase 3 acts on protease-activated receptor-2 to enhance vascular endothelial cell barrier function.", "journal": "Arteriosclerosis, thrombosis, and vascular biology", "date": "2013", "authors": "Kuckleburg CJ, Newman PJ", "reference": { "type": "PubMed", "id": "23202369", "url": "https://pubmed.ncbi.nlm.nih.gov/23202369" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P24158-1", "protein_name": "Myeloblastin", "gene_name": "PRTN3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N6Q3-1", "protein_name": "CD177 antigen", "gene_name": "CD177", "tax_name": "Human" }, { "uniprot_canonical_ac": "P55085-1", "protein_name": "Proteinase-activated receptor 2", "gene_name": "F2RL1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P24158", "url": "https://www.uniprot.org/uniprotkb/P24158" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.23202369", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Wegener's autoantigen decoded.", "journal": "Nature", "date": "1990", "authors": "Jenne D E, Tschopp J, L\u00fcdemann J, Utecht B, Gross W L", "reference": { "type": "PubMed", "id": "2377228", "url": "https://pubmed.ncbi.nlm.nih.gov/2377228" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P24158-1", "protein_name": "Myeloblastin", "gene_name": "PRTN3", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P24158", "url": "https://www.uniprot.org/uniprotkb/P24158" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.2377228", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Characterization of two azurphil granule proteases with active-site homology to neutrophil elastase.", "journal": "J. Biol. Chem.", "date": "1990", "authors": "Wilde C G, Snable J L, Griffith J E, Scott R W", "reference": { "type": "PubMed", "id": "2404977", "url": "https://pubmed.ncbi.nlm.nih.gov/2404977" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P24158-1", "protein_name": "Myeloblastin", "gene_name": "PRTN3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P20160-1", "protein_name": "Azurocidin", "gene_name": "AZU1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P24158", "url": "https://www.uniprot.org/uniprotkb/P24158" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.2404977", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "CD4(+)and CD8(+)T-cell reactions against leukemia-associated- or minor-histocompatibility-antigens in AML-patients after allogeneic SCT.", "journal": "Immunobiology", "date": "2014-04", "authors": "Steger Brigitte, Milosevic Slavoljub, Doessinger Georg, Reuther Susanne, Liepert Anja, Braeu Marion, Schick Julia, Vogt Valentin, Schuster Friedhelm, Kroell Tanja, Busch Dirk H, Borkhardt Arndt, Kolb Hans-Jochem, Tischer Johanna, Buhmann Raymund, Schmetzer Helga", "reference": { "type": "PubMed", "id": "24315637", "url": "https://pubmed.ncbi.nlm.nih.gov/24315637" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P24158-1", "protein_name": "Myeloblastin", "gene_name": "PRTN3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P19544-1", "protein_name": "Wilms tumor protein", "gene_name": "WT1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P78395-1", "protein_name": "Melanoma antigen preferentially expressed in tumors", "gene_name": "PRAME", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P24158", "url": "https://www.uniprot.org/uniprotkb/P24158" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.24315637", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Down-regulation of a serine protease, myeloblastin, causes growth arrest and differentiation of promyelocytic leukemia cells.", "journal": "Cell", "date": "1989", "authors": "Bories D, Raynal M C, Solomon D H, Darzynkiewicz Z, Cayre Y E", "reference": { "type": "PubMed", "id": "2598267", "url": "https://pubmed.ncbi.nlm.nih.gov/2598267" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P24158-1", "protein_name": "Myeloblastin", "gene_name": "PRTN3", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P24158", "url": "https://www.uniprot.org/uniprotkb/P24158" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.2598267", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Wegener's granulomatosis autoantigen is a novel neutrophil serine proteinase.", "journal": "Blood", "date": "1989", "authors": "Niles J L, McCluskey R T, Ahmad M F, Arnaout M A", "reference": { "type": "PubMed", "id": "2679910", "url": "https://pubmed.ncbi.nlm.nih.gov/2679910" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P24158-1", "protein_name": "Myeloblastin", "gene_name": "PRTN3", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P24158", "url": "https://www.uniprot.org/uniprotkb/P24158" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.2679910", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Characterization of the CD177 interaction with the ANCA antigen proteinase 3.", "journal": "Scientific reports", "date": "2017-02-27", "authors": "Jerke Uwe, Marino Stephen F, Daumke Oliver, Kettritz Ralph", "reference": { "type": "PubMed", "id": "28240246", "url": "https://pubmed.ncbi.nlm.nih.gov/28240246" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P24158-1", "protein_name": "Myeloblastin", "gene_name": "PRTN3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N6Q3-1", "protein_name": "CD177 antigen", "gene_name": "CD177", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P24158", "url": "https://www.uniprot.org/uniprotkb/P24158" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.28240246", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Proteinase 3. A distinct human polymorphonuclear leukocyte proteinase that produces emphysema in hamsters.", "journal": "The Journal of clinical investigation", "date": "1988-12", "authors": "Kao R C, Wehner N G, Skubitz K M, Gray B H, Hoidal J R", "reference": { "type": "PubMed", "id": "3198760", "url": "https://pubmed.ncbi.nlm.nih.gov/3198760" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P24158-1", "protein_name": "Myeloblastin", "gene_name": "PRTN3", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P24158", "url": "https://www.uniprot.org/uniprotkb/P24158" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.3198760", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Immunological Interaction of HLA-DPB1 and Proteinase 3 in ANCA Vasculitis is Associated with Clinical Disease Activity.", "journal": "Journal of the American Society of Nephrology : JASN", "date": "2022", "authors": "Chen DP, McInnis EA, Wu EY, Stember KG, Hogan SL, Hu Y, Henderson CD, Blazek LN, Mallal S, Karosiene E, Peters B, Sidney J, James EA, Kwok WW, Jennette JC, Ciavatta DJ, Falk RJ, Free ME", "reference": { "type": "PubMed", "id": "35672132", "url": "https://pubmed.ncbi.nlm.nih.gov/35672132" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P24158-1", "protein_name": "Myeloblastin", "gene_name": "PRTN3", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P24158", "url": "https://www.uniprot.org/uniprotkb/P24158" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.35672132", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "GPR97 triggers inflammatory processes in human neutrophils via a macromolecular complex upstream of PAR2 activation.", "journal": "Nature communications", "date": "2022-10-27", "authors": "Chu Tai-Ying, Zheng-G\u00e9rard C\u00e9line, Huang Kuan-Yeh, Chang Yu-Chi, Chen Ying-Wen, I Kuan-Yu, Lo Yu-Ling, Chiang Nien-Yi, Chen Hsin-Yi, Stacey Martin, Gordon Siamon, Tseng Wen-Yi, Sun Chiao-Yin, Wu Yen-Mu, Pan Yi-Shin, Huang Chien-Hao, Lin Chun-Yen, Chen Tse-Ching, El Omari Kamel, Antonelou Marilina, Henderson Scott R, Salama Alan, Seiradake Elena, Lin Hsi-Hsien", "reference": { "type": "PubMed", "id": "36302784", "url": "https://pubmed.ncbi.nlm.nih.gov/36302784" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P24158-1", "protein_name": "Myeloblastin", "gene_name": "PRTN3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86Y34-1", "protein_name": "Adhesion G protein-coupled receptor G3", "gene_name": "ADGRG3", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P24158", "url": "https://www.uniprot.org/uniprotkb/P24158" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.36302784", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Identification of proteinase 3 autoreactive CD4+T cells and their T-cell receptor repertoires in antineutrophil cytoplasmic antibody-associated vasculitis.", "journal": "Kidney international", "date": "2023-02-15", "authors": "Sharma Ravi Kumar, Yoosuf Niyaz, Afonso Marcelo, Scheffschick Andrea, Avik Aune, Bartoletti Alice, Horuluoglu Begum, Diaz Boada Juan Sebastian, Boddul Sanjay Kumar, Jonasdottir Asta