[ { "title": "Activity of human Delta5 and Delta6 desaturases on multiple n-3 and n-6 polyunsaturated fatty acids.", "journal": "FEBS letters", "date": "2001-11-30", "authors": "de Antueno R J, Knickle L C, Smith H, Elliot M L, Allen S J, Nwaka S, Winther M D", "reference": { "type": "PubMed", "id": "11734209", "url": "https://pubmed.ncbi.nlm.nih.gov/11734209" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9NXB9-1", "protein_name": "Very long chain fatty acid elongase 2", "gene_name": "ELOVL2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9NXB9", "url": "https://www.uniprot.org/uniprotkb/Q9NXB9" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.11734209", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Identification of the peroxisomal beta-oxidation enzymes involved in the biosynthesis of docosahexaenoic acid.", "journal": "Journal of lipid research", "date": "2001", "authors": "Ferdinandusse S, Denis S, Mooijer PA, Zhang Z, Reddy JK, Spector AA, Wanders RJ", "reference": { "type": "PubMed", "id": "11734571", "url": "https://pubmed.ncbi.nlm.nih.gov/11734571" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9NXB9-1", "protein_name": "Very long chain fatty acid elongase 2", "gene_name": "ELOVL2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NYP7-1", "protein_name": "Very long chain fatty acid elongase 5", "gene_name": "ELOVL5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P22307-1", "protein_name": "Sterol carrier protein 2", "gene_name": "SCP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95864-1", "protein_name": "Acyl-CoA 6-desaturase", "gene_name": "FADS2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P33121-1", "protein_name": "Long-chain-fatty-acid--CoA ligase 1", "gene_name": "ACSL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15067-1", "protein_name": "Peroxisomal acyl-coenzyme A oxidase 1", "gene_name": "ACOX1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51659-1", "protein_name": "Peroxisomal multifunctional enzyme type 2", "gene_name": "HSD17B4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BW60-1", "protein_name": "Very long chain fatty acid elongase 1", "gene_name": "ELOVL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HB03-1", "protein_name": "Very long chain fatty acid elongase 3", "gene_name": "ELOVL3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P09110-1", "protein_name": "3-ketoacyl-CoA thiolase, peroxisomal", "gene_name": "ACAA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60427-1", "protein_name": "Acyl-CoA (8-3)-desaturase", "gene_name": "FADS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14734-1", "protein_name": "Acyl-coenzyme A thioesterase 8", "gene_name": "ACOT8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P33897-1", "protein_name": "ATP-binding cassette sub-family D member 1", "gene_name": "ABCD1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9NXB9", "url": "https://www.uniprot.org/uniprotkb/Q9NXB9" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.11734571", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 13 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The same rat Delta6-desaturase not only acts on 18- but also on 24-carbon fatty acids in very-long-chain polyunsaturated fatty acid biosynthesis.", "journal": "The Biochemical journal", "date": "2002", "authors": "D'andrea S, Guillou H, Jan S, Catheline D, Thibault JN, Bouriel M, Rioux V, Legrand P", "reference": { "type": "PubMed", "id": "11988075", "url": "https://pubmed.ncbi.nlm.nih.gov/11988075" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9NXB9-1", "protein_name": "Very long chain fatty acid elongase 2", "gene_name": "ELOVL2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NYP7-1", "protein_name": "Very long chain fatty acid elongase 5", "gene_name": "ELOVL5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P22307-1", "protein_name": "Sterol carrier protein 2", "gene_name": "SCP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Z122-1", "protein_name": "Acyl-CoA 6-desaturase", "gene_name": "Fads2", "tax_name": "Rat" }, { "uniprot_canonical_ac": "O95864-1", "protein_name": "Acyl-CoA 6-desaturase", "gene_name": "FADS2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P33121-1", "protein_name": "Long-chain-fatty-acid--CoA ligase 1", "gene_name": "ACSL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51659-1", "protein_name": "Peroxisomal multifunctional enzyme type 2", "gene_name": "HSD17B4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BW60-1", "protein_name": "Very long chain fatty acid elongase 1", "gene_name": "ELOVL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HB03-1", "protein_name": "Very long chain fatty acid elongase 3", "gene_name": "ELOVL3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P09110-1", "protein_name": "3-ketoacyl-CoA thiolase, peroxisomal", "gene_name": "ACAA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60427-1", "protein_name": "Acyl-CoA (8-3)-desaturase", "gene_name": "FADS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14734-1", "protein_name": "Acyl-coenzyme A thioesterase 8", "gene_name": "ACOT8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P33897-1", "protein_name": "ATP-binding cassette sub-family D member 1", "gene_name": "ABCD1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9NXB9", "url": "https://www.uniprot.org/uniprotkb/Q9NXB9" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.11988075", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 13 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Eicosapentaenoic and docosapentaenoic acids are the principal products of alpha-linolenic acid metabolism in young men*.", "journal": "The British journal of nutrition", "date": "2002", "authors": "Burdge GC, Jones AE, Wootton SA", "reference": { "type": "PubMed", "id": "12323085", "url": "https://pubmed.ncbi.nlm.nih.gov/12323085" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9NXB9-1", "protein_name": "Very long chain fatty acid elongase 2", "gene_name": "ELOVL2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NYP7-1", "protein_name": "Very long chain fatty acid elongase 5", "gene_name": "ELOVL5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P22307-1", "protein_name": "Sterol carrier protein 2", "gene_name": "SCP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95864-1", "protein_name": "Acyl-CoA 6-desaturase", "gene_name": "FADS2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P33121-1", "protein_name": "Long-chain-fatty-acid--CoA ligase 1", "gene_name": "ACSL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51659-1", "protein_name": "Peroxisomal multifunctional enzyme type 2", "gene_name": "HSD17B4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BW60-1", "protein_name": "Very long chain fatty acid elongase 1", "gene_name": "ELOVL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HB03-1", "protein_name": "Very long chain fatty acid elongase 3", "gene_name": "ELOVL3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P09110-1", "protein_name": "3-ketoacyl-CoA thiolase, peroxisomal", "gene_name": "ACAA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60427-1", "protein_name": "Acyl-CoA (8-3)-desaturase", "gene_name": "FADS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14734-1", "protein_name": "Acyl-coenzyme A thioesterase 8", "gene_name": "ACOT8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P33897-1", "protein_name": "ATP-binding cassette sub-family D member 1", "gene_name": "ABCD1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9NXB9", "url": "https://www.uniprot.org/uniprotkb/Q9NXB9" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.12323085", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 12 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Conversion of alpha-linolenic acid to eicosapentaenoic, docosapentaenoic and docosahexaenoic acids in young women.", "journal": "The British journal of nutrition", "date": "2002", "authors": "Burdge GC, Wootton SA", "reference": { "type": "PubMed", "id": "12323090", "url": "https://pubmed.ncbi.nlm.nih.gov/12323090" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9NXB9-1", "protein_name": "Very long chain fatty acid elongase 2", "gene_name": "ELOVL2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NYP7-1", "protein_name": "Very long chain fatty acid elongase 5", "gene_name": "ELOVL5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P22307-1", "protein_name": "Sterol carrier protein 2", "gene_name": "SCP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95864-1", "protein_name": "Acyl-CoA 6-desaturase", "gene_name": "FADS2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P33121-1", "protein_name": "Long-chain-fatty-acid--CoA ligase 1", "gene_name": "ACSL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51659-1", "protein_name": "Peroxisomal multifunctional enzyme type 2", "gene_name": "HSD17B4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BW60-1", "protein_name": "Very long chain fatty acid elongase 1", "gene_name": "ELOVL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HB03-1", "protein_name": "Very long chain fatty acid elongase 3", "gene_name": "ELOVL3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P09110-1", "protein_name": "3-ketoacyl-CoA thiolase, peroxisomal", "gene_name": "ACAA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60427-1", "protein_name": "Acyl-CoA (8-3)-desaturase", "gene_name": "FADS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14734-1", "protein_name": "Acyl-coenzyme A thioesterase 8", "gene_name": "ACOT8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P33897-1", "protein_name": "ATP-binding cassette sub-family D member 1", "gene_name": "ABCD1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9NXB9", "url": "https://www.uniprot.org/uniprotkb/Q9NXB9" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.12323090", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 12 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Regulation of human delta-6 desaturase gene transcription: identification of a functional direct repeat-1 element.", "journal": "Journal of lipid research", "date": "2003", "authors": "Tang C, Cho HP, Nakamura MT, Clarke SD", "reference": { "type": "PubMed", "id": "12562861", "url": "https://pubmed.ncbi.nlm.nih.gov/12562861" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9NXB9-1", "protein_name": "Very long chain fatty acid elongase 2", "gene_name": "ELOVL2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NYP7-1", "protein_name": "Very long chain fatty acid elongase 5", "gene_name": "ELOVL5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P22307-1", "protein_name": "Sterol carrier protein 2", "gene_name": "SCP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Z122-1", "protein_name": "Acyl-CoA 6-desaturase", "gene_name": "Fads2", "tax_name": "Rat" }, { "uniprot_canonical_ac": "O95864-1", "protein_name": "Acyl-CoA 6-desaturase", "gene_name": "FADS2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P33121-1", "protein_name": "Long-chain-fatty-acid--CoA ligase 1", "gene_name": "ACSL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51659-1", "protein_name": "Peroxisomal multifunctional enzyme type 2", "gene_name": "HSD17B4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BW60-1", "protein_name": "Very long chain fatty acid elongase 1", "gene_name": "ELOVL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HB03-1", "protein_name": "Very long chain fatty acid elongase 3", "gene_name": "ELOVL3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P09110-1", "protein_name": "3-ketoacyl-CoA thiolase, peroxisomal", "gene_name": "ACAA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60427-1", "protein_name": "Acyl-CoA (8-3)-desaturase", "gene_name": "FADS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14734-1", "protein_name": "Acyl-coenzyme A thioesterase 8", "gene_name": "ACOT8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P33897-1", "protein_name": "ATP-binding cassette sub-family D member 1", "gene_name": "ABCD1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9NXB9", "url": "https://www.uniprot.org/uniprotkb/Q9NXB9" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.12562861", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 13 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Identification of the delta-6 desaturase of human sebaceous glands: expression and enzyme activity.", "journal": "The Journal of investigative dermatology", "date": "2003", "authors": "Ge L, Gordon JS, Hsuan C, Stenn K, Prouty SM", "reference": { "type": "PubMed", "id": "12713571", "url": "https://pubmed.ncbi.nlm.nih.gov/12713571" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9NXB9-1", "protein_name": "Very long chain fatty acid elongase 2", "gene_name": "ELOVL2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NYP7-1", "protein_name": "Very long chain fatty acid elongase 5", "gene_name": "ELOVL5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P22307-1", "protein_name": "Sterol carrier protein 2", "gene_name": "SCP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95864-1", "protein_name": "Acyl-CoA 6-desaturase", "gene_name": "FADS2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P33121-1", "protein_name": "Long-chain-fatty-acid--CoA ligase 1", "gene_name": "ACSL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51659-1", "protein_name": "Peroxisomal multifunctional enzyme type 2", "gene_name": "HSD17B4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BW60-1", "protein_name": "Very long chain fatty acid elongase 1", "gene_name": "ELOVL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HB03-1", "protein_name": "Very long chain fatty acid elongase 3", "gene_name": "ELOVL3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P09110-1", "protein_name": "3-ketoacyl-CoA thiolase, peroxisomal", "gene_name": "ACAA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60427-1", "protein_name": "Acyl-CoA (8-3)-desaturase", "gene_name": "FADS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14734-1", "protein_name": "Acyl-coenzyme