D\u00f6gg, L\u00f6vstr\u00f6m Bj\u00f6rn, Brauner Hanna, Raposo Bruno, Chemin Karine, Bruchfeld Annette, Gunnarsson Iva, Malmstr\u00f6m Vivianne", "reference": { "type": "PubMed", "id": "36804380", "url": "https://pubmed.ncbi.nlm.nih.gov/36804380" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P24158-1", "protein_name": "Myeloblastin", "gene_name": "PRTN3", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P24158", "url": "https://www.uniprot.org/uniprotkb/P24158" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.36804380", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Identification of PRTN3 as a novel biomarker for the diagnosis of early gastric cance.", "journal": "Journal of proteomics", "date": "2023-04-15", "authors": "Guo Daxin, Zhang Biying, Wu Dong, Hu Xujun, Tu Hanxiao", "reference": { "type": "PubMed", "id": "36804624", "url": "https://pubmed.ncbi.nlm.nih.gov/36804624" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P24158-1", "protein_name": "Myeloblastin", "gene_name": "PRTN3", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P24158", "url": "https://www.uniprot.org/uniprotkb/P24158" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.36804624", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Risk of relapse of ANCA-associated vasculitis among patients homozygous for the proteinase 3 gene Val119Ile polymorphism.", "journal": "RMD open", "date": "2023-03", "authors": "Casal Moura Marta, Deng Zuoming, Brooks Stephen R, Tew Wei, Fervenza Fernando C, Kallenberg Cees G M, Langford Carol A, Merkel Peter A, Monach Paul A, Seo Philip, Spiera Robert F, St Clair E William, Stone John H, Prunotto Marco, Grayson Peter C, Specks Ulrich", "reference": { "type": "PubMed", "id": "36990659", "url": "https://pubmed.ncbi.nlm.nih.gov/36990659" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P24158-1", "protein_name": "Myeloblastin", "gene_name": "PRTN3", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P24158", "url": "https://www.uniprot.org/uniprotkb/P24158" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.36990659", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Elevated first-trimester neutrophil elastase and proteinase 3 increase the risk of gestational diabetes mellitus and adverse fetal outcomes.", "journal": "Reproductive biology and endocrinology : RB&E", "date": "2024-01-02", "authors": "Wang Lihong, Zhou Zhoujunhao, Xu Xinming, Li Yue, Zhang Rui, Yu Zhiyan, Huang Xinmei, Zang Shufei, Sun Tiange", "reference": { "type": "PubMed", "id": "38167145", "url": "https://pubmed.ncbi.nlm.nih.gov/38167145" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P24158-1", "protein_name": "Myeloblastin", "gene_name": "PRTN3", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P24158", "url": "https://www.uniprot.org/uniprotkb/P24158" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.38167145", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "A novel form of dipeptidylpeptidase IV found in human serum. Isolation, characterization, and comparison with T lymphocyte membrane dipeptidylpeptidase IV (CD26).", "journal": "J. Biol. Chem.", "date": "1995", "authors": "Duke-Cohan JS, Morimoto C, Rocker JA, Schlossman SF", "reference": { "type": "PubMed", "id": "7539799", "url": "https://pubmed.ncbi.nlm.nih.gov/7539799" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P24158-1", "protein_name": "Myeloblastin", "gene_name": "PRTN3", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75882-1", "protein_name": "Attractin", "gene_name": "ATRN", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q03405-1", "protein_name": "Urokinase plasminogen activator surface receptor", "gene_name": "PLAUR", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P24158", "url": "https://www.uniprot.org/uniprotkb/P24158" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.7539799", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Epitopes on proteinase-3 recognized by antibodies from patients with Wegener's granulomatosis.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "1994-05-01", "authors": "Williams R C, Staud R, Malone C C, Payabyab J, Byres L, Underwood D", "reference": { "type": "PubMed", "id": "8157982", "url": "https://pubmed.ncbi.nlm.nih.gov/8157982" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P24158-1", "protein_name": "Myeloblastin", "gene_name": "PRTN3", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P24158", "url": "https://www.uniprot.org/uniprotkb/P24158" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.8157982", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The crystal structure of PR3, a neutrophil serine proteinase antigen of Wegener's granulomatosis antibodies.", "journal": "Journal of molecular biology", "date": "1996", "authors": "Fujinaga M, Chernaia MM, Halenbeck R, Koths K, James MN", "reference": { "type": "PubMed", "id": "8757293", "url": "https://pubmed.ncbi.nlm.nih.gov/8757293" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P24158-1", "protein_name": "Myeloblastin", "gene_name": "PRTN3", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P24158", "url": "https://www.uniprot.org/uniprotkb/P24158" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "glycosylation": [ { "glytoucan_ac": "", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "icn3d_view": { "label": "iCn3D", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?bcifid=9IGO&bu=0&command=select+.A:174;+center+selection;+zoom+selection" }, "start_pos": 174, "start_aa": "Asn", "end_pos": 174, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn174", "evidence": [ { "id": "P24158", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P24158#ptm_processing" }, { "id": "1FUJ", "database": "PDB", "url": "https://www.rcsb.org/sequence/1FUJ" }, { "id": "8757293", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/8757293" }, { "id": "9IGO", "database": "PDB", "url": "https://www.rcsb.org/structure/9IGO" } ], "filter_code": "001000000000000000000.00010000000000.00.01001", "uniprot_canonical_ac": "P24158-1" } ], "record_id": "pubmed.8757293", "abstract": "", "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_sites", "count": 1 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "exact_sites", "count": 1 }, { "field": "exact_n_linked_sites", "count": 1 }, { "field": "fuzzy_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "icn3d_view.label", "icn3d_view.url", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl", "filter_code", "uniprot_canonical_ac" ] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_sites", "count": 1 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "exact_sites", "count": 1 }, { "field": "exact_n_linked_sites", "count": 1 }, { "field": "fuzzy_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "icn3d_view.label", "icn3d_view.url", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl", "filter_code", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Donor-recipient polymorphism of the proteinase 3 gene: a potential target for T-cell alloresponses to myeloid leukemia.", "journal": "J. Immunother.", "date": "1999", "authors": "Clave E, Molldrem J, Hensel N, Raptis A, Barrett A J", "reference": { "type": "PubMed", "id": "9924693", "url": "https://pubmed.ncbi.nlm.nih.gov/9924693" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P24158-1", "protein_name": "Myeloblastin", "gene_name": "PRTN3", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P24158", "url": "https://www.uniprot.org/uniprotkb/P24158" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.9924693", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Identification of a third alternatively spliced cDNA encoding the catalytic subunit of protein phosphatase 2B beta.", "journal": "Biochim. Biophys. Acta", "date": "1991", "authors": "McPartlin AE, Barker HM, Cohen PT", "reference": { "type": "PubMed", "id": "1848109", "url": "https://pubmed.ncbi.nlm.nih.gov/1848109" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P16298-1", "protein_name": "Serine/threonine-protein phosphatase 2B catalytic subunit beta isoform", "gene_name": "PPP3CB", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P16298", "url": "https://www.uniprot.org/uniprotkb/P16298" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.1848109", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The proline-rich N-terminal sequence of calcineurin Abeta determines substrate binding.", "journal": "Biochemistry", "date": "2009", "authors": "Kilka S, Erdmann F, Migdoll A, Fischer G, Weiwad M", "reference": { "type": "PubMed", "id": "19154138", "url": "https://pubmed.ncbi.nlm.nih.gov/19154138" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P16298-1", "protein_name": "Serine/threonine-protein phosphatase 2B catalytic subunit beta isoform", "gene_name": "PPP3CB", "tax_name": "Human" }, { "uniprot_canonical_ac": "P48454-1", "protein_name": "Serine/threonine-protein phosphatase 2B catalytic subunit gamma isoform", "gene_name": "PPP3CC", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q08209-1", "protein_name": "Protein phosphatase 3 catalytic subunit alpha", "gene_name": "PPP3CA", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P16298", "url": "https://www.uniprot.org/uniprotkb/P16298" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 2, "end_pos": 21, "sequence_org": "AAPEPARAAPPPPPPPPPPP", "sequence_mut": "", "comment": "Increases catalytic efficiency towards NFATC1 and DARPP32 but not towards a peptide substrate. Does not affect cytoplasmic localization and activation by calmodulin.", "evidence": [ { "database": "UniProtKB", "id": "P16298", "url": "https://www.uniprot.org/uniprotkb/P16298" }, { "database": "PubMed", "id": "19154138", "url": "https://pubmed.ncbi.nlm.nih.gov/19154138" } ], "uniprot_canonical_ac": "P16298-1" } ], "record_id": "pubmed.19154138", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Cloning of human calcineurin A: evidence for two isozymes and identification of a polyproline structural domain.", "journal": "Proc. Natl. Acad. Sci. U.S.A.", "date": "1989", "authors": "Guerini D, Klee CB", "reference": { "type": "PubMed", "id": "2556704", "url": "https://pubmed.ncbi.nlm.nih.gov/2556704" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P16298-1", "protein_name": "Serine/threonine-protein phosphatase 2B catalytic subunit beta isoform", "gene_name": "PPP3CB", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P16298", "url": "https://www.uniprot.org/uniprotkb/P16298" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.2556704", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Cooperative autoinhibition and multi-level activation mechanisms of calcineurin.", "journal": "Cell research", "date": "2016", "authors": "Li SJ, Wang J, Ma L, Lu C, Wang J, Wu JW, Wang ZX", "reference": { "type": "PubMed", "id": "26794871", "url": "https://pubmed.ncbi.nlm.nih.gov/26794871" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P16298-1", "protein_name": "Serine/threonine-protein phosphatase 2B catalytic subunit beta isoform", "gene_name": "PPP3CB", "tax_name": "Human" }, { "uniprot_canonical_ac": "P63098-1", "protein_name": "Calcineurin subunit B type 1", "gene_name": "PPP3R1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P63328-1", "protein_name": "Protein phosphatase 3 catalytic subunit alpha", "gene_name": "Ppp3ca", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "Q63810-1", "protein_name": "Calcineurin subunit B type 1", "gene_name": "Ppp3r1", "tax_name": "Mouse" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P16298", "url": "https://www.uniprot.org/uniprotkb/P16298" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 352, "end_pos": 352, "sequence_org": "L", "sequence_mut": "A", "comment": "Severe loss of calmodulin-mediated activation. Probably prevents recognition of substrates.", "evidence": [ { "database": "UniProtKB", "id": "P16298", "url": "https://www.uniprot.org/uniprotkb/P16298" }, { "database": "PubMed", "id": "26794871", "url": "https://pubmed.ncbi.nlm.nih.gov/26794871" } ], "uniprot_canonical_ac": "P16298-1" }, { "start_pos": 353, "end_pos": 353, "sequence_org": "P", "sequence_mut": "A", "comment": "Reduction of basal catalytic activity in absence of calmodulin.", "evidence": [ { "database": "UniProtKB", "id": "P16298", "url": "https://www.uniprot.org/uniprotkb/P16298" }, { "database": "PubMed", "id": "26794871", "url": "https://pubmed.ncbi.nlm.nih.gov/26794871" } ], "uniprot_canonical_ac": "P16298-1" }, { "start_pos": 356, "end_pos": 356, "sequence_org": "M", "sequence_mut": "A", "comment": "Modest increase in catalytic activity in absence of calmodulin.", "evidence": [ { "database": "UniProtKB", "id": "P16298", "url": "https://www.uniprot.org/uniprotkb/P16298" }, { "database": "PubMed", "id": "26794871", "url": "https://pubmed.ncbi.nlm.nih.gov/26794871" } ], "uniprot_canonical_ac": "P16298-1" }, { "start_pos": 357, "end_pos": 524, "sequence_org": "DVFTWSLPFVGEKVTEMLVNVLSICSDDELMTEGEDQFDGSAAARKEIIRNKIRAIGKMARVFSVLREESESVLTLKGLTPTGMLPSGVLAGGRQTLQSATVEAIEAEKAIRGFSPPHRICSFEEAKGLDRINERMPPRKDAVQQDGFNSLNTAHATENHGTGNHTAQ", "sequence_mut": "", "comment": "Loss of catalytic activity. Loss of interaction with PPP3R1/calreticulin B and calmodulin.", "evidence": [ { "database": "UniProtKB", "id": "P16298", "url": "https://www.uniprot.org/uniprotkb/P16298" }, { "database": "PubMed", "id": "26794871", "url": "https://pubmed.ncbi.nlm.nih.gov/26794871" } ], "uniprot_canonical_ac": "P16298-1" }, { "start_pos": 361, "end_pos": 361, "sequence_org": "W", "sequence_mut": "A", "comment": "Severe reduction of basal catalytic activity in absence of calmodulin. Severe loss of calmodulin-mediated activation. Probably prevents recognition of substrates.", "evidence": [ { "database": "UniProtKB", "id": "P16298", "url": "https://www.uniprot.org/uniprotkb/P16298" }, { "database": "PubMed", "id": "26794871", "url": "https://pubmed.ncbi.nlm.nih.gov/26794871" } ], "uniprot_canonical_ac": "P16298-1" }, { "start_pos": 365, "end_pos": 365, "sequence_org": "F", "sequence_mut": "A", "comment": "Moderate loss of calmodulin-mediated activation. Probably prevents recognition of substrates.", "evidence": [ { "database": "UniProtKB", "id": "P16298", "url": "https://www.uniprot.org/uniprotkb/P16298" }, { "database": "PubMed", "id": "26794871", "url": "https://pubmed.ncbi.nlm.nih.gov/26794871" } ], "uniprot_canonical_ac": "P16298-1" }, { "start_pos": 398, "end_pos": 524, "sequence_org": "AAARKEIIRNKIRAIGKMARVFSVLREESESVLTLKGLTPTGMLPSGVLAGGRQTLQSATVEAIEAEKAIRGFSPPHRICSFEEAKGLDRINERMPPRKDAVQQDGFNSLNTAHATENHGTGNHTAQ", "sequence_mut": "", "comment": "Increases catalytic activity independently of calmodulin. Loss of interaction with calmodulin. Does not affect interaction with PPP3R1/calreticulin B.", "evidence": [ { "database": "UniProtKB", "id": "P16298", "url": "https://www.uniprot.org/uniprotkb/P16298" }, { "database": "PubMed", "id": "26794871", "url": "https://pubmed.ncbi.nlm.nih.gov/26794871" } ], "uniprot_canonical_ac": "P16298-1" }, { "start_pos": 415, "end_pos": 524, "sequence_org": "MARVFSVLREESESVLTLKGLTPTGMLPSGVLAGGRQTLQSATVEAIEAEKAIRGFSPPHRICSFEEAKGLDRINERMPPRKDAVQQDGFNSLNTAHATENHGTGNHTAQ", "sequence_mut": "", "comment": "Increases catalytic activity independently of calmodulin. Does not affect interaction with PPP3R1/calreticulin B and calmodulin.", "evidence": [ { "database": "UniProtKB", "id": "P16298", "url": "https://www.uniprot.org/uniprotkb/P16298" }, { "database": "PubMed", "id": "26794871", "url": "https://pubmed.ncbi.nlm.nih.gov/26794871" } ], "uniprot_canonical_ac": "P16298-1" }, { "start_pos": 417, "end_pos": 417, "sequence_org": "R", "sequence_mut": "A", "comment": "Modest increase in catalytic activity in absence of calmodulin. Does not affect interaction with calmodulin.", "evidence": [ { "database": "UniProtKB", "id": "P16298", "url": "https://www.uniprot.org/uniprotkb/P16298" }, { "database": "PubMed", "id": "26794871", "url": "https://pubmed.ncbi.nlm.nih.gov/26794871" } ], "uniprot_canonical_ac": "P16298-1" }, { "start_pos": 418, "end_pos": 418, "sequence_org": "V", "sequence_mut": "A", "comment": "Does not affect catalytic activity in absence of calmodulin. Does not affect interaction with calmodulin.", "evidence": [ { "database": "UniProtKB", "id": "P16298", "url": "https://www.uniprot.org/uniprotkb/P16298" }, { "database": "PubMed", "id": "26794871", "url": "https://pubmed.ncbi.nlm.nih.gov/26794871" } ], "uniprot_canonical_ac": "P16298-1" }, { "start_pos": 419, "end_pos": 419, "sequence_org": "F", "sequence_mut": "A", "comment": "Modest increase in catalytic activity in absence of calmodulin. Does not affect interaction with calmodulin.", "evidence": [ { "database": "UniProtKB", "id": "P16298", "url": "https://www.uniprot.org/uniprotkb/P16298" }, { "database": "PubMed", "id": "26794871", "url": "https://pubmed.ncbi.nlm.nih.gov/26794871" } ], "uniprot_canonical_ac": "P16298-1" }, { "start_pos": 420, "end_pos": 420, "sequence_org": "S", "sequence_mut": "A", "comment": "Does not affect catalytic activity in absence of calmodulin. Does not affect interaction with calmodulin.", "evidence": [ { "database": "UniProtKB", "id": "P16298", "url": "https://www.uniprot.org/uniprotkb/P16298" }, { "database": "PubMed", "id": "26794871", "url": "https://pubmed.ncbi.nlm.nih.gov/26794871" } ], "uniprot_canonical_ac": "P16298-1" }, { "start_pos": 421, "end_pos": 421, "sequence_org": "V", "sequence_mut": "A", "comment": "Modest increase in catalytic activity in absence of calmodulin. Does not affect interaction with calmodulin.", "evidence": [ { "database": "UniProtKB", "id": "P16298", "url": "https://www.uniprot.org/uniprotkb/P16298" }, { "database": "PubMed", "id": "26794871", "url": "https://pubmed.ncbi.nlm.nih.gov/26794871" } ], "uniprot_canonical_ac": "P16298-1" }, { "start_pos": 422, "end_pos": 422, "sequence_org": "L", "sequence_mut": "A", "comment": "Modest increase in catalytic activity in absence of calmodulin. Does not affect interaction with calmodulin.", "evidence": [ { "database": "UniProtKB", "id": "P16298", "url": "https://www.uniprot.org/uniprotkb/P16298" }, { "database": "PubMed", "id": "26794871", "url": "https://pubmed.ncbi.nlm.nih.gov/26794871" } ], "uniprot_canonical_ac": "P16298-1" }, { "start_pos": 423, "end_pos": 423, "sequence_org": "R", "sequence_mut": "A", "comment": "Modest increase in catalytic activity in absence of calmodulin. Does not affect interaction with calmodulin.", "evidence": [ { "database": "UniProtKB", "id": "P16298", "url": "https://www.uniprot.org/uniprotkb/P16298" }, { "database": "PubMed", "id": "26794871", "url": "https://pubmed.ncbi.nlm.nih.gov/26794871" } ], "uniprot_canonical_ac": "P16298-1" }, { "start_pos": 451, "end_pos": 524, "sequence_org": "QTLQSATVEAIEAEKAIRGFSPPHRICSFEEAKGLDRINERMPPRKDAVQQDGFNSLNTAHATENHGTGNHTAQ", "sequence_mut": "", "comment": "Increases basal catalytic activity. Does not affect interaction with PPP3R1/calreticulin B and calmodulin.", "evidence": [ { "database": "UniProtKB", "id": "P16298", "url": "https://www.uniprot.org/uniprotkb/P16298" }, { "database": "PubMed", "id": "26794871", "url": "https://pubmed.ncbi.nlm.nih.gov/26794871" } ], "uniprot_canonical_ac": "P16298-1" }, { "start_pos": 348, "end_pos": 521, "sequence_org": "DVFTWSLPFVGEKVTEMLVNVLNICSDDELGSEEDGFDGATAAARKEVIRNKIRAIGKMARVFSVLREESESVLTLKGLTPTGMLPSGVLSGGKQTLQSATVEAIEADEAIKGFSPQHKITSFEEAKGLDRINERMPPRRDAMPSDANLNSINKALASETNGTDSNGSNSSNIQ", "sequence_mut": "", "comment": "Loss of catalytic activity. Loss of interaction with PPP3R1/calreticulin B and calmodulin.", "evidence": [ { "database": "UniProtKB", "id": "P63328", "url": "https://www.uniprot.org/uniprotkb/P63328" }, { "database": "PubMed", "id": "26794871", "url": "https://pubmed.ncbi.nlm.nih.gov/26794871" } ], "uniprot_canonical_ac": "P63328-1" }, { "start_pos": 389, "end_pos": 521, "sequence_org": "AAARKEVIRNKIRAIGKMARVFSVLREESESVLTLKGLTPTGMLPSGVLSGGKQTLQSATVEAIEADEAIKGFSPQHKITSFEEAKGLDRINERMPPRRDAMPSDANLNSINKALASETNGTDSNGSNSSNIQ", "sequence_mut": "", "comment": "Increases catalytic activity independently of calmodulin. Loss of interaction with calmodulin. Does not affect interaction with PPP3R1/calreticulin B.", "evidence": [ { "database": "UniProtKB", "id": "P63328", "url": "https://www.uniprot.org/uniprotkb/P63328" }, { "database": "PubMed", "id": "26794871", "url": "https://pubmed.ncbi.nlm.nih.gov/26794871" } ], "uniprot_canonical_ac": "P63328-1" }, { "start_pos": 406, "end_pos": 521, "sequence_org": "MARVFSVLREESESVLTLKGLTPTGMLPSGVLSGGKQTLQSATVEAIEADEAIKGFSPQHKITSFEEAKGLDRINERMPPRRDAMPSDANLNSINKALASETNGTDSNGSNSSNIQ", "sequence_mut": "", "comment": "Increases catalytic activity independently of calmodulin. Does not affect interaction with PPP3R1/calreticulin B and calmodulin.", "evidence": [ { "database": "UniProtKB", "id": "P63328", "url": "https://www.uniprot.org/uniprotkb/P63328" }, { "database": "PubMed", "id": "26794871", "url": "https://pubmed.ncbi.nlm.nih.gov/26794871" } ], "uniprot_canonical_ac": "P63328-1" }, { "start_pos": 442, "end_pos": 521, "sequence_org": "QTLQSATVEAIEADEAIKGFSPQHKITSFEEAKGLDRINERMPPRRDAMPSDANLNSINKALASETNGTDSNGSNSSNIQ", "sequence_mut": "", "comment": "Increases basal catalytic activity. Does not affect interaction with PPP3R1/calreticulin B and calmodulin.", "evidence": [ { "database": "UniProtKB", "id": "P63328", "url": "https://www.uniprot.org/uniprotkb/P63328" }, { "database": "PubMed", "id": "26794871", "url": "https://pubmed.ncbi.nlm.nih.gov/26794871" } ], "uniprot_canonical_ac": "P63328-1" } ], "record_id": "pubmed.26794871", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 4 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "PPP3CB overexpression mediates EGFR TKI resistance in lung tumors via calcineurin/MEK/ERK signaling.", "journal": "Life science alliance", "date": "2024-12", "authors": "Gazzeri Sylvie, Zubchuk Nadiia, Montaudon Elodie, Nemati Fariba, Huot-Marchand Sarah, Berardi Giulia, Pucciarelli Amelie, Dib Yassir, Nerini Dylan, Oddou Christiane, Pezet Myl\u00e8ne, David-Boudet Laurence, Ardin Camille, de Fraipont Florence, Maraver Antonio, Girard Nicolas, Decaudin Didier, Toffart Anne-Claire, Eymin Beatrice", "reference": { "type": "PubMed", "id": "39353739", "url": "https://pubmed.ncbi.nlm.nih.gov/39353739" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P16298-1", "protein_name": "Serine/threonine-protein phosphatase 2B catalytic subunit beta isoform", "gene_name": "PPP3CB", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P16298", "url": "https://www.uniprot.org/uniprotkb/P16298" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.39353739", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "p62 functions as a p38 MAP kinase regulator.", "journal": "Biochem. Biophys. Res. Commun.", "date": "2000", "authors": "Sudo T, Maruyama M, Osada H", "reference": { "type": "PubMed", "id": "10708586", "url": "https://pubmed.ncbi.nlm.nih.gov/10708586" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q8IW41-1", "protein_name": "MAP kinase-activated protein kinase 5", "gene_name": "MAPKAPK5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13501-1", "protein_name": "Sequestosome-1", "gene_name": "SQSTM1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q8IW41", "url": "https://www.uniprot.org/uniprotkb/Q8IW41" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.10708586", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Mitogen-activated protein kinase p38 and MK2, MK3 and MK5: menage a trois or menage a quatre?", "journal": "Cell. Signal.", "date": "2010", "authors": "Shiryaev Alexey, Moens Ugo", "reference": { "type": "PubMed", "id": "20227494", "url": "https://pubmed.ncbi.nlm.nih.gov/20227494" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q8IW41-1", "protein_name": "MAP kinase-activated protein kinase 5", "gene_name": "MAPKAPK5", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q8IW41", "url": "https://www.uniprot.org/uniprotkb/Q8IW41" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.20227494", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Comment on `Increased MKK4 abundance with replicative senescence is linked to the joint reduction of multiple microRNAs`.", "journal": "Science signaling", "date": "2010", "authors": "Moens U, Shiryaev A, Dumitriu G", "reference": { "type": "PubMed", "id": "20647589", "url": "https://pubmed.ncbi.nlm.nih.gov/20647589" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q8IW41-1", "protein_name": "MAP kinase-activated protein kinase 5", "gene_name": "MAPKAPK5", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q8IW41", "url": "https://www.uniprot.org/uniprotkb/Q8IW41" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 93, "end_pos": 93, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q8IW41", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q8IW41" }, { "database": "PubMed", "id": "20647589", "url": "https://pubmed.ncbi.nlm.nih.gov/20647589" } ], "site_lbl": "Ser93", "uniprot_canonical_ac": "Q8IW41-1" } ], "record_id": "pubmed.20647589", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Physiological roles of mitogen-activated-protein-kinase-activated p38-regulated/activated protein kinase.", "journal": "World journal of biological chemistry", "date": "2011", "authors": "Kostenko S, Dumitriu G, Laegreid KJ, Moens U", "reference": { "type": "PubMed", "id": "21666810", "url": "https://pubmed.ncbi.nlm.nih.gov/21666810" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q8IW41-1", "protein_name": "MAP kinase-activated protein kinase 5", "gene_name": "MAPKAPK5", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q8IW41", "url": "https://www.uniprot.org/uniprotkb/Q8IW41" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 182, "end_pos": 