A thioesterase 8", "gene_name": "ACOT8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P33897-1", "protein_name": "ATP-binding cassette sub-family D member 1", "gene_name": "ABCD1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9NXB9", "url": "https://www.uniprot.org/uniprotkb/Q9NXB9" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.12713571", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 12 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Metabolism of stearidonic acid in human subjects: comparison with the metabolism of other n-3 fatty acids.", "journal": "The American journal of clinical nutrition", "date": "2003", "authors": "James MJ, Ursin VM, Cleland LG", "reference": { "type": "PubMed", "id": "12716664", "url": "https://pubmed.ncbi.nlm.nih.gov/12716664" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9NXB9-1", "protein_name": "Very long chain fatty acid elongase 2", "gene_name": "ELOVL2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NYP7-1", "protein_name": "Very long chain fatty acid elongase 5", "gene_name": "ELOVL5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P22307-1", "protein_name": "Sterol carrier protein 2", "gene_name": "SCP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95864-1", "protein_name": "Acyl-CoA 6-desaturase", "gene_name": "FADS2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P33121-1", "protein_name": "Long-chain-fatty-acid--CoA ligase 1", "gene_name": "ACSL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51659-1", "protein_name": "Peroxisomal multifunctional enzyme type 2", "gene_name": "HSD17B4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BW60-1", "protein_name": "Very long chain fatty acid elongase 1", "gene_name": "ELOVL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HB03-1", "protein_name": "Very long chain fatty acid elongase 3", "gene_name": "ELOVL3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P09110-1", "protein_name": "3-ketoacyl-CoA thiolase, peroxisomal", "gene_name": "ACAA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60427-1", "protein_name": "Acyl-CoA (8-3)-desaturase", "gene_name": "FADS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14734-1", "protein_name": "Acyl-coenzyme A thioesterase 8", "gene_name": "ACOT8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P33897-1", "protein_name": "ATP-binding cassette sub-family D member 1", "gene_name": "ABCD1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9NXB9", "url": "https://www.uniprot.org/uniprotkb/Q9NXB9" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.12716664", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 12 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Studies on the metabolic fate of n-3 polyunsaturated fatty acids.", "journal": "Journal of lipid research", "date": "2003", "authors": "Ferdinandusse S, Denis S, Dacremont G, Wanders RJ", "reference": { "type": "PubMed", "id": "12897190", "url": "https://pubmed.ncbi.nlm.nih.gov/12897190" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9NXB9-1", "protein_name": "Very long chain fatty acid elongase 2", "gene_name": "ELOVL2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NYP7-1", "protein_name": "Very long chain fatty acid elongase 5", "gene_name": "ELOVL5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P22307-1", "protein_name": "Sterol carrier protein 2", "gene_name": "SCP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95864-1", "protein_name": "Acyl-CoA 6-desaturase", "gene_name": "FADS2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P33121-1", "protein_name": "Long-chain-fatty-acid--CoA ligase 1", "gene_name": "ACSL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51659-1", "protein_name": "Peroxisomal multifunctional enzyme type 2", "gene_name": "HSD17B4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BW60-1", "protein_name": "Very long chain fatty acid elongase 1", "gene_name": "ELOVL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HB03-1", "protein_name": "Very long chain fatty acid elongase 3", "gene_name": "ELOVL3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P09110-1", "protein_name": "3-ketoacyl-CoA thiolase, peroxisomal", "gene_name": "ACAA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60427-1", "protein_name": "Acyl-CoA (8-3)-desaturase", "gene_name": "FADS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14734-1", "protein_name": "Acyl-coenzyme A thioesterase 8", "gene_name": "ACOT8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P33897-1", "protein_name": "ATP-binding cassette sub-family D member 1", "gene_name": "ABCD1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9NXB9", "url": "https://www.uniprot.org/uniprotkb/Q9NXB9" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.12897190", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 12 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Comparison of the conversion rates of alpha-linolenic acid (18:3(n - 3)) and stearidonic acid (18:4(n - 3)) to longer polyunsaturated fatty acids in rats.", "journal": "Biochimica et biophysica acta", "date": "1992", "authors": "Yamazaki K, Fujikawa M, Hamazaki T, Yano S, Shono T", "reference": { "type": "PubMed", "id": "1346092", "url": "https://pubmed.ncbi.nlm.nih.gov/1346092" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9NXB9-1", "protein_name": "Very long chain fatty acid elongase 2", "gene_name": "ELOVL2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NYP7-1", "protein_name": "Very long chain fatty acid elongase 5", "gene_name": "ELOVL5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P22307-1", "protein_name": "Sterol carrier protein 2", "gene_name": "SCP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95864-1", "protein_name": "Acyl-CoA 6-desaturase", "gene_name": "FADS2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P33121-1", "protein_name": "Long-chain-fatty-acid--CoA ligase 1", "gene_name": "ACSL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51659-1", "protein_name": "Peroxisomal multifunctional enzyme type 2", "gene_name": "HSD17B4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BW60-1", "protein_name": "Very long chain fatty acid elongase 1", "gene_name": "ELOVL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HB03-1", "protein_name": "Very long chain fatty acid elongase 3", "gene_name": "ELOVL3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P09110-1", "protein_name": "3-ketoacyl-CoA thiolase, peroxisomal", "gene_name": "ACAA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60427-1", "protein_name": "Acyl-CoA (8-3)-desaturase", "gene_name": "FADS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14734-1", "protein_name": "Acyl-coenzyme A thioesterase 8", "gene_name": "ACOT8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P33897-1", "protein_name": "ATP-binding cassette sub-family D member 1", "gene_name": "ABCD1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9NXB9", "url": "https://www.uniprot.org/uniprotkb/Q9NXB9" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.1346092", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 12 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Elongation of long-chain fatty acids.", "journal": "Progress in lipid research", "date": "2004", "authors": "Leonard AE, Pereira SL, Sprecher H, Huang YS", "reference": { "type": "PubMed", "id": "14636670", "url": "https://pubmed.ncbi.nlm.nih.gov/14636670" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9NXB9-1", "protein_name": "Very long chain fatty acid elongase 2", "gene_name": "ELOVL2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NYP7-1", "protein_name": "Very long chain fatty acid elongase 5", "gene_name": "ELOVL5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P22307-1", "protein_name": "Sterol carrier protein 2", "gene_name": "SCP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95864-1", "protein_name": "Acyl-CoA 6-desaturase", "gene_name": "FADS2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P33121-1", "protein_name": "Long-chain-fatty-acid--CoA ligase 1", "gene_name": "ACSL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51659-1", "protein_name": "Peroxisomal multifunctional enzyme type 2", "gene_name": "HSD17B4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BW60-1", "protein_name": "Very long chain fatty acid elongase 1", "gene_name": "ELOVL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HB03-1", "protein_name": "Very long chain fatty acid elongase 3", "gene_name": "ELOVL3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P09110-1", "protein_name": "3-ketoacyl-CoA thiolase, peroxisomal", "gene_name": "ACAA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60427-1", "protein_name": "Acyl-CoA (8-3)-desaturase", "gene_name": "FADS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14734-1", "protein_name": "Acyl-coenzyme A thioesterase 8", "gene_name": "ACOT8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P33897-1", "protein_name": "ATP-binding cassette sub-family D member 1", "gene_name": "ABCD1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9NXB9", "url": "https://www.uniprot.org/uniprotkb/Q9NXB9" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.14636670", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 12 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The metabolism of 7,10,13,16,19-docosapentaenoic acid to 4,7,10,13,16,19-docosahexaenoic acid in rat liver is independent of a 4-desaturase.", "journal": "The Journal of biological chemistry", "date": "1991", "authors": "Voss A, Reinhart M, Sankarappa S, Sprecher H", "reference": { "type": "PubMed", "id": "1834642", "url": "https://pubmed.ncbi.nlm.nih.gov/1834642" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9NXB9-1", "protein_name": "Very long chain fatty acid elongase 2", "gene_name": "ELOVL2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NYP7-1", "protein_name": "Very long chain fatty acid elongase 5", "gene_name": "ELOVL5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P22307-1", "protein_name": "Sterol carrier protein 2", "gene_name": "SCP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95864-1", "protein_name": "Acyl-CoA 6-desaturase", "gene_name": "FADS2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P33121-1", "protein_name": "Long-chain-fatty-acid--CoA ligase 1", "gene_name": "ACSL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51659-1", "protein_name": "Peroxisomal multifunctional enzyme type 2", "gene_name": "HSD17B4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BW60-1", "protein_name": "Very long chain fatty acid elongase 1", "gene_name": "ELOVL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HB03-1", "protein_name": "Very long chain fatty acid elongase 3", "gene_name": "ELOVL3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P09110-1", "protein_name": "3-ketoacyl-CoA thiolase, peroxisomal", "gene_name": "ACAA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60427-1", "protein_name": "Acyl-CoA (8-3)-desaturase", "gene_name": "FADS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14734-1", "protein_name": "Acyl-coenzyme A thioesterase 8", "gene_name": "ACOT8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P33897-1", "protein_name": "ATP-binding cassette sub-family D member 1", "gene_name": "ABCD1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9NXB9", "url": "https://www.uniprot.org/uniprotkb/Q9NXB9" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.1834642", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 12 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Novel functions of acyl-CoA thioesterases and acyltransferases as auxiliary enzymes in peroxisomal lipid metabolism.", "journal": "Progress in lipid research", "date": "2008", "authors": "Hunt MC, Alexson SE", "reference": { "type": "PubMed", "id": "18538142", "url": "https://pubmed.ncbi.nlm.nih.gov/18538142" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9NXB9-1", "protein_name": "Very long chain fatty acid elongase 2", "gene_name": "ELOVL2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NYP7-1", "protein_name": "Very long chain fatty acid elongase 5", "gene_name": "ELOVL5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P22307-1", "protein_name": "Sterol carrier protein 2", "gene_name": "SCP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95864-1", "protein_name": "Acyl-CoA 6-desaturase", "gene_name": "FADS2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P33121-1", "protein_name": "Long-chain-fatty-acid--CoA ligase 1", "gene_name": "ACSL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51659-1", "protein_name": "Peroxisomal multifunctional enzyme type 2", "gene_name": "HSD17B4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BW60-1", "protein_name": "Very long chain fatty acid elongase 1", "gene_name": "ELOVL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HB03-1", "protein_name": "Very long chain fatty acid elongase 3", "gene_name": "ELOVL3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P09110-1", "protein_name": "3-ketoacyl-CoA thiolase, peroxisomal", "gene_name": "ACAA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60427-1", "protein_name": "Acyl-CoA (8-3)-desaturase", "gene_name": "FADS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14734-1", "protein_name": "Acyl-coenzyme A thioesterase 8", "gene_name": "ACOT8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P33897-1", "protein_name": "ATP-binding cassette sub-family D member 1", "gene_name": "ABCD1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9NXB9", "url": "https://www.uniprot.org/uniprotkb/Q9NXB9" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.18538142", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 12 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Dietary stearidonic acid is a long chain (n-3) polyunsaturated fatty acid with potential health benefits.", "journal": "The Journal of nutrition", "date": "2009", "authors": "Whelan