182, "kinase_uniprot_canonical_ac": "P28482-1", "kinase_gene_name": "MAPK1", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q8IW41", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q8IW41" }, { "database": "PubMed", "id": "9628874", "url": "https://pubmed.ncbi.nlm.nih.gov/9628874" }, { "database": "PubMed", "id": "21666810", "url": "https://pubmed.ncbi.nlm.nih.gov/21666810" } ], "site_lbl": "Thr182", "uniprot_canonical_ac": "Q8IW41-1" } ], "record_id": "pubmed.21666810", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Comparative molecular dynamics simulations of mitogen-activated protein kinase-activated protein kinase 5.", "journal": "International journal of molecular sciences", "date": "2014", "authors": "Lindin I, Wuxiuer Y, Ravna AW, Moens U, Sylte I", "reference": { "type": "PubMed", "id": "24651460", "url": "https://pubmed.ncbi.nlm.nih.gov/24651460" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q8IW41-1", "protein_name": "MAP kinase-activated protein kinase 5", "gene_name": "MAPKAPK5", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q8IW41", "url": "https://www.uniprot.org/uniprotkb/Q8IW41" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 182, "end_pos": 182, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine; by MAPK11, MAPK14, MAPK4, MAPK6 and PKA", "evidence": [ { "database": "UniProtKB", "id": "Q8IW41", "url": "https://www.uniprot.org/uniprotkb/Q8IW41" }, { "database": "PRO", "id": "Q8IW41", "url": "https://proconsortium.org/cgi-bin/entry_pro?id=Q8IW41" }, { "database": "iPTMnet", "id": "Q8IW41", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q8IW41" }, { "database": "PubMed", "id": "24651460", "url": "https://pubmed.ncbi.nlm.nih.gov/24651460" }, { "database": "PubMed", "id": "28252035", "url": "https://pubmed.ncbi.nlm.nih.gov/28252035" }, { "database": "PubMed", "id": "23186163", "url": "https://pubmed.ncbi.nlm.nih.gov/23186163" }, { "database": "PubMed", "id": "9628874", "url": "https://pubmed.ncbi.nlm.nih.gov/9628874" }, { "database": "PubMed", "id": "19690332", "url": "https://pubmed.ncbi.nlm.nih.gov/19690332" } ], "site_lbl": "Thr182", "uniprot_canonical_ac": "Q8IW41-1" }, { "start_pos": 242, "end_pos": 242, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q8IW41", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q8IW41" }, { "database": "PubMed", "id": "24651460", "url": "https://pubmed.ncbi.nlm.nih.gov/24651460" } ], "site_lbl": "Tyr242", "uniprot_canonical_ac": "Q8IW41-1" } ], "record_id": "pubmed.24651460", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Regulation of atypical MAP kinases ERK3 and ERK4 by the phosphatase DUSP2.", "journal": "Scientific reports", "date": "2017", "authors": "Perander M, Al-Mahdi R, Jensen TC, Nunn JA, Kildalsen H, Johansen B, Gabrielsen M, Keyse SM, Seternes OM", "reference": { "type": "PubMed", "id": "28252035", "url": "https://pubmed.ncbi.nlm.nih.gov/28252035" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q8IW41-1", "protein_name": "MAP kinase-activated protein kinase 5", "gene_name": "MAPKAPK5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P31152-1", "protein_name": "Mitogen-activated protein kinase 4", "gene_name": "MAPK4", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q8IW41", "url": "https://www.uniprot.org/uniprotkb/Q8IW41" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 182, "end_pos": 182, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine; by MAPK11, MAPK14, MAPK4, MAPK6 and PKA", "evidence": [ { "database": "UniProtKB", "id": "Q8IW41", "url": "https://www.uniprot.org/uniprotkb/Q8IW41" }, { "database": "PRO", "id": "Q8IW41", "url": "https://proconsortium.org/cgi-bin/entry_pro?id=Q8IW41" }, { "database": "iPTMnet", "id": "Q8IW41", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q8IW41" }, { "database": "PubMed", "id": "24651460", "url": "https://pubmed.ncbi.nlm.nih.gov/24651460" }, { "database": "PubMed", "id": "28252035", "url": "https://pubmed.ncbi.nlm.nih.gov/28252035" }, { "database": "PubMed", "id": "23186163", "url": "https://pubmed.ncbi.nlm.nih.gov/23186163" }, { "database": "PubMed", "id": "9628874", "url": "https://pubmed.ncbi.nlm.nih.gov/9628874" }, { "database": "PubMed", "id": "19690332", "url": "https://pubmed.ncbi.nlm.nih.gov/19690332" } ], "site_lbl": "Thr182", "uniprot_canonical_ac": "Q8IW41-1" }, { "start_pos": 186, "end_pos": 186, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by PAK1, PAK2 and PAK3", "evidence": [ { "database": "UniProtKB", "id": "P31152", "url": "https://www.uniprot.org/uniprotkb/P31152" }, { "database": "iPTMnet", "id": "P31152", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P31152" }, { "database": "PubMed", "id": "18669648", "url": "https://pubmed.ncbi.nlm.nih.gov/18669648" }, { "database": "PRO", "id": "P31152", "url": "https://proconsortium.org/cgi-bin/entry_pro?id=P31152" }, { "database": "PubMed", "id": "18248330", "url": "https://pubmed.ncbi.nlm.nih.gov/18248330" }, { "database": "PubMed", "id": "28252035", "url": "https://pubmed.ncbi.nlm.nih.gov/28252035" }, { "database": "PubMed", "id": "21177870", "url": "https://pubmed.ncbi.nlm.nih.gov/21177870" } ], "site_lbl": "Ser186", "uniprot_canonical_ac": "P31152-1" } ], "record_id": "pubmed.28252035", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Biallelic truncating variants in MAPKAPK5 cause a new developmental disorder involving neurological, cardiac, and facial anomalies combined with synpolydactyly.", "journal": "Genet. Med.", "date": "2021", "authors": "Horn D, Fernandez-Nunez E, Gomez-Carmona R, Rivera-Barahona A, Nevado J, Schwartzmann S, Ehmke N, Lapunzina P, Otaify GA, Temtamy S, Aglan M, Boschann F, Ruiz-Perez VL", "reference": { "type": "PubMed", "id": "33442026", "url": "https://pubmed.ncbi.nlm.nih.gov/33442026" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q8IW41-1", "protein_name": "MAP kinase-activated protein kinase 5", "gene_name": "MAPKAPK5", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q8IW41", "url": "https://www.uniprot.org/uniprotkb/Q8IW41" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.33442026", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "TLK1-mediated MK5-S354 phosphorylation drives prostate cancer cell motility and may signify distinct pathologies.", "journal": "Molecular oncology", "date": "2022", "authors": "Khalil MI, Singh V, King J, De Benedetti A", "reference": { "type": "PubMed", "id": "35064619", "url": "https://pubmed.ncbi.nlm.nih.gov/35064619" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q8IW41-1", "protein_name": "MAP kinase-activated protein kinase 5", "gene_name": "MAPKAPK5", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q8IW41", "url": "https://www.uniprot.org/uniprotkb/Q8IW41" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.35064619", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Expanding the novel MAPKAPK5-related developmental disorder's genotype-phenotype correlation: Patient report and 19 months of follow-up.", "journal": "Clinical genetics", "date": "2022", "authors": "Vecchio D, Cocciadiferro D, Macchiaiolo M, Gonfiantini MV, Agolini E, Matraxia M, Carboni A, Coretti A, Villani A, Panfili FM, Dentici ML, Buonuomo PS, Rana I, Colafati GS, Digilio MC, Novelli A, Bartuli A", "reference": { "type": "PubMed", "id": "35575217", "url": "https://pubmed.ncbi.nlm.nih.gov/35575217" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q8IW41-1", "protein_name": "MAP kinase-activated protein kinase 5", "gene_name": "MAPKAPK5", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q8IW41", "url": "https://www.uniprot.org/uniprotkb/Q8IW41" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.35575217", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The TTYH3/MK5 Positive Feedback Loop regulates Tumor Progression via GSK3-beta/beta-catenin signaling in HCC.", "journal": "International journal of biological sciences", "date": "2022", "authors": "Wang Y, Xie Y, Dong B, Xue W, Chen S, Mitsuo S, Zou H, Feng Y, Ma K, Dong Q, Cao J, Zhu C", "reference": { "type": "PubMed", "id": "35844789", "url": "https://pubmed.ncbi.nlm.nih.gov/35844789" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q8IW41-1", "protein_name": "MAP kinase-activated protein kinase 5", "gene_name": "MAPKAPK5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9C0H2-1", "protein_name": "Protein tweety homolog 3", "gene_name": "TTYH3", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q8IW41", "url": "https://www.uniprot.org/uniprotkb/Q8IW41" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.35844789", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Consolidating the association of biallelic MAPKAPK5 pathogenic variants with a distinct syndromic neurodevelopmental disorder.", "journal": "Journal of medical genetics", "date": "2023-08", "authors": "Maroofian Reza, Efthymiou Stephanie, Suri Mohnish, Rahman Fatima, Zaki Maha S, Maqbool Shazia, Anwa Najwa, Ruiz-P\u00e9rez Victor L, Yanovsky-Dagan Shira, Elpeleg Orly, Sudhakar Sniya, Mankad Kshitij, Harel Tamar, Houlden Henry", "reference": { "type": "PubMed", "id": "36581449", "url": "https://pubmed.ncbi.nlm.nih.gov/36581449" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q8IW41-1", "protein_name": "MAP kinase-activated protein kinase 5", "gene_name": "MAPKAPK5", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q8IW41", "url": "https://www.uniprot.org/uniprotkb/Q8IW41" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.36581449", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Dynamic molecular architecture and substrate recruitment of cullin3-RING E3 ligase CRL3KBTBD2.", "journal": "Nature structural & molecular biology", "date": "2024-02", "authors": "Hu Yuxia, Zhang Zhao, Mao Qiyu, Zhang Xiang, Hao Aihua, Xun Yu, Wang Yeda, Han Lin, Zhan Wuqiang, Liu Qianying, Yin Yue, Peng Chao, Moresco Eva Marie Y, Chen Zhenguo, Beutler Bruce, Sun Lei", "reference": { "type": "PubMed", "id": "38332366", "url": "https://pubmed.ncbi.nlm.nih.gov/38332366" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q8IY47-1", "protein_name": "Kelch repeat and BTB domain-containing protein 2", "gene_name": "KBTBD2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q8IY47", "url": "https://www.uniprot.org/uniprotkb/Q8IY47" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.38332366", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The tumor suppressor RASSF1A and MAP-1 link death receptor signaling to Bax conformational change and cell death.", "journal": "Molecular cell", "date": "2005", "authors": "Baksh S, Tommasi S, Fenton S, Yu VC, Martins LM, Pfeifer GP, Latif F, Downward J, Neel BG", "reference": { "type": "PubMed", "id": "15949439", "url": "https://pubmed.ncbi.nlm.nih.gov/15949439" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q96BY2-1", "protein_name": "Modulator of apoptosis 1", "gene_name": "MOAP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NS23-1", "protein_name": "Ras association domain-containing protein 1", "gene_name": "RASSF1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q96BY2", "url": "https://www.uniprot.org/uniprotkb/Q96BY2" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 161, "end_pos": 166, "sequence_org": "KYKKLR", "sequence_mut": "AYAALA", "comment": "No effect on RASSF1-binding.", "evidence": [ { "database": "UniProtKB", "id": "Q96BY2", "url": "https://www.uniprot.org/uniprotkb/Q96BY2" }, { "database": "PubMed", "id": "15949439", "url": "https://pubmed.ncbi.nlm.nih.gov/15949439" } ], "uniprot_canonical_ac": "Q96BY2-1" }, { "start_pos": 202, "end_pos": 205, "sequence_org": "KRRR", "sequence_mut": "AAAA", "comment": "Loss of RASSF1-binding; interacts with BAX in the absence of RASSF1.", "evidence": [ { "database": "UniProtKB", "id": "Q96BY2", "url": "https://www.uniprot.org/uniprotkb/Q96BY2" }, { "database": "PubMed", "id": "15949439", "url": "https://pubmed.ncbi.nlm.nih.gov/15949439" } ], "uniprot_canonical_ac": "Q96BY2-1" } ], "record_id": "pubmed.15949439", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The RASSF1A tumor suppressor activates Bax via MOAP-1.", "journal": "The Journal of biological chemistry", "date": "2006", "authors": "Vos MD, Dallol A, Eckfeld K, Allen NP, Donninger H, Hesson LB, Calvisi D, Latif F, Clark GJ", "reference": { "type": "PubMed", "id": "16344548", "url": "https://pubmed.ncbi.nlm.nih.gov/16344548" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q96BY2-1", "protein_name": "Modulator of apoptosis 1", "gene_name": "MOAP1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q96BY2", "url": "https://www.uniprot.org/uniprotkb/Q96BY2" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.16344548", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "TRIM39 is a MOAP-1-binding protein that stabilizes MOAP-1 through inhibition of its poly-ubiquitination process.", "journal": "Exp. Cell Res.", "date": "2009", "authors": "Lee SS, Fu NY, Sukumaran SK, Wan KF, Wan Q, Yu VC", "reference": { "type": "PubMed", "id": "19100260", "url": "https://pubmed.ncbi.nlm.nih.gov/19100260" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q96BY2-1", "protein_name": "Modulator of apoptosis 1", "gene_name": "MOAP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HCM9-1", "protein_name": "E3 ubiquitin-protein ligase TRIM39", "gene_name": "TRIM39", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q96BY2", "url": "https://www.uniprot.org/uniprotkb/Q96BY2" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.19100260", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The Trim39 ubiquitin ligase inhibits APC/CCdh1-mediated degradation of the Bax activator MOAP-1.", "journal": "The Journal of cell biology", "date": "2012", "authors": "Huang NJ, Zhang L, Tang W, Chen C, Yang CS, Kornbluth S", "reference": { "type": "PubMed", "id": "22529100", "url": "https://pubmed.ncbi.nlm.nih.gov/22529100" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q96BY2-1", "protein_name": "Modulator of apoptosis 1", "gene_name": "MOAP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HCM9-1", "protein_name": "E3 ubiquitin-protein ligase TRIM39", "gene_name": "TRIM39", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q96BY2", "url": "https://www.uniprot.org/uniprotkb/Q96BY2" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.22529100", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Structural evidence that MOAP1 and PEG10 are derived from retrovirus/retrotransposon Gag proteins.", "journal": "Proteins", "date": "2022", "authors": "Zurowska K, Alam A, Ganser-Pornillos BK, Pornillos O", "reference": { "type": "PubMed", "id": "34357660", "url": "https://pubmed.ncbi.nlm.nih.gov/34357660" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q96BY2-1", "protein_name": "Modulator of apoptosis 1", "gene_name": "MOAP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86TG7-1", "protein_name": "Retrotransposon-derived protein PEG10", "gene_name": "PEG10", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q96BY2", "url": "https://www.uniprot.org/uniprotkb/Q96BY2" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.34357660", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Human Cytomegalovirus miR-UL70-3p Downregulates the H2O2-Induced Apoptosis by Targeting the Modulator of Apoptosis-1 (MOAP1).", "journal": "International journal of molecular sciences", "date": "2021", "authors": "Pandeya A, Khalko RK, Mishra A, Singh N, Singh S, Saha S, Yadav S, Saxena S, Gosipatala SB", "reference": { "type": "PubMed", "id": "35008453", "url": "https://pubmed.ncbi.nlm.nih.gov/35008453" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q96BY2-1", "protein_name": "Modulator of apoptosis 1", "gene_name": "MOAP1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q96BY2", "url": "https://www.uniprot.org/uniprotkb/Q96BY2" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.35008453", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Tripartite motif-containing 68-stabilized modulator of apoptosis-1 retards the proliferation and metastasis of lung cancer.", "journal": "Biochemical and biophysical research communications", "date": "2023-03-12", "authors": "Xu Xiao, Yang Mengting, Liu Xueling, Gong Aihua, Guo Qi, Xu Wenrong, Qian Hui", "reference": { "type": "PubMed", "id": "36724555", "url": "https://pubmed.ncbi.nlm.nih.gov/36724555" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q96BY2-1", "protein_name": "Modulator of apoptosis 1", "gene_name": "MOAP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6AZZ1-1", "protein_name": "E3 ubiquitin-protein ligase TRIM68", "gene_name": "TRIM68", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q96BY2", "url": "https://www.uniprot.org/uniprotkb/Q96BY2" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.36724555", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Cyclosporin A associated helicase-like protein facilitates the association of hepatitis C virus RNA polymerase with its cellular cyclophilin B.", "journal": "PloS one", "date": "2011", "authors": "Morohashi K, Sahara H, Watashi K, Iwabata K, Sunoki T, Kuramochi K, Takakusagi K, Miyashita H, Sato N, Tanabe A, Shimotohno K, Kobayashi S, Sakaguchi K, Sugawara F", "reference": { "type": "PubMed", "id": "21559518", "url": "https://pubmed.ncbi.nlm.nih.gov/21559518" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9H6S0-1", "protein_name": "3'-5' RNA