J", "reference": { "type": "PubMed", "id": "19056654", "url": "https://pubmed.ncbi.nlm.nih.gov/19056654" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9NXB9-1", "protein_name": "Very long chain fatty acid elongase 2", "gene_name": "ELOVL2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NYP7-1", "protein_name": "Very long chain fatty acid elongase 5", "gene_name": "ELOVL5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P22307-1", "protein_name": "Sterol carrier protein 2", "gene_name": "SCP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95864-1", "protein_name": "Acyl-CoA 6-desaturase", "gene_name": "FADS2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P33121-1", "protein_name": "Long-chain-fatty-acid--CoA ligase 1", "gene_name": "ACSL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51659-1", "protein_name": "Peroxisomal multifunctional enzyme type 2", "gene_name": "HSD17B4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BW60-1", "protein_name": "Very long chain fatty acid elongase 1", "gene_name": "ELOVL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HB03-1", "protein_name": "Very long chain fatty acid elongase 3", "gene_name": "ELOVL3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P09110-1", "protein_name": "3-ketoacyl-CoA thiolase, peroxisomal", "gene_name": "ACAA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60427-1", "protein_name": "Acyl-CoA (8-3)-desaturase", "gene_name": "FADS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14734-1", "protein_name": "Acyl-coenzyme A thioesterase 8", "gene_name": "ACOT8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P33897-1", "protein_name": "ATP-binding cassette sub-family D member 1", "gene_name": "ABCD1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9NXB9", "url": "https://www.uniprot.org/uniprotkb/Q9NXB9" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.19056654", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 12 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Antibody Binding Epitope Mapping (AbMap) of Hundred Antibodies in a Single Run.", "journal": "Molecular & cellular proteomics : MCP", "date": "2021", "authors": "Qi Huan, Ma Mingliang, Hu Chuansheng, Xu Zhao-Wei, Wu Fan-Lin, Wang Nan, Lai Dan-Yun, Li Yang, Zhang Hainan, Jiang He-Wei, Meng Qing-Feng, Guo Shujuan, Kang Yani, Zhao Xiaodong, Li Hua, Tao Sheng-Ce", "reference": { "type": "PubMed", "id": "33109704", "url": "https://pubmed.ncbi.nlm.nih.gov/33109704" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9NXB9-1", "protein_name": "Very long chain fatty acid elongase 2", "gene_name": "ELOVL2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15858-1", "protein_name": "Sodium channel protein type 9 subunit alpha", "gene_name": "SCN9A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99442-1", "protein_name": "Translocation protein SEC62", "gene_name": "SEC62", "tax_name": "Human" }, { "uniprot_canonical_ac": "P24298-1", "protein_name": "Alanine aminotransferase 1", "gene_name": "GPT", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35869-1", "protein_name": "Aryl hydrocarbon receptor", "gene_name": "AHR", "tax_name": "Human" }, { "uniprot_canonical_ac": "A6N7Y9-1", "protein_name": "Piwi-like protein 1", "gene_name": "PIWIL1", "tax_name": "Chicken" }, { "uniprot_canonical_ac": "P63137-1", "protein_name": "Gamma-aminobutyric acid receptor subunit beta-2", "gene_name": "Gabrb2", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "Q75UR0-1", "protein_name": "Anoctamin-5", "gene_name": "Ano5", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "Q80ZA5-1", "protein_name": "Sodium-driven chloride bicarbonate exchanger", "gene_name": "Slc4a10", "tax_name": "Rat" }, { "uniprot_canonical_ac": "P11596-1", "protein_name": "Female-specific protein transformer", "gene_name": "tra", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q26263-1", "protein_name": "Protein deadpan", "gene_name": "dpn", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q80VP2-1", "protein_name": "Spermatogenesis-associated protein 7 homolog", "gene_name": "Spata7", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "Q8K1S4-1", "protein_name": "Netrin receptor UNC5A", "gene_name": "Unc5a", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "F1QDF8-1", "protein_name": "Forkhead box protein J1-A", "gene_name": "foxj1a", "tax_name": "Zebrafish" }, { "uniprot_canonical_ac": "Q5U5Q3-1", "protein_name": "RNA-binding E3 ubiquitin-protein ligase MEX3C", "gene_name": "MEX3C", "tax_name": "Human" }, { "uniprot_canonical_ac": "P43116-1", "protein_name": "Prostaglandin E2 receptor EP2 subtype", "gene_name": "PTGER2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8C3X4-1", "protein_name": "Translation factor Guf1, mitochondrial", "gene_name": "Guf1", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "P53350-1", "protein_name": "Serine/threonine-protein kinase PLK1", "gene_name": "PLK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13123-1", "protein_name": "Protein Red", "gene_name": "IK", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NZQ7-1", "protein_name": "Programmed cell death 1 ligand 1", "gene_name": "CD274", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60832-1", "protein_name": "H/ACA ribonucleoprotein complex subunit DKC1", "gene_name": "DKC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13438-1", "protein_name": "Protein OS-9", "gene_name": "OS9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UNA0-1", "protein_name": "A disintegrin and metalloproteinase with thrombospondin motifs 5", "gene_name": "ADAMTS5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06753-1", "protein_name": "Tropomyosin alpha-3 chain", "gene_name": "TPM3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q06787-1", "protein_name": "Fragile X messenger ribonucleoprotein 1", "gene_name": "FMR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6B0I6-1", "protein_name": "Lysine-specific demethylase 4D", "gene_name": "KDM4D", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q02535-1", "protein_name": "DNA-binding protein inhibitor ID-3", "gene_name": "ID3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86YT6-1", "protein_name": "E3 ubiquitin-protein ligase MIB1", "gene_name": "MIB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6P2I7-1", "protein_name": "Endogenous Bornavirus-like nucleoprotein 2", "gene_name": "EBLN2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q62936-1", "protein_name": "Disks large homolog 3", "gene_name": "Dlg3", "tax_name": "Rat" }, { "uniprot_canonical_ac": "P32851-1", "protein_name": "Syntaxin-1A", "gene_name": "Stx1a", "tax_name": "Rat" }, { "uniprot_canonical_ac": "O80742-1", "protein_name": "U-box domain-containing protein 19", "gene_name": "PUB19", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q3U487-1", "protein_name": "E3 ubiquitin-protein ligase HECTD3", "gene_name": "Hectd3", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "P51448-1", "protein_name": "Nuclear receptor ROR-alpha", "gene_name": "Rora", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "P40645-1", "protein_name": "Transcription factor SOX-6", "gene_name": "Sox6", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "Q9VKJ5-1", "protein_name": "Dynein axonemal assembly factor 4", "gene_name": "Dnaaf4", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q6P9S1-1", "protein_name": "ATM interactor", "gene_name": "Atmin", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "P16882-1", "protein_name": "Growth hormone receptor", "gene_name": "Ghr", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "Q96AQ7-1", "protein_name": "Lipid transferase CIDEC", "gene_name": "CIDEC", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q969P5-1", "protein_name": "F-box only protein 32", "gene_name": "FBXO32", "tax_name": "Human" }, { "uniprot_canonical_ac": "P52758-1", "protein_name": "2-iminobutanoate/2-iminopropanoate deaminase", "gene_name": "RIDA", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43490-1", "protein_name": "Prominin-1", "gene_name": "PROM1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P97460-1", "protein_name": "Neuronal PAS domain-containing protein 2", "gene_name": "Npas2", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "Q9WTS5-1", "protein_name": "Teneurin-2", "gene_name": "Tenm2", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "Q14644-1", "protein_name": "Ras GTPase-activating protein 3", "gene_name": "RASA3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG47-1", "protein_name": "Polyubiquitin-B", "gene_name": "UBB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96SD1-1", "protein_name": "Protein artemis", "gene_name": "DCLRE1C", "tax_name": "Human" }, { "uniprot_canonical_ac": "P08476-1", "protein_name": "Inhibin beta A chain", "gene_name": "INHBA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q7TT00-1", "protein_name": "Transcription factor SPT20 homolog", "gene_name": "Supt20h; Supt20", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "Q67E05-1", "protein_name": "Bactericidal permeability-increasing protein", "gene_name": "Bpi", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "Q05915-1", "protein_name": "GTP cyclohydrolase 1", "gene_name": "Gch1", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "Q8VC33-1", "protein_name": "Nucleoredoxin-like protein 1", "gene_name": "Nxnl1", "tax_name": "Mouse" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9NXB9", "url": "https://www.uniprot.org/uniprotkb/Q9NXB9" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.33109704", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 52 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "ELOVL2 promotes cancer progression by inhibiting cell apoptosis in renal cell carcinoma.", "journal": "Oncology reports", "date": "2022", "authors": "Tanaka K, Kandori S, Sakka S, Nitta S, Tanuma K, Shiga M, Nagumo Y, Negoro H, Kojima T, Mathis BJ, Shimazui T, Watanabe M, Sato TA, Miyamoto T, Matsuzaka T, Shimano H, Nishiyama H", "reference": { "type": "PubMed", "id": "34841437", "url": "https://pubmed.ncbi.nlm.nih.gov/34841437" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9NXB9-1", "protein_name": "Very long chain fatty acid elongase 2", "gene_name": "ELOVL2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9NXB9", "url": "https://www.uniprot.org/uniprotkb/Q9NXB9" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.34841437", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "ELOVL2 restrains cell proliferation, migration, and invasion of prostate cancer via regulation of the tumor suppressor INPP4B.", "journal": "Cellular signalling", "date": "2022", "authors": "Hu T, Zhang H, Du Y, Luo S, Yang X, Zhang H, Feng J, Chen X, Tu X, Wang C, Zhang Y", "reference": { "type": "PubMed", "id": "35640821", "url": "https://pubmed.ncbi.nlm.nih.gov/35640821" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9NXB9-1", "protein_name": "Very long chain fatty acid elongase 2", "gene_name": "ELOVL2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9NXB9", "url": "https://www.uniprot.org/uniprotkb/Q9NXB9" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.35640821", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "An ELOVL2-Based Epigenetic Clock for Forensic Age Prediction: A Systematic Review.", "journal": "International journal of molecular sciences", "date": "2023-01-23", "authors": "Paparazzo Ersilia, Lagani Vincenzo, Geracitano Silvana, Citrigno Luigi, Aceto Mirella Aurora, Malvaso Antonio, Bruno Francesco, Passarino Giuseppe, Montesanto Alberto", "reference": { "type": "PubMed", "id": "36768576", "url": "https://pubmed.ncbi.nlm.nih.gov/36768576" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9NXB9-1", "protein_name": "Very long chain fatty acid elongase 2", "gene_name": "ELOVL2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9NXB9", "url": "https://www.uniprot.org/uniprotkb/Q9NXB9" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.36768576", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "ELOVL2-methylation and renal and cardiovascular event in patients with chronic kidney disease.", "journal": "European journal of clinical investigation", "date": "2023-07-26", "authors": "Obeid Rima, Rickens Patricia, Heine Gunnar Henrik, Emrich Insa E, Fliser Danilo, Zawada Adam M, Bodis Marion, Geisel J\u00fcrgen", "reference": { "type": "PubMed", "id": "37493252", "url": "https://pubmed.ncbi.nlm.nih.gov/37493252" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9NXB9-1", "protein_name": "Very long chain fatty acid elongase 2", "gene_name": "ELOVL2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9NXB9", "url": "https://www.uniprot.org/uniprotkb/Q9NXB9" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.37493252", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The 3-hydroxyacyl-CoA dehydratase 1/2 form complex with trans-2-enoyl-CoA reductase involved in substrates transfer in very long chain fatty acid elongation.", "journal": "Biochem. Biophys. Res. Commun.", "date": "2024", "authors": "Zhou Youli, Lv Rui, Ye Richard D, Ren Ruobing, Yu Leiye", "reference": { "type": "PubMed", "id": "38422897", "url": "https://pubmed.ncbi.nlm.nih.gov/38422897" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9NXB9-1", "protein_name": "Very long chain fatty acid elongase 2", "gene_name": "ELOVL2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NYP7-1", "protein_name": "Very long chain fatty acid elongase 5", "gene_name": "ELOVL5", "tax_name": "Human" }, { "uniprot_canonical_ac": "A1L3X0-1", "protein_name": "Very long chain fatty acid elongase 7", "gene_name": "ELOVL7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6Y1H2-1", "protein_name": "Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase 2", "gene_name": "HACD2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BW60-1", "protein_name": "Very long chain fatty acid elongase 1", "gene_name": "ELOVL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HB03-1", "protein_name": "Very long chain fatty acid elongase 3", "gene_name": "ELOVL3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NZ01-1", "protein_name": "Very-long-chain enoyl-CoA