helicase YTHDC2", "gene_name": "YTHDC2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9H6S0", "url": "https://www.uniprot.org/uniprotkb/Q9H6S0" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.21559518", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Regulation of m(6)A Transcripts by the 3'-->5' RNA Helicase YTHDC2 Is Essential for a Successful Meiotic Program in the Mammalian Germline.", "journal": "Molecular cell", "date": "2017", "authors": "Wojtas MN, Pandey RR, Mendel M, Homolka D, Sachidanandam R, Pillai RS", "reference": { "type": "PubMed", "id": "29033321", "url": "https://pubmed.ncbi.nlm.nih.gov/29033321" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9H6S0-1", "protein_name": "3'-5' RNA helicase YTHDC2", "gene_name": "YTHDC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "A2AG06-1", "protein_name": "Meiosis-specific coiled-coil domain-containing protein MEIOC", "gene_name": "Meioc", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "Q8IZH2-1", "protein_name": "5'-3' exoribonuclease 1", "gene_name": "XRN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "B2RR83-1", "protein_name": "3'-5' RNA helicase YTHDC2", "gene_name": "Ythdc2", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "P97789-1", "protein_name": "5'-3' exoribonuclease 1", "gene_name": "Xrn1", "tax_name": "Mouse" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9H6S0", "url": "https://www.uniprot.org/uniprotkb/Q9H6S0" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 1360, "end_pos": 1360, "sequence_org": "W", "sequence_mut": "A", "comment": "Abolished ability to bind N6-methyladenosine (m6A)-containing RNAs.", "evidence": [ { "database": "UniProtKB", "id": "Q9H6S0", "url": "https://www.uniprot.org/uniprotkb/Q9H6S0" }, { "database": "PubMed", "id": "29033321", "url": "https://pubmed.ncbi.nlm.nih.gov/29033321" } ], "uniprot_canonical_ac": "Q9H6S0-1" }, { "start_pos": 317, "end_pos": 317, "sequence_org": "E", "sequence_mut": "A", "comment": "Abolished 3'-5' RNA helicase activity.", "evidence": [ { "database": "UniProtKB", "id": "Q9H6S0", "url": "https://www.uniprot.org/uniprotkb/Q9H6S0" }, { "database": "PubMed", "id": "29033321", "url": "https://pubmed.ncbi.nlm.nih.gov/29033321" } ], "uniprot_canonical_ac": "Q9H6S0-1" } ], "record_id": "pubmed.29033321", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 5 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The m(6)A reader protein YTHDC2 interacts with the small ribosomal subunit and the 5'-3' exoribonuclease XRN1.", "journal": "RNA (New York, N.Y.)", "date": "2018", "authors": "Kretschmer J, Rao H, Hackert P, Sloan KE, Hobartner C, Bohnsack MT", "reference": { "type": "PubMed", "id": "29970596", "url": "https://pubmed.ncbi.nlm.nih.gov/29970596" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9H6S0-1", "protein_name": "3'-5' RNA helicase YTHDC2", "gene_name": "YTHDC2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9H6S0", "url": "https://www.uniprot.org/uniprotkb/Q9H6S0" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.29970596", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Crystal structure of human YTHDC2 YTH domain.", "journal": "Biochem. Biophys. Res. Commun.", "date": "2019", "authors": "Ma C, Liao S, Zhu Z", "reference": { "type": "PubMed", "id": "31472957", "url": "https://pubmed.ncbi.nlm.nih.gov/31472957" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9H6S0-1", "protein_name": "3'-5' RNA helicase YTHDC2", "gene_name": "YTHDC2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9H6S0", "url": "https://www.uniprot.org/uniprotkb/Q9H6S0" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.31472957", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "YTHDC2 Retards Cell Proliferation and Triggers Apoptosis in Papillary Thyroid Cancer by Regulating CYLD-Mediated Inactivation of Akt Signaling.", "journal": "Applied biochemistry and biotechnology", "date": "2024-01", "authors": "Zhou Guangying, Wang Shasha", "reference": { "type": "PubMed", "id": "37162682", "url": "https://pubmed.ncbi.nlm.nih.gov/37162682" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9H6S0-1", "protein_name": "3'-5' RNA helicase YTHDC2", "gene_name": "YTHDC2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9H6S0", "url": "https://www.uniprot.org/uniprotkb/Q9H6S0" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.37162682", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Crosstalk between RNA m6A and DNA methylation regulates transposable element chromatin activation and cell fate in human pluripotent stem cells.", "journal": "Nature genetics", "date": "2023-08", "authors": "Sun Tongyu, Xu Yueyuan, Xiang Yu, Ou Jianhong, Soderblom Erik J, Diao Yarui", "reference": { "type": "PubMed", "id": "37474847", "url": "https://pubmed.ncbi.nlm.nih.gov/37474847" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9H6S0-1", "protein_name": "3'-5' RNA helicase YTHDC2", "gene_name": "YTHDC2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9H6S0", "url": "https://www.uniprot.org/uniprotkb/Q9H6S0" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.37474847", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The m6A Reader YTHDC2 Suppresses Lung Adenocarcinoma Tumorigenesis by Destabilizing MRPL12.", "journal": "Molecular biotechnology", "date": "2024-05", "authors": "Sun Yingchuan, Liu Yanyan, Wang Pengyuan, Chang Lin, Huang Jianmin", "reference": { "type": "PubMed", "id": "38129673", "url": "https://pubmed.ncbi.nlm.nih.gov/38129673" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9H6S0-1", "protein_name": "3'-5' RNA helicase YTHDC2", "gene_name": "YTHDC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P52815-1", "protein_name": "Large ribosomal subunit protein bL12m", "gene_name": "MRPL12", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9H6S0", "url": "https://www.uniprot.org/uniprotkb/Q9H6S0" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.38129673", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The m6A reader YTHDC2 regulates UVB-induced DNA damage repair and histone modification.", "journal": "Photochemistry and photobiology", "date": "2024", "authors": "Yang Zizhao, Verghese Michelle, Yang Seungwon, Shah Palak, He Yu-Ying", "reference": { "type": "PubMed", "id": "38190286", "url": "https://pubmed.ncbi.nlm.nih.gov/38190286" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9H6S0-1", "protein_name": "3'-5' RNA helicase YTHDC2", "gene_name": "YTHDC2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9H6S0", "url": "https://www.uniprot.org/uniprotkb/Q9H6S0" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.38190286", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "A homozygous missense variant in YTHDC2 induces azoospermia in two siblings.", "journal": "Molecular genetics and genomics : MGG", "date": "2024-09-02", "authors": "Tian Shixiong, Faheem Muhammad, Satti Humayoon Shafique, Xiao Jianqiu, Zhang Feng, Khan Tahir Naeem, Liu Chunyu", "reference": { "type": "PubMed", "id": "39223386", "url": "https://pubmed.ncbi.nlm.nih.gov/39223386" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9H6S0-1", "protein_name": "3'-5' RNA helicase YTHDC2", "gene_name": "YTHDC2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9H6S0", "url": "https://www.uniprot.org/uniprotkb/Q9H6S0" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.39223386", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Why reversing the sequence of the alpha domain of human metallothionein-2 does not change its metal-binding and folding characteristics.", "journal": "European journal of biochemistry", "date": "1999", "authors": "Pan PK, Zheng ZF, Lyu PC, Huang PC", "reference": { "type": "PubMed", "id": "10542048", "url": "https://pubmed.ncbi.nlm.nih.gov/10542048" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P80294-1", "protein_name": "Metallothionein-1H", "gene_name": "MT1H", "tax_name": "Human" }, { "uniprot_canonical_ac": "P13640-1", "protein_name": "Metallothionein-1G", "gene_name": "MT1G", "tax_name": "Human" }, { "uniprot_canonical_ac": "P25713-1", "protein_name": "Metallothionein-3", "gene_name": "MT3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N339-1", "protein_name": "Metallothionein-1M", "gene_name": "MT1M", "tax_name": "Human" }, { "uniprot_canonical_ac": "P02795-1", "protein_name": "Metallothionein-2", "gene_name": "MT2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04732-1", "protein_name": "Metallothionein-1E", "gene_name": "MT1E", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04733-1", "protein_name": "Metallothionein-1F", "gene_name": "MT1F", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04731-1", "protein_name": "Metallothionein-1A", "gene_name": "MT1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P47944-1", "protein_name": "Metallothionein-4", "gene_name": "MT4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P80297-1", "protein_name": "Metallothionein-1X", "gene_name": "MT1X", "tax_name": "Human" }, { "uniprot_canonical_ac": "P07438-1", "protein_name": "Metallothionein-1B", "gene_name": "MT1B", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P80294", "url": "https://www.uniprot.org/uniprotkb/P80294" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.10542048", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 11 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Zinc transfer potentials of the alpha - and beta-clusters of metallothionein are affected by domain interactions in the whole molecule.