reductase", "gene_name": "TECR", "tax_name": "Human" }, { "uniprot_canonical_ac": "B0YJ81-1", "protein_name": "Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase 1", "gene_name": "HACD1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9NXB9", "url": "https://www.uniprot.org/uniprotkb/Q9NXB9" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.38422897", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 8 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The biosynthesis of delta-9,12,15,18-tetracosatetraenoic and of delta-6,9,12,15,18-tetracosapentaenoic acids by rat testes.", "journal": "The Journal of biological chemistry", "date": "1970", "authors": "Bridges RB, Coniglio JG", "reference": { "type": "PubMed", "id": "5411545", "url": "https://pubmed.ncbi.nlm.nih.gov/5411545" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9NXB9-1", "protein_name": "Very long chain fatty acid elongase 2", "gene_name": "ELOVL2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NYP7-1", "protein_name": "Very long chain fatty acid elongase 5", "gene_name": "ELOVL5", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95864-1", "protein_name": "Acyl-CoA 6-desaturase", "gene_name": "FADS2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P33121-1", "protein_name": "Long-chain-fatty-acid--CoA ligase 1", "gene_name": "ACSL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BW60-1", "protein_name": "Very long chain fatty acid elongase 1", "gene_name": "ELOVL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HB03-1", "protein_name": "Very long chain fatty acid elongase 3", "gene_name": "ELOVL3", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60427-1", "protein_name": "Acyl-CoA (8-3)-desaturase", "gene_name": "FADS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P33897-1", "protein_name": "ATP-binding cassette sub-family D member 1", "gene_name": "ABCD1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9NXB9", "url": "https://www.uniprot.org/uniprotkb/Q9NXB9" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.5411545", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 8 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Discovery of an arachidonoyl coenzyme A synthetase in human platelets.", "journal": "The Journal of biological chemistry", "date": "1982", "authors": "Wilson DB, Prescott SM, Majerus PW", "reference": { "type": "PubMed", "id": "7061494", "url": "https://pubmed.ncbi.nlm.nih.gov/7061494" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9NXB9-1", "protein_name": "Very long chain fatty acid elongase 2", "gene_name": "ELOVL2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NYP7-1", "protein_name": "Very long chain fatty acid elongase 5", "gene_name": "ELOVL5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P22307-1", "protein_name": "Sterol carrier protein 2", "gene_name": "SCP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95864-1", "protein_name": "Acyl-CoA 6-desaturase", "gene_name": "FADS2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P33121-1", "protein_name": "Long-chain-fatty-acid--CoA ligase 1", "gene_name": "ACSL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51659-1", "protein_name": "Peroxisomal multifunctional enzyme type 2", "gene_name": "HSD17B4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BW60-1", "protein_name": "Very long chain fatty acid elongase 1", "gene_name": "ELOVL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HB03-1", "protein_name": "Very long chain fatty acid elongase 3", "gene_name": "ELOVL3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P09110-1", "protein_name": "3-ketoacyl-CoA thiolase, peroxisomal", "gene_name": "ACAA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60427-1", "protein_name": "Acyl-CoA (8-3)-desaturase", "gene_name": "FADS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14734-1", "protein_name": "Acyl-coenzyme A thioesterase 8", "gene_name": "ACOT8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P33897-1", "protein_name": "ATP-binding cassette sub-family D member 1", "gene_name": "ABCD1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9NXB9", "url": "https://www.uniprot.org/uniprotkb/Q9NXB9" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.7061494", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 12 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Comparison of the metabolism of alpha-linolenic acid and its delta 6 desaturation product, stearidonic acid, in cultured NIH-3T3 cells.", "journal": "Lipids", "date": "1993", "authors": "Cantrill RC, Huang YS, Ells GW, Horrobin DF", "reference": { "type": "PubMed", "id": "8096621", "url": "https://pubmed.ncbi.nlm.nih.gov/8096621" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9NXB9-1", "protein_name": "Very long chain fatty acid elongase 2", "gene_name": "ELOVL2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NYP7-1", "protein_name": "Very long chain fatty acid elongase 5", "gene_name": "ELOVL5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P22307-1", "protein_name": "Sterol carrier protein 2", "gene_name": "SCP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95864-1", "protein_name": "Acyl-CoA 6-desaturase", "gene_name": "FADS2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P33121-1", "protein_name": "Long-chain-fatty-acid--CoA ligase 1", "gene_name": "ACSL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51659-1", "protein_name": "Peroxisomal multifunctional enzyme type 2", "gene_name": "HSD17B4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BW60-1", "protein_name": "Very long chain fatty acid elongase 1", "gene_name": "ELOVL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HB03-1", "protein_name": "Very long chain fatty acid elongase 3", "gene_name": "ELOVL3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P09110-1", "protein_name": "3-ketoacyl-CoA thiolase, peroxisomal", "gene_name": "ACAA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60427-1", "protein_name": "Acyl-CoA (8-3)-desaturase", "gene_name": "FADS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14734-1", "protein_name": "Acyl-coenzyme A thioesterase 8", "gene_name": "ACOT8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P33897-1", "protein_name": "ATP-binding cassette sub-family D member 1", "gene_name": "ABCD1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9NXB9", "url": "https://www.uniprot.org/uniprotkb/Q9NXB9" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.8096621", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 12 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Metabolism of gammalinolenic acid in human neutrophils.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "1996", "authors": "Chilton-Lopez, Surette ME, Swan DD, Fonteh AN, Johnson MM, Chilton FH", "reference": { "type": "PubMed", "id": "8609415", "url": "https://pubmed.ncbi.nlm.nih.gov/8609415" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9NXB9-1", "protein_name": "Very long chain fatty acid elongase 2", "gene_name": "ELOVL2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NYP7-1", "protein_name": "Very long chain fatty acid elongase 5", "gene_name": "ELOVL5", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95864-1", "protein_name": "Acyl-CoA 6-desaturase", "gene_name": "FADS2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P33121-1", "protein_name": "Long-chain-fatty-acid--CoA ligase 1", "gene_name": "ACSL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BW60-1", "protein_name": "Very long chain fatty acid elongase 1", "gene_name": "ELOVL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HB03-1", "protein_name": "Very long chain fatty acid elongase 3", "gene_name": "ELOVL3", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60427-1", "protein_name": "Acyl-CoA (8-3)-desaturase", "gene_name": "FADS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P33897-1", "protein_name": "ATP-binding cassette sub-family D member 1", "gene_name": "ABCD1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9NXB9", "url": "https://www.uniprot.org/uniprotkb/Q9NXB9" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.8609415", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 8 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Docosahexaenoic acid synthesis in human skin fibroblasts involves peroxisomal retroconversion of tetracosahexaenoic acid.", "journal": "Journal of lipid research", "date": "1995", "authors": "Moore SA, Hurt E, Yoder E, Sprecher H, Spector AA", "reference": { "type": "PubMed", "id": "8656081", "url": "https://pubmed.ncbi.nlm.nih.gov/8656081" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9NXB9-1", "protein_name": "Very long chain fatty acid elongase 2", "gene_name": "ELOVL2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NYP7-1", "protein_name": "Very long chain fatty acid elongase 5", "gene_name": "ELOVL5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P22307-1", "protein_name": "Sterol carrier protein 2", "gene_name": "SCP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95864-1", "protein_name": "Acyl-CoA 6-desaturase", "gene_name": "FADS2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P33121-1", "protein_name": "Long-chain-fatty-acid--CoA ligase 1", "gene_name": "ACSL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51659-1", "protein_name": "Peroxisomal multifunctional enzyme type 2", "gene_name": "HSD17B4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BW60-1", "protein_name": "Very long chain fatty acid elongase 1", "gene_name": "ELOVL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HB03-1", "protein_name": "Very long chain fatty acid elongase 3", "gene_name": "ELOVL3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P09110-1", "protein_name": "3-ketoacyl-CoA thiolase, peroxisomal", "gene_name": "ACAA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60427-1", "protein_name": "Acyl-CoA (8-3)-desaturase", "gene_name": "FADS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14734-1", "protein_name": "Acyl-coenzyme A thioesterase 8", "gene_name": "ACOT8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P33897-1", "protein_name": "ATP-binding cassette sub-family D member 1", "gene_name": "ABCD1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9NXB9", "url": "https://www.uniprot.org/uniprotkb/Q9NXB9" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.8656081", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 12 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Docosapentaenoic acid (22:5, n-3), an elongation metabolite of eicosapentaenoic acid (20:5, n-3), is a potent stimulator of endothelial cell migration on pretreatment in vitro.", "journal": "Prostaglandins, leukotrienes, and essential fatty acids", "date": "1996", "authors": "Kanayasu-Toyoda T, Morita I, Murota S", "reference": { "type": "PubMed", "id": "8832760", "url": "https://pubmed.ncbi.nlm.nih.gov/8832760" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9NXB9-1", "protein_name": "Very long chain fatty acid elongase 2", "gene_name": "ELOVL2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NYP7-1", "protein_name": "Very long chain fatty acid elongase 5", "gene_name": "ELOVL5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P22307-1", "protein_name": "Sterol carrier protein 2", "gene_name": "SCP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95864-1", "protein_name": "Acyl-CoA 6-desaturase", "gene_name": "FADS2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P33121-1", "protein_name": "Long-chain-fatty-acid--CoA ligase 1", "gene_name": "ACSL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51659-1", "protein_name": "Peroxisomal multifunctional enzyme type 2", "gene_name": "HSD17B4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BW60-1", "protein_name": "Very long chain fatty acid elongase 1", "gene_name": "ELOVL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HB03-1", "protein_name": "Very long chain fatty acid elongase 3", "gene_name": "ELOVL3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P09110-1", "protein_name": "3-ketoacyl-CoA thiolase, peroxisomal", "gene_name": "ACAA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60427-1", "protein_name": "Acyl-CoA (8-3)-desaturase", "gene_name": "FADS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14734-1", "protein_name": "Acyl-coenzyme A thioesterase 8", "gene_name": "ACOT8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P33897-1", "protein_name": "ATP-binding cassette sub-family D member 1", "gene_name": "ABCD1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9NXB9", "url": "https://www.uniprot.org/uniprotkb/Q9NXB9" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.8832760", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 12 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Analysis of the putative role of 24-carbon polyunsaturated fatty acids in the biosynthesis of docosapentaenoic (22:5n-6) and docosahexaenoic (22:6n-3) acids.", "journal": "FEBS letters", "date": "1998", "authors": "Infante JP, Huszagh VA", "reference": { "type": "PubMed", "id": "9684854", "url": "https://pubmed.ncbi.nlm.nih.gov/9684854" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9NXB9-1", "protein_name": "Very long chain fatty acid elongase 2", "gene_name": "ELOVL2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NYP7-1", "protein_name": "Very long chain fatty acid elongase 5", "gene_name": "ELOVL5", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95864-1", "protein_name": "Acyl-CoA 6-desaturase", "gene_name": "FADS2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P33121-1", "protein_name": "Long-chain-fatty-acid--CoA ligase 1", "gene_name": "ACSL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BW60-1", "protein_name": "Very long chain fatty acid elongase 1", "gene_name": "ELOVL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HB03-1", "protein_name": "Very long chain fatty acid elongase 3", "gene_name": "ELOVL3", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60427-1", "protein_name": "Acyl-CoA (8-3)-desaturase", "gene_name": "FADS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P33897-1", "protein_name": "ATP-binding cassette sub-family D member 1", "gene_name": "ABCD1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9NXB9", "url": "https://www.uniprot.org/uniprotkb/Q9NXB9" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.9684854", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 8 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Fate of linoleic, arachidonic, and docosa-7,10,13,16-tetraenoic acids in rat testicles.", "journal": "Journal of lipid research", "date": "1973", "authors": "Ayala S, Gaspar G, Brenner RR, Peluffo RO, Kunau W", "reference": { "type": "PubMed", "id": "9704073", "url": "https://pubmed.ncbi.nlm.nih.gov/9704073" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9NXB9-1", "protein_name": "Very long chain fatty acid elongase 2", "gene_name": "ELOVL2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NYP7-1", "protein_name": "Very long chain fatty acid elongase 5", "gene_name": "ELOVL5", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95864-1", "protein_name": "Acyl-CoA 6-desaturase", "gene_name": "FADS2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P33121-1", "protein_name": "Long-chain-fatty-acid--CoA ligase 1", "gene_name": "ACSL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BW60-1", "protein_name": "Very long chain fatty acid elongase 1", "gene_name": "ELOVL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HB03-1", "protein_name": "Very long chain fatty acid elongase 3", "gene_name": "ELOVL3", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60427-1", "protein_name": "Acyl-CoA (8-3)-desaturase", "gene_name": "FADS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P33897-1", "protein_name": "ATP-binding cassette sub-family D member 1", "gene_name": "ABCD1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9NXB9", "url": "https://www.uniprot.org/uniprotkb/Q9NXB9" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.9704073", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 8 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Importance of dietary gamma-linolenic acid in human health and nutrition.", "journal": "The Journal of nutrition", "date": "1998", "authors": "Fan YY, Chapkin RS", "reference": { "type": "PubMed", "id": "9732298", "url": "https://pubmed.ncbi.nlm.nih.gov/9732298" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9NXB9-1", "protein_name": "Very long chain fatty acid elongase 2", "gene_name": "ELOVL2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NYP7-1", "protein_name": "Very long chain fatty acid elongase 5", "gene_name": "ELOVL5", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95864-1", "protein_name": "Acyl-CoA 6-desaturase", "gene_name": "FADS2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P33121-1", "protein_name": "Long-chain-fatty-acid--CoA ligase 1", "gene_name": "ACSL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BW60-1", "protein_name": "Very long chain fatty acid elongase 1", "gene_name": "ELOVL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HB03-1", "protein_name": "Very long chain fatty acid elongase 3", "gene_name": "ELOVL3", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60427-1", "protein_name": "Acyl-CoA (8-3)-desaturase", "gene_name": "FADS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P33897-1", "protein_name": "ATP-binding cassette sub-family D member 1", "gene_name": "ABCD1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9NXB9", "url": "https://www.uniprot.org/uniprotkb/Q9NXB9" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.9732298", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 8 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Nomenclature of the human immunoglobulin lambda (IGL) genes.", "journal": "Exp. Clin. Immunogenet.", "date": "2001", "authors": "Lefranc M P", "reference": { "type": "PubMed", "id": "11872955", "url": "https://pubmed.ncbi.nlm.nih.gov/11872955" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "A0A075B6H9-1", "protein_name": "Immunoglobulin lambda variable 4-69", "gene_name": "IGLV4-69", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A075B6J6-1", "protein_name": "Immunoglobulin lambda variable 3-22", "gene_name": "IGLV3-22", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A075B6J9-1", "protein_name": "Immunoglobulin lambda variable 2-18", "gene_name": "IGLV2-18", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A075B6K0-1", "protein_name": "Immunoglobulin lambda variable 3-16", "gene_name": "IGLV3-16", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A075B6K5-1", "protein_name": "Immunoglobulin lambda variable 3-9", "gene_name": "IGLV3-9", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0G2JS06-1", "protein_name": "Immunoglobulin lambda variable 5-39", "gene_name": "IGLV5-39", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01700-1", "protein_name": "Immunoglobulin lambda variable 1-47", "gene_name": "IGLV1-47", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01714-1", "protein_name": "Immunoglobulin lambda variable 3-19", "gene_name": "IGLV3-19", "tax_name": "Human" }, { "uniprot_canonical_ac": "P80748-1", "protein_name": "Immunoglobulin lambda variable 3-21", "gene_name": "IGLV3-21", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DOY2-1", "protein_name": "Immunoglobulin lambda constant 2", "gene_name": "IGLC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A087WSX0-1", "protein_name": "Immunoglobulin lambda variable 5-45", "gene_name": "IGLV5-45", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A075B6I0-1", "protein_name": "Immunoglobulin lambda variable 8-61", "gene_name": "IGLV8-61", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A075B6K2-1", "protein_name": "Immunoglobulin lambda variable 3-12", "gene_name": "IGLV3-12", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0B4J1U3-1", "protein_name": "Immunoglobulin lambda variable 1-36", "gene_name": "IGLV1-36", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01699-1", "protein_name": "Immunoglobulin lambda variable 1-44", "gene_name": "IGLV1-44", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01701-1", "protein_name": "Immunoglobulin lambda variable 1-51", "gene_name": "IGLV1-51", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01704-1", "protein_name": "Immunoglobulin lambda variable 2-14", "gene_name": "IGLV2-14", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01706-1", "protein_name": "Immunoglobulin lambda variable 2-11", "gene_name": "IGLV2-11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01709-1", "protein_name": "Immunoglobulin lambda variable 2-8", "gene_name": "IGLV2-8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01717-1", "protein_name": "Immunoglobulin lambda variable 3-25", "gene_name": "IGLV3-25", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01721-1", "protein_name": "Immunoglobulin lambda variable 6-57", "gene_name": "IGLV6-57", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A075B6K4-1", "protein_name": "Immunoglobulin lambda variable 3-10", "gene_name": "IGLV3-10", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A075B6K6-1", "protein_name": "Immunoglobulin lambda variable 4-3", "gene_name": "IGLV4-3", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0A0MRZ9-1", "protein_name": "Immunoglobulin lambda variable 5-52", "gene_name": "IGLV5-52", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0B4J1Y8-1", "protein_name": "Immunoglobulin lambda variable 9-49", "gene_name": "IGLV9-49", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01703-1", "protein_name": "Immunoglobulin lambda variable 1-40", "gene_name": "IGLV1-40", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01705-1", "protein_name": "Immunoglobulin lambda variable 2-23", "gene_name": "IGLV2-23", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01715-1", "protein_name": "Immunoglobulin lambda variable 3-1", "gene_name": "IGLV3-1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01718-1", "protein_name": "Immunoglobulin lambda variable 3-27", "gene_name": "IGLV3-27", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04211-1", "protein_name": "Immunoglobulin lambda variable 7-43", "gene_name": "IGLV7-43", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A075B6I4-1", "protein_name": "Immunoglobulin lambda variable 10-54", "gene_name": "IGLV10-54", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CF74-1", "protein_name": "Immunoglobulin lambda constant 6", "gene_name": "IGLC6", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A075B6I1-1", "protein_name": "Immunoglobulin lambda variable 4-60", "gene_name": "IGLV4-60", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A075B6I9-1", "protein_name": "Immunoglobulin lambda variable 7-46", "gene_name": "IGLV7-46", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A075B6J1-1", "protein_name": "Immunoglobulin lambda variable 5-37", "gene_name": "IGLV5-37", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0M8Q6-1", "protein_name": "Immunoglobulin lambda constant 7", "gene_name": "IGLC7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG04-1", "protein_name": "Immunoglobulin lambda constant 1", "gene_name": "IGLC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DOY3-1", "protein_name": "Immunoglobulin lambda constant 3", "gene_name": "IGLC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0A0MT76-1", "protein_name": "Immunoglobulin lambda joining 1", "gene_name": "IGLJ1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "A0A075B6H9", "url": "https://www.uniprot.org/uniprotkb/A0A075B6H9" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.11872955", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 39 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Immunoglobulin somatic hypermutation.", "journal": "Annual review of genetics", "date": "2007", "authors": "Teng Grace, Papavasiliou F Nina", "reference": { "type": "PubMed", "id": "17576170", "url": "https://pubmed.ncbi.nlm.nih.gov/17576170" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "A0A075B6H9-1", "protein_name": "Immunoglobulin lambda variable 4-69", "gene_name": "IGLV4-69", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A075B6J6-1", "protein_name": "Immunoglobulin lambda variable 3-22", "gene_name": "IGLV3-22", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A075B6J9-1", "protein_name": "Immunoglobulin lambda variable 2-18", "gene_name": "IGLV2-18", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A075B6K0-1", "protein_name": "Immunoglobulin lambda variable 3-16", "gene_name": "IGLV3-16", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A075B6K5-1", "protein_name": "Immunoglobulin lambda variable 3-9", "gene_name": "IGLV3-9", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0A0MT89-1", "protein_name": "Immunoglobulin kappa joining 1", "gene_name": "IGKJ1", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0G2JS06-1", "protein_name": "Immunoglobulin lambda variable 5-39", "gene_name": "IGLV5-39", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01700-1", "protein_name": "Immunoglobulin lambda variable 1-47", "gene_name": "IGLV1-47", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01714-1", "protein_name": "Immunoglobulin lambda variable 3-19", "gene_name": "IGLV3-19", "tax_name": "Human" }, { "uniprot_canonical_ac": "P80748-1", "protein_name": "Immunoglobulin lambda variable 3-21", "gene_name": "IGLV3-21", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A075B6P5-1", "protein_name": "Immunoglobulin kappa variable 2-28", "gene_name": "IGKV2-28", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A075B6S4-1", "protein_name": "Immunoglobulin kappa variable 1D-17", "gene_name": "IGKV1D-17", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A075B6S6-1", "protein_name": "Immunoglobulin kappa variable 2D-30", "gene_name": "IGKV2D-30", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A087WSY6-1", "protein_name": "Immunoglobulin kappa variable 3D-15", "gene_name": "IGKV3D-15", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A087WW87-1", "protein_name": "Immunoglobulin kappa variable 2-40", "gene_name": "IGKV2-40", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0A0MRZ8-1", "protein_name": "Immunoglobulin kappa variable 3D-11", "gene_name": "IGKV3D-11", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0B4J1Z2-1", "protein_name": "Immunoglobulin kappa variable 1D-43", "gene_name": "IGKV1D-43", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0B4J2D9-1", "protein_name": "Immunoglobulin kappa variable 1D-13", "gene_name": "IGKV1D-13", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0C4DH24-1", "protein_name": "Immunoglobulin kappa variable 6-21", "gene_name": "IGKV6-21", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0C4DH25-1", "protein_name": "Immunoglobulin kappa variable 3D-20", "gene_name": "IGKV3D-20", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0C4DH55-1", "protein_name": "Immunoglobulin kappa variable 3D-7", "gene_name": "IGKV3D-7", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0C4DH69-1", "protein_name": "Immunoglobulin kappa variable 1-9", "gene_name": "IGKV1-9", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01593-1", "protein_name": "Immunoglobulin kappa variable 1D-33", "gene_name": "IGKV1D-33", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01599-1", "protein_name": "Immunoglobulin kappa variable 1-17", "gene_name": "IGKV1-17", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01601-1", "protein_name": "Immunoglobulin kappa variable 1D-16", "gene_name": "IGKV1D-16", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01611-1", "protein_name": "Immunoglobulin kappa variable 1D-12", "gene_name": "IGKV1D-12", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01615-1", "protein_name": "Immunoglobulin kappa variable 2D-28", "gene_name": "IGKV2D-28", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01619-1", "protein_name": "Immunoglobulin kappa variable 3-20", "gene_name": "IGKV3-20", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01624-1", "protein_name": "Immunoglobulin kappa variable 