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2000", "authors": "Jiang LJ, Vasak M, Vallee BL, Maret W", "reference": { "type": "PubMed", "id": "10716985", "url": "https://pubmed.ncbi.nlm.nih.gov/10716985" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P80294-1", "protein_name": "Metallothionein-1H", "gene_name": "MT1H", "tax_name": "Human" }, { "uniprot_canonical_ac": "P13640-1", "protein_name": "Metallothionein-1G", "gene_name": "MT1G", "tax_name": "Human" }, { "uniprot_canonical_ac": "P25713-1", "protein_name": "Metallothionein-3", "gene_name": "MT3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N339-1", "protein_name": "Metallothionein-1M", "gene_name": "MT1M", "tax_name": "Human" }, { "uniprot_canonical_ac": "P02795-1", "protein_name": "Metallothionein-2", "gene_name": "MT2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04732-1", "protein_name": "Metallothionein-1E", "gene_name": "MT1E", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04733-1", "protein_name": "Metallothionein-1F", "gene_name": "MT1F", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04731-1", "protein_name": "Metallothionein-1A", "gene_name": "MT1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P47944-1", "protein_name": "Metallothionein-4", "gene_name": "MT4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P80297-1", "protein_name": "Metallothionein-1X", "gene_name": "MT1X", "tax_name": "Human" }, { "uniprot_canonical_ac": "P07438-1", "protein_name": "Metallothionein-1B", "gene_name": "MT1B", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P80294", "url": "https://www.uniprot.org/uniprotkb/P80294" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.10716985", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 11 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Circular dichroism, kinetic and mass spectrometric studies of copper(I) and mercury(II) binding to metallothionein.", "journal": "Journal of inorganic biochemistry", "date": "2000", "authors": "Stillman MJ, Thomas D, Trevithick C, Guo X, Siu M", "reference": { "type": "PubMed", "id": "10830841", "url": "https://pubmed.ncbi.nlm.nih.gov/10830841" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P80294-1", "protein_name": "Metallothionein-1H", "gene_name": "MT1H", "tax_name": "Human" }, { "uniprot_canonical_ac": "P13640-1", "protein_name": "Metallothionein-1G", "gene_name": "MT1G", "tax_name": "Human" }, { "uniprot_canonical_ac": "P25713-1", "protein_name": "Metallothionein-3", "gene_name": "MT3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N339-1", "protein_name": "Metallothionein-1M", "gene_name": "MT1M", "tax_name": "Human" }, { "uniprot_canonical_ac": "P02795-1", "protein_name": "Metallothionein-2", "gene_name": "MT2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04732-1", "protein_name": "Metallothionein-1E", "gene_name": "MT1E", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04733-1", "protein_name": "Metallothionein-1F", "gene_name": "MT1F", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04731-1", "protein_name": "Metallothionein-1A", "gene_name": "MT1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P47944-1", "protein_name": "Metallothionein-4", "gene_name": "MT4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P80297-1", "protein_name": "Metallothionein-1X", "gene_name": "MT1X", "tax_name": "Human" }, { "uniprot_canonical_ac": "P07438-1", "protein_name": "Metallothionein-1B", "gene_name": "MT1B", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P80294", "url": "https://www.uniprot.org/uniprotkb/P80294" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.10830841", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 11 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Brain-specific metallothionein-3 has higher metal-binding capacity than ubiquitous metallothioneins and binds metals noncooperatively.", "journal": "Biochemistry", "date": "2002", "authors": "Palumaa P, Eriste E, Njunkova O, Pokras L, Jornvall H, Sillard R", "reference": { "type": "PubMed", "id": "11994011", "url": "https://pubmed.ncbi.nlm.nih.gov/11994011" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P80294-1", "protein_name": "Metallothionein-1H", "gene_name": "MT1H", "tax_name": "Human" }, { "uniprot_canonical_ac": "P13640-1", "protein_name": "Metallothionein-1G", "gene_name": "MT1G", "tax_name": "Human" }, { "uniprot_canonical_ac": "P25713-1", "protein_name": "Metallothionein-3", "gene_name": "MT3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N339-1", "protein_name": "Metallothionein-1M", "gene_name": "MT1M", "tax_name": "Human" }, { "uniprot_canonical_ac": "P02795-1", "protein_name": "Metallothionein-2", "gene_name": "MT2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04732-1", "protein_name": "Metallothionein-1E", "gene_name": "MT1E", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04733-1", "protein_name": "Metallothionein-1F", "gene_name": "MT1F", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04731-1", "protein_name": "Metallothionein-1A", "gene_name": "MT1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P47944-1", "protein_name": "Metallothionein-4", "gene_name": "MT4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P80297-1", "protein_name": "Metallothionein-1X", "gene_name": "MT1X", "tax_name": "Human" }, { "uniprot_canonical_ac": "P07438-1", "protein_name": "Metallothionein-1B", "gene_name": "MT1B", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P80294", "url": "https://www.uniprot.org/uniprotkb/P80294" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.11994011", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 11 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "A distinct Cu(4)-thiolate cluster of human metallothionein-3 is located in the N-terminal domain.", "journal": "Journal of biological inorganic chemistry : JBIC : a publication of the Society of Biological Inorganic Chemistry", "date": "2002", "authors": "Roschitzki B, Vasak M", "reference": { "type": "PubMed", "id": "12072966", "url": "https://pubmed.ncbi.nlm.nih.gov/12072966" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P80294-1", "protein_name": "Metallothionein-1H", "gene_name": "MT1H", "tax_name": "Human" }, { "uniprot_canonical_ac": "P13640-1", "protein_name": "Metallothionein-1G", "gene_name": "MT1G", "tax_name": "Human" }, { "uniprot_canonical_ac": "P25713-1", "protein_name": "Metallothionein-3", "gene_name": "MT3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N339-1", "protein_name": "Metallothionein-1M", "gene_name": "MT1M", "tax_name": "Human" }, { "uniprot_canonical_ac": "P02795-1", "protein_name": "Metallothionein-2", "gene_name": "MT2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04732-1", "protein_name": "Metallothionein-1E", "gene_name": "MT1E", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04733-1", "protein_name": "Metallothionein-1F", "gene_name": "MT1F", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04731-1", "protein_name": "Metallothionein-1A", "gene_name": "MT1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P47944-1", "protein_name": "Metallothionein-4", "gene_name": "MT4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P80297-1", "protein_name": "Metallothionein-1X", "gene_name": "MT1X", "tax_name": "Human" }, { "uniprot_canonical_ac": "P07438-1", "protein_name": "Metallothionein-1B", "gene_name": "MT1B", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P80294", "url": "https://www.uniprot.org/uniprotkb/P80294" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.12072966", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 11 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] } ]