3-15", "gene_name": "IGKV3-15", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04433-1", "protein_name": "Immunoglobulin kappa variable 3-11", "gene_name": "IGKV3-11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DP09-1", "protein_name": "Immunoglobulin kappa variable 1-13", "gene_name": "IGKV1-13", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A087WSZ0-1", "protein_name": "Immunoglobulin kappa variable 1D-8", "gene_name": "IGKV1D-8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01602-1", "protein_name": "Immunoglobulin kappa variable 1-5", "gene_name": "IGKV1-5", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A075B6R9-1", "protein_name": "Probable non-functional immunoglobulin kappa variable 2D-24", "gene_name": "IGKV2D-24", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01871-2", "protein_name": "Immunoglobulin heavy constant mu", "gene_name": "IGHM", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0C4DH62-1", "protein_name": "Immunoglobulin heavy joining 1", "gene_name": "IGHJ1", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A075B6R2-1", "protein_name": "Immunoglobulin heavy variable 4-4", "gene_name": "IGHV4-4", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0B4J1U7-1", "protein_name": "Immunoglobulin heavy variable 6-1", "gene_name": "IGHV6-1", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0B4J1V0-1", "protein_name": "Immunoglobulin heavy variable 3-15", "gene_name": "IGHV3-15", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0J9YVY3-1", "protein_name": "Immunoglobulin heavy variable 7-4-1", "gene_name": "IGHV7-4-1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01767-1", "protein_name": "Immunoglobulin heavy variable 3-53", "gene_name": "IGHV3-53", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06331-1", "protein_name": "Immunoglobulin heavy variable 4-34", "gene_name": "IGHV4-34", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DP03-1", "protein_name": "Immunoglobulin heavy variable 3-30-5", "gene_name": "IGHV3-30-5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DP04-1", "protein_name": "Immunoglobulin heavy variable 3-43D", "gene_name": "IGHV3-43D", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DP06-1", "protein_name": "Immunoglobulin heavy variable 4-30-4", "gene_name": "IGHV4-30-4", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0A0MT36-1", "protein_name": "Immunoglobulin kappa variable 6D-21", "gene_name": "IGKV6D-21", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0C4DH67-1", "protein_name": "Immunoglobulin kappa variable 1-8", "gene_name": "IGKV1-8", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0C4DH72-1", "protein_name": "Immunoglobulin kappa variable 1-6", "gene_name": "IGKV1-6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01597-1", "protein_name": "Immunoglobulin kappa variable 1-39", "gene_name": "IGKV1-39", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06310-1", "protein_name": "Immunoglobulin kappa variable 2-30", "gene_name": "IGKV2-30", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06312-1", "protein_name": "Immunoglobulin kappa variable 4-1", "gene_name": "IGKV4-1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01614-1", "protein_name": "Immunoglobulin kappa variable 2D-40", "gene_name": "IGKV2D-40", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DOY2-1", "protein_name": "Immunoglobulin lambda constant 2", "gene_name": "IGLC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0C4DH35-1", "protein_name": "Probable non-functional immunoglobulin heavy variable 3-35", "gene_name": "IGHV3-35", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DTW3-1", "protein_name": "Probable non-functional immunoglobulin heavy variable 1-38-4", "gene_name": "IGHV1-38-4", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A075B6H7-1", "protein_name": "Probable non-functional immunoglobulin kappa variable 3-7", "gene_name": "IGKV3-7", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A087WSX0-1", "protein_name": "Immunoglobulin lambda variable 5-45", "gene_name": "IGLV5-45", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A075B6S2-1", "protein_name": "Immunoglobulin kappa variable 2D-29", "gene_name": "IGKV2D-29", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0A0MRZ7-1", "protein_name": "Immunoglobulin kappa variable 2D-26", "gene_name": "IGKV2D-26", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04432-1", "protein_name": "Immunoglobulin kappa variable 1D-39", "gene_name": "IGKV1D-39", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06315-1", "protein_name": "Immunoglobulin kappa variable 5-2", "gene_name": "IGKV5-2", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A075B6I0-1", "protein_name": "Immunoglobulin lambda variable 8-61", "gene_name": "IGLV8-61", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A075B6K2-1", "protein_name": "Immunoglobulin lambda variable 3-12", "gene_name": "IGLV3-12", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0B4J1U3-1", "protein_name": "Immunoglobulin lambda variable 1-36", "gene_name": "IGLV1-36", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01699-1", "protein_name": "Immunoglobulin lambda variable 1-44", "gene_name": "IGLV1-44", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01701-1", "protein_name": "Immunoglobulin lambda variable 1-51", "gene_name": "IGLV1-51", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01704-1", "protein_name": "Immunoglobulin lambda variable 2-14", "gene_name": "IGLV2-14", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01706-1", "protein_name": "Immunoglobulin lambda variable 2-11", "gene_name": "IGLV2-11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01709-1", "protein_name": "Immunoglobulin lambda variable 2-8", "gene_name": "IGLV2-8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01717-1", "protein_name": "Immunoglobulin lambda variable 3-25", "gene_name": "IGLV3-25", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01721-1", "protein_name": "Immunoglobulin lambda variable 6-57", "gene_name": "IGLV6-57", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A075B6K4-1", "protein_name": "Immunoglobulin lambda variable 3-10", "gene_name": "IGLV3-10", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A075B6K6-1", "protein_name": "Immunoglobulin lambda variable 4-3", "gene_name": "IGLV4-3", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0A0MRZ9-1", "protein_name": "Immunoglobulin lambda variable 5-52", "gene_name": "IGLV5-52", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0B4J1Y8-1", "protein_name": "Immunoglobulin lambda variable 9-49", "gene_name": "IGLV9-49", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01703-1", "protein_name": "Immunoglobulin lambda variable 1-40", "gene_name": "IGLV1-40", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01705-1", "protein_name": "Immunoglobulin lambda variable 2-23", "gene_name": "IGLV2-23", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01715-1", "protein_name": "Immunoglobulin lambda variable 3-1", "gene_name": "IGLV3-1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01718-1", "protein_name": "Immunoglobulin lambda variable 3-27", "gene_name": "IGLV3-27", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04211-1", "protein_name": "Immunoglobulin lambda variable 7-43", "gene_name": "IGLV7-43", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A075B6S9-1", "protein_name": "Probable non-functional immunoglobulin kappa variable 1-37", "gene_name": "IGKV1-37", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A075B6I4-1", "protein_name": "Immunoglobulin lambda variable 10-54", "gene_name": "IGLV10-54", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01860-2", "protein_name": "Immunoglobulin heavy constant gamma 3", "gene_name": "IGHG3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01861-2", "protein_name": "Immunoglobulin heavy constant gamma 4", "gene_name": "IGHG4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01876-2", "protein_name": "Immunoglobulin heavy constant alpha 1", "gene_name": "IGHA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01880-2", "protein_name": "Immunoglobulin heavy constant delta", "gene_name": "IGHD", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CF74-1", "protein_name": "Immunoglobulin lambda constant 6", "gene_name": "IGLC6", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A075B6I1-1", "protein_name": "Immunoglobulin lambda variable 4-60", "gene_name": "IGLV4-60", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A075B6I9-1", "protein_name": "Immunoglobulin lambda variable 7-46", "gene_name": "IGLV7-46", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A075B6J1-1", "protein_name": "Immunoglobulin lambda variable 5-37", "gene_name": "IGLV5-37", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A075B6H8-1", "protein_name": "Probable non-functional immunoglobulin kappa variable 1D-42", "gene_name": "IGKV1D-42", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0C4DH30-1", "protein_name": "Probable non-functional immunoglobulin heavy variable 3-16", "gene_name": "IGHV3-16", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A075B6J2-1", "protein_name": "Probable non-functional immunoglobulin lambda variable 2-33", "gene_name": "IGLV2-33", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DSN7-1", "protein_name": "Probable non-functional immunoglobulin kappa variable 1D-37", "gene_name": "IGKV1D-37", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DTE2-1", "protein_name": "Probable non-functional immunoglobulin heavy variable 8-51-1", "gene_name": "IGHV8-51-1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DTE1-1", "protein_name": "Probable non-functional immunoglobulin heavy variable 3-38-3", "gene_name": "IGHV3-38-3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01825-1", "protein_name": "Immunoglobulin heavy variable 4-59", "gene_name": "IGHV4-59", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DOY5-1", "protein_name": "Immunoglobulin heavy diversity 1-1", "gene_name": "IGHD1-1", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0A0MS15-1", "protein_name": "Immunoglobulin heavy variable 3-49", "gene_name": "IGHV3-49", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0B4J1X8-1", "protein_name": "Immunoglobulin heavy variable 3-43", "gene_name": "IGHV3-43", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0B4J1Y9-1", "protein_name": "Immunoglobulin heavy variable 3-72", "gene_name": "IGHV3-72", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0C4DH34-1", "protein_name": "Immunoglobulin heavy variable 4-28", "gene_name": "IGHV4-28", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0C4DH38-1", "protein_name": "Immunoglobulin heavy variable 5-51", "gene_name": "IGHV5-51", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0C4DH39-1", "protein_name": "Immunoglobulin heavy variable 1-58", "gene_name": "IGHV1-58", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0C4DH42-1", "protein_name": "Immunoglobulin heavy variable 3-66", "gene_name": "IGHV3-66", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01817-1", "protein_name": "Immunoglobulin heavy variable 2-5", "gene_name": "IGHV2-5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01824-1", "protein_name": "Immunoglobulin heavy variable 4-39", "gene_name": "IGHV4-39", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DP07-1", "protein_name": "Immunoglobulin heavy variable 4-31", "gene_name": "IGHV4-31", "tax_name": "Human" }, { "uniprot_canonical_ac": "P23083-1", "protein_name": "Immunoglobulin heavy variable 1-2", "gene_name": "IGHV1-2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01742-1", "protein_name": "Immunoglobulin heavy variable 1-69", "gene_name": "IGHV1-69", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01768-1", "protein_name": "Immunoglobulin heavy variable 3-30", "gene_name": "IGHV3-30", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01814-1", "protein_name": "Immunoglobulin heavy variable 2-70", "gene_name": "IGHV2-70", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01772-1", "protein_name": "Immunoglobulin heavy variable 3-33", "gene_name": "IGHV3-33", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A075B6Q5-1", "protein_name": "Immunoglobulin heavy variable 3-64", "gene_name": "IGHV3-64", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A087WSY4-1", "protein_name": "Immunoglobulin heavy variable 4-30-2", "gene_name": "IGHV4-30-2", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0B4J1V1-1", "protein_name": "Immunoglobulin heavy variable 3-21", "gene_name": "IGHV3-21", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0B4J1V2-1", "protein_name": "Immunoglobulin heavy variable 2-26", "gene_name": "IGHV2-26", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0B4J1V6-1", "protein_name": "Immunoglobulin heavy variable 3-73", "gene_name": "IGHV3-73", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0B4J1X5-1", "protein_name": "Immunoglobulin heavy variable 3-74", "gene_name": "IGHV3-74", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0B4J2H0-1", "protein_name": "Immunoglobulin heavy variable 1-69D", "gene_name": "IGHV1-69D", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0C4DH31-1", "protein_name": "Immunoglobulin heavy variable 1-18", "gene_name": "IGHV1-18", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0C4DH32-1", "protein_name": "Immunoglobulin heavy variable 3-20", "gene_name": "IGHV3-20", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0J9YXX1-1", "protein_name": "Immunoglobulin heavy variable 5-10-1", "gene_name": "IGHV5-10-1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01762-1", "protein_name": "Immunoglobulin heavy variable 3-11", "gene_name": "IGHV3-11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01763-1", "protein_name": "Immunoglobulin heavy variable 3-48", "gene_name": "IGHV3-48", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01764-1", "protein_name": "Immunoglobulin heavy variable 3-23", "gene_name": "IGHV3-23", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01766-1", "protein_name": "Immunoglobulin heavy variable 3-13", "gene_name": "IGHV3-13", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01780-1", "protein_name": "Immunoglobulin heavy variable 3-7", "gene_name": "IGHV3-7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01782-1", "protein_name": "Immunoglobulin heavy variable 3-9", "gene_name": "IGHV3-9", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DP02-1", "protein_name": "Immunoglobulin heavy variable 3-30-3", "gene_name": "IGHV3-30-3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DP08-1", "protein_name": "Immunoglobulin heavy variable 4-38-2", "gene_name": "IGHV4-38-2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01877-2", "protein_name": "Immunoglobulin heavy constant alpha 2", "gene_name": "IGHA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0M8Q6-1", "protein_name": "Immunoglobulin lambda constant 7", "gene_name": "IGLC7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01834-1", "protein_name": "Immunoglobulin kappa constant", "gene_name": "IGKC", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01859-2", "protein_name": "Immunoglobulin heavy constant gamma 2", "gene_name": "IGHG2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG04-1", "protein_name": "Immunoglobulin lambda constant 1", "gene_name": "IGLC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DOY3-1", "protein_name": "Immunoglobulin lambda constant 3", "gene_name": "IGLC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A075B6I7-1", "protein_name": "Probable non-functional immunoglobulin lambda variable 5-48", "gene_name": "IGLV5-48", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A075B6I3-1", "protein_name": "Probable non-functional immunoglobulin lambda variable 11-55", "gene_name": "IGLV11-55", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A075B6I6-1", "protein_name": "Probable non-functional immunoglobulin lambda variable 1-50", "gene_name": "IGLV1-50", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0A0MS14-1", "protein_name": "Immunoglobulin heavy variable 1-45", "gene_name": "IGHV1-45", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0C4DH29-1", "protein_name": "Immunoglobulin heavy variable 1-3", "gene_name": "IGHV1-3", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0C4DH33-1", "protein_name": "Immunoglobulin heavy variable 1-24", "gene_name": "IGHV1-24", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0C4DH41-1", "protein_name": "Immunoglobulin heavy variable 4-61", "gene_name": "IGHV4-61", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0C4DH43-1", "protein_name": "Immunoglobulin heavy variable 2-70D", "gene_name": "IGHV2-70D", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0G2JMI3-1", "protein_name": "Immunoglobulin heavy variable 1-69-2", "gene_name": "IGHV1-69-2", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0J9YX35-1", "protein_name": "Immunoglobulin heavy variable 3-64D", "gene_name": "IGHV3-64D", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01743-1", "protein_name": "Immunoglobulin heavy variable 1-46", "gene_name": "IGHV1-46", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01854-2", "protein_name": "Immunoglobulin heavy constant epsilon", "gene_name": "IGHE", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DP01-1", "protein_name": "Immunoglobulin heavy variable 1-8", "gene_name": "IGHV1-8", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A075B6S5-1", "protein_name": "Immunoglobulin kappa variable 1-27", "gene_name": "IGKV1-27", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0A0MT76-1", "protein_name": "Immunoglobulin lambda joining 1", "gene_name": "IGLJ1", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0C4DH68-1", "protein_name": "Immunoglobulin kappa variable 2-24", "gene_name": "IGKV2-24", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0C4DH73-1", "protein_name": "Immunoglobulin kappa variable 1-12", "gene_name": "IGKV1-12", "tax_name": "Human" }, { "uniprot_canonical_ac": "A2NJV5-1", "protein_name": "Immunoglobulin kappa variable 2-29", "gene_name": "IGKV2-29", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01594-1", "protein_name": "Immunoglobulin kappa variable 1-33", "gene_name": "IGKV1-33", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04430-1", "protein_name": "Immunoglobulin kappa variable 1-16", "gene_name": "IGKV1-16", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0B4J1V7-1", "protein_name": "Probable non-functional immunoglobulin heavy variable 7-81", "gene_name": "IGHV7-81", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01857-2", "protein_name": "Immunoglobulin heavy constant gamma 1", "gene_name": "IGHG1", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0A0MS00-1", "protein_name": "Probable non-functional immunoglobulin lambda variable 3-32", "gene_name": "IGLV3-32", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0C4DH36-1", "protein_name": "Probable non-functional immunoglobulin heavy variable 3-38", "gene_name": "IGHV3-38", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0C4DH26-1", "protein_name": "Probable non-functional immunoglobulin kappa variable 6D-41", "gene_name": "IGKV6D-41", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "A0A075B6H9", "url": "https://www.uniprot.org/uniprotkb/A0A075B6H9" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.17576170", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 162 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Structure and function of immunoglobulins.", "journal": "The Journal of allergy and clinical immunology", "date": "2010-02", "authors": "Schroeder Harry W, Cavacini Lisa", "reference": { "type": "PubMed", "id": "20176268", "url": "https://pubmed.ncbi.nlm.nih.gov/20176268" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "A0A075B6H9-1", "protein_name": "Immunoglobulin lambda variable 4-69", "gene_name": "IGLV4-69", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A075B6J6-1", "protein_name": "Immunoglobulin lambda variable 3-22", "gene_name": "IGLV3-22", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A075B6J9-1", "protein_name": "Immunoglobulin lambda variable 2-18", "gene_name": "IGLV2-18", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A075B6K0-1", "protein_name": "Immunoglobulin lambda variable 3-16", "gene_name": "IGLV3-16", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A075B6K5-1", "protein_name": "Immunoglobulin lambda variable 3-9", "gene_name": "IGLV3-9", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0A0MT89-1", "protein_name": "Immunoglobulin kappa joining 1", "gene_name": "IGKJ1", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0G2JS06-1", "protein_name": "Immunoglobulin lambda variable 5-39", "gene_name": "IGLV5-39", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01700-1", "protein_name": "Immunoglobulin lambda variable 1-47", "gene_name": "IGLV1-47", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01714-1", "protein_name": "Immunoglobulin lambda variable 3-19", "gene_name": "IGLV3-19", "tax_name": "Human" }, { "uniprot_canonical_ac": "P80748-1", "protein_name": "Immunoglobulin lambda variable 3-21", "gene_name": "IGLV3-21", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A075B6P5-1", "protein_name": "Immunoglobulin kappa variable 2-28", "gene_name": "IGKV2-28", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A075B6S4-1", "protein_name": "Immunoglobulin kappa variable 1D-17", "gene_name": "IGKV1D-17", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A075B6S6-1", "protein_name": "Immunoglobulin kappa variable 2D-30", "gene_name": "IGKV2D-30", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A087WSY6-1", "protein_name": "Immunoglobulin kappa variable 3D-15", "gene_name": "IGKV3D-15", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A087WW87-1", "protein_name": "Immunoglobulin kappa variable 2-40", "gene_name": "IGKV2-40", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0A0MRZ8-1", "protein_name": "Immunoglobulin kappa variable 3D-11", "gene_name": "IGKV3D-11", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0B4J1Z2-1", "protein_name": "Immunoglobulin kappa variable 1D-43", "gene_name": "IGKV1D-43", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0B4J2D9-1", "protein_name": "Immunoglobulin kappa variable 1D-13", "gene_name": "IGKV1D-13", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0C4DH24-1", "protein_name": "Immunoglobulin kappa variable 6-21", "gene_name": "IGKV6-21", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0C4DH25-1", "protein_name": "Immunoglobulin kappa variable 3D-20", "gene_name": "IGKV3D-20", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0C4DH55-1", "protein_name": "Immunoglobulin kappa variable 3D-7", "gene_name": "IGKV3D-7", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0C4DH69-1", "protein_name": "Immunoglobulin kappa variable 1-9", "gene_name": "IGKV1-9", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01593-1", "protein_name": "Immunoglobulin kappa variable 1D-33", "gene_name": "IGKV1D-33", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01599-1", "protein_name": "Immunoglobulin kappa variable 1-17", "gene_name": "IGKV1-17", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01601-1", "protein_name": "Immunoglobulin kappa variable 1D-16", "gene_name": "IGKV1D-16", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01611-1", "protein_name": "Immunoglobulin kappa variable 1D-12", "gene_name": "IGKV1D-12", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01615-1", "protein_name": "Immunoglobulin kappa variable 2D-28", "gene_name": "IGKV2D-28", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01619-1", "protein_name": "Immunoglobulin kappa variable 3-20", "gene_name": "IGKV3-20", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01624-1", "protein_name": "Immunoglobulin kappa variable 3-15", "gene_name": "IGKV3-15", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04433-1", "protein_name": "Immunoglobulin kappa variable 3-11", "gene_name": "IGKV3-11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DP09-1", "protein_name": "Immunoglobulin kappa variable 1-13", "gene_name": "IGKV1-13", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A087WSZ0-1", "protein_name": "Immunoglobulin kappa variable 1D-8", "gene_name": "IGKV1D-8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01602-1", "protein_name": "Immunoglobulin kappa variable 1-5", "gene_name": "IGKV1-5", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A075B6R9-1", "protein_name": "Probable non-functional immunoglobulin kappa variable 2D-24", "gene_name": "IGKV2D-24", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01871-2", "protein_name": "Immunoglobulin heavy constant mu", "gene_name": "IGHM", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0C4DH62-1", "protein_name": "Immunoglobulin heavy joining 1", "gene_name": "IGHJ1", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A075B6R2-1", "protein_name": "Immunoglobulin heavy variable 4-4", "gene_name": "IGHV4-4", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0B4J1U7-1", "protein_name": "Immunoglobulin heavy variable 6-1", "gene_name": "IGHV6-1", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0B4J1V0-1", "protein_name": "Immunoglobulin heavy variable 3-15", "gene_name": "IGHV3-15", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0J9YVY3-1", "protein_name": "Immunoglobulin heavy variable 7-4-1", "gene_name": "IGHV7-4-1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01767-1", "protein_name": "Immunoglobulin heavy variable 3-53", "gene_name": "IGHV3-53", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06331-1", "protein_name": "Immunoglobulin heavy variable 4-34", "gene_name": "IGHV4-34", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DP03-1", "protein_name": "Immunoglobulin heavy variable 3-30-5", "gene_name": "IGHV3-30-5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DP04-1", "protein_name": "Immunoglobulin heavy variable 3-43D", "gene_name": "IGHV3-43D", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DP06-1", "protein_name": "Immunoglobulin heavy variable 4-30-4", "gene_name": "IGHV4-30-4", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0A0MT36-1", "protein_name": "Immunoglobulin kappa variable 6D-21", "gene_name": "IGKV6D-21", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0C4DH67-1", "protein_name": "Immunoglobulin kappa variable 1-8", "gene_name": "IGKV1-8", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0C4DH72-1", "protein_name": "Immunoglobulin kappa variable 1-6", "gene_name": "IGKV1-6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01597-1", "protein_name": "Immunoglobulin kappa variable 1-39", "gene_name": "IGKV1-39", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06310-1", "protein_name": "Immunoglobulin kappa variable 2-30", "gene_name": "IGKV2-30", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06312-1", "protein_name": "Immunoglobulin kappa variable 4-1", "gene_name": "IGKV4-1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01614-1", "protein_name": "Immunoglobulin kappa variable 2D-40", "gene_name": "IGKV2D-40", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DOY2-1", "protein_name": "Immunoglobulin lambda constant 2", "gene_name": "IGLC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0C4DH35-1", "protein_name": "Probable non-functional immunoglobulin heavy variable 3-35", "gene_name": "IGHV3-35", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DTW3-1", "protein_name": "Probable non-functional immunoglobulin heavy variable 1-38-4", "gene_name": "IGHV1-38-4", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A075B6H7-1", "protein_name": "Probable non-functional immunoglobulin kappa variable 3-7", "gene_name": "IGKV3-7", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A087WSX0-1", "protein_name": "Immunoglobulin lambda variable 5-45", "gene_name": "IGLV5-45", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A075B6S2-1", "protein_name": "Immunoglobulin kappa variable 2D-29", "gene_name": "IGKV2D-29", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0A0MRZ7-1", "protein_name": "Immunoglobulin kappa variable 2D-26", "gene_name": "IGKV2D-26", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04432-1", "protein_name": "Immunoglobulin kappa variable 1D-39", "gene_name": "IGKV1D-39", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06315-1", "protein_name": "Immunoglobulin kappa variable 5-2", "gene_name": "IGKV5-2", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A075B6I0-1", "protein_name": "Immunoglobulin lambda variable 8-61", "gene_name": "IGLV8-61", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A075B6K2-1", "protein_name": "Immunoglobulin lambda variable 3-12", "gene_name": "IGLV3-12", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0B4J1U3-1", "protein_name": "Immunoglobulin lambda variable 1-36", "gene_name": "IGLV1-36", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01699-1", "protein_name": "Immunoglobulin lambda variable 1-44", "gene_name": "IGLV1-44", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01701-1", "protein_name": "Immunoglobulin lambda variable 1-51", "gene_name": "IGLV1-51", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01704-1", "protein_name": "Immunoglobulin lambda variable 2-14", "gene_name": "IGLV2-14", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01706-1", "protein_name": "Immunoglobulin lambda variable 2-11", "gene_name": "IGLV2-11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01709-1", "protein_name": "Immunoglobulin lambda variable 2-8", "gene_name": "IGLV2-8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01717-1", "protein_name": "Immunoglobulin lambda variable 3-25", "gene_name": "IGLV3-25", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01721-1", "protein_name": "Immunoglobulin lambda variable 6-57", "gene_name": "IGLV6-57", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A075B6K4-1", "protein_name": "Immunoglobulin lambda variable 3-10", "gene_name": "IGLV3-10", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A075B6K6-1", "protein_name": "Immunoglobulin lambda variable 4-3", "gene_name": "IGLV4-3", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0A0MRZ9-1", "protein_name": "Immunoglobulin lambda variable 5-52", "gene_name": "IGLV5-52", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0B4J1Y8-1", "protein_name": "Immunoglobulin lambda variable 9-49", "gene_name": "IGLV9-49", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01703-1", "protein_name": "Immunoglobulin lambda variable 1-40", "gene_name": "IGLV1-40", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01705-1", "protein_name": "Immunoglobulin lambda variable 2-23", "gene_name": "IGLV2-23", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01715-1", "protein_name": "Immunoglobulin lambda variable 3-1", "gene_name": "IGLV3-1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01718-1", "protein_name": "Immunoglobulin lambda variable 3-27", "gene_name": "IGLV3-27", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04211-1", "protein_name": "Immunoglobulin lambda variable 7-43", "gene_name": "IGLV7-43", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A075B6S9-1", "protein_name": "Probable non-functional immunoglobulin kappa variable 1-37", "gene_name": "IGKV1-37", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A075B6I4-1", "protein_name": "Immunoglobulin lambda variable 10-54", "gene_name": "IGLV10-54", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01860-2", "protein_name": "Immunoglobulin heavy constant gamma 3", "gene_name": "IGHG3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01861-2", "protein_name": "Immunoglobulin heavy constant gamma 4", "gene_name": "IGHG4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01876-2", "protein_name": "Immunoglobulin heavy constant alpha 1", "gene_name": "IGHA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01880-2", "protein_name": "Immunoglobulin heavy constant delta", "gene_name": "IGHD", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CF74-1", "protein_name": "Immunoglobulin lambda constant 6", "gene_name": "IGLC6", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A075B6I1-1", "protein_name": "Immunoglobulin lambda variable 4-60", "gene_name": "IGLV4-60", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A075B6I9-1", "protein_name": "Immunoglobulin lambda variable 7-46", "gene_name": "IGLV7-46", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A075B6J1-1", "protein_name": "Immunoglobulin lambda variable 5-37", "gene_name": "IGLV5-37", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A075B6H8-1", "protein_name": "Probable non-functional immunoglobulin kappa variable 1D-42", "gene_name": "IGKV1D-42", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0C4DH30-1", "protein_name": "Probable non-functional immunoglobulin heavy variable 3-16", "gene_name": "IGHV3-16", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A075B6J2-1", "protein_name": "Probable non-functional immunoglobulin lambda variable 2-33", "gene_name": "IGLV2-33", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DSN7-1", "protein_name": "Probable non-functional immunoglobulin kappa variable 1D-37", "gene_name": "IGKV1D-37", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DTE2-1", "protein_name": "Probable non-functional immunoglobulin heavy variable 8-51-1", "gene_name": "IGHV8-51-1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DTE1-1", "protein_name": "Probable non-functional immunoglobulin heavy variable 3-38-3", "gene_name": "IGHV3-38-3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01825-1", "protein_name": "Immunoglobulin heavy variable 4-59", "gene_name": "IGHV4-59", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DOY5-1", "protein_name": "Immunoglobulin heavy diversity 1-1", "gene_name": "IGHD1-1", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0A0MS15-1", "protein_name": "Immunoglobulin heavy variable 3-49", "gene_name": "IGHV3-49", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0B4J1X8-1", "protein_name": "Immunoglobulin heavy variable 3-43", "gene_name": "IGHV3-43", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0B4J1Y9-1", "protein_name": "Immunoglobulin heavy variable 3-72", "gene_name": "IGHV3-72", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0C4DH34-1", "protein_name": "Immunoglobulin heavy variable 4-28", "gene_name": "IGHV4-28", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0C4DH38-1", "protein_name": "Immunoglobulin heavy variable 5-51", "gene_name": "IGHV5-51", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0C4DH39-1", "protein_name": "Immunoglobulin heavy variable 1-58", "gene_name": "IGHV1-58", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0C4DH42-1", "protein_name": "Immunoglobulin heavy variable 3-66", "gene_name": "IGHV3-66", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01817-1", "protein_name": "Immunoglobulin heavy variable 2-5", "gene_name": "IGHV2-5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01824-1", "protein_name": "Immunoglobulin heavy variable 4-39", "gene_name": "IGHV4-39", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DP07-1", "protein_name": "Immunoglobulin heavy variable 4-31", "gene_name": "IGHV4-31", "tax_name": "Human" }, { "uniprot_canonical_ac": "P23083-1", "protein_name": "Immunoglobulin heavy variable 1-2", "gene_name": "IGHV1-2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01742-1", "protein_name": "Immunoglobulin heavy variable 1-69", "gene_name": "IGHV1-69", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01768-1", "protein_name": "Immunoglobulin heavy variable 3-30", "gene_name": "IGHV3-30", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01814-1", "protein_name": "Immunoglobulin heavy variable 2-70", "gene_name": "IGHV2-70", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01772-1", "protein_name": "Immunoglobulin heavy variable 3-33", "gene_name": "IGHV3-33", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A075B6Q5-1", "protein_name": "Immunoglobulin heavy variable 3-64", "gene_name": "IGHV3-64", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A087WSY4-1", "protein_name": "Immunoglobulin heavy variable 4-30-2", "gene_name": "IGHV4-30-2", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0B4J1V1-1", "protein_name": "Immunoglobulin heavy variable 3-21", "gene_name": "IGHV3-21", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0B4J1V2-1", "protein_name": "Immunoglobulin heavy variable 2-26", "gene_name": "IGHV2-26", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0B4J1V6-1", "protein_name": "Immunoglobulin heavy variable 3-73", "gene_name": "IGHV3-73", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0B4J1X5-1", "protein_name": "Immunoglobulin heavy variable 3-74", "gene_name": "IGHV3-74", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0B4J2H0-1", "protein_name": "Immunoglobulin heavy variable 1-69D", "gene_name": "IGHV1-69D", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0C4DH31-1", "protein_name": "Immunoglobulin heavy variable 1-18", "gene_name": "IGHV1-18", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0C4DH32-1", "protein_name": "Immunoglobulin heavy variable 3-20", "gene_name": "IGHV3-20", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0J9YXX1-1", "protein_name": "Immunoglobulin heavy variable 5-10-1", "gene_name": "IGHV5-10-1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01762-1", "protein_name": "Immunoglobulin heavy variable 3-11", "gene_name": "IGHV3-11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01763-1", "protein_name": "Immunoglobulin heavy variable 3-48", "gene_name": "IGHV3-48", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01764-1", "protein_name": "Immunoglobulin heavy variable 3-23", "gene_name": "IGHV3-23", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01766-1", "protein_name": "Immunoglobulin heavy variable 3-13", "gene_name": "IGHV3-13", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01780-1", "protein_name": "Immunoglobulin heavy variable 3-7", "gene_name": "IGHV3-7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01782-1", "protein_name": "Immunoglobulin heavy variable 3-9", "gene_name": "IGHV3-9", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DP02-1", "protein_name": "Immunoglobulin heavy variable 3-30-3", "gene_name": "IGHV3-30-3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DP08-1", "protein_name": "Immunoglobulin heavy variable 4-38-2", "gene_name": "IGHV4-38-2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01877-2", "protein_name": "Immunoglobulin heavy constant alpha 2", "gene_name": "IGHA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0M8Q6-1", "protein_name": "Immunoglobulin lambda constant 7", "gene_name": "IGLC7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01834-1", "protein_name": "Immunoglobulin kappa constant", "gene_name": "IGKC", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01859-2", "protein_name": "Immunoglobulin heavy constant gamma 2", "gene_name": "IGHG2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG04-1", "protein_name": "Immunoglobulin lambda constant 1", "gene_name": "IGLC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DOY3-1", "protein_name": "Immunoglobulin lambda constant 3", "gene_name": "IGLC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A075B6I7-1", "protein_name": "Probable non-functional immunoglobulin lambda variable 5-48", "gene_name": "IGLV5-48", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A075B6I3-1", "protein_name": "Probable non-functional immunoglobulin lambda variable 11-55", "gene_name": "IGLV11-55", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A075B6I6-1", "protein_name": "Probable non-functional immunoglobulin lambda variable 1-50", "gene_name": "IGLV1-50", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0A0MS14-1", "protein_name": "Immunoglobulin heavy variable 1-45", "gene_name": "IGHV1-45", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0C4DH29-1", "protein_name": "Immunoglobulin heavy variable 1-3", "gene_name": "IGHV1-3", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0C4DH33-1", "protein_name": "Immunoglobulin heavy variable 1-24", "gene_name": "IGHV1-24", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0C4DH41-1", "protein_name": "Immunoglobulin heavy variable 4-61", "gene_name": "IGHV4-61", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0C4DH43-1", "protein_name": "Immunoglobulin heavy variable 2-70D", "gene_name": "IGHV2-70D", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0G2JMI3-1", "protein_name": "Immunoglobulin heavy variable 1-69-2", "gene_name": "IGHV1-69-2", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0J9YX35-1", "protein_name": "Immunoglobulin heavy variable 3-64D", "gene_name": "IGHV3-64D", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01743-1", "protein_name": "Immunoglobulin heavy variable 1-46", "gene_name": "IGHV1-46", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01854-2", "protein_name": "Immunoglobulin heavy constant epsilon", "gene_name": "IGHE", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DP01-1", "protein_name": "Immunoglobulin heavy variable 1-8", "gene_name": "IGHV1-8", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A075B6S5-1", "protein_name": "Immunoglobulin kappa variable 1-27", "gene_name": "IGKV1-27", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0A0MT76-1", "protein_name": "Immunoglobulin lambda joining 1", "gene_name": "IGLJ1", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0C4DH68-1", "protein_name": "Immunoglobulin kappa variable 2-24", "gene_name": "IGKV2-24", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0C4DH73-1", "protein_name": "Immunoglobulin kappa variable 1-12", "gene_name": "IGKV1-12", "tax_name": "Human" }, { "uniprot_canonical_ac": "A2NJV5-1", "protein_name": "Immunoglobulin kappa variable 2-29", "gene_name": "IGKV2-29", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01594-1", "protein_name": "Immunoglobulin kappa variable 1-33", "gene_name": "IGKV1-33", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04430-1", "protein_name": "Immunoglobulin kappa variable 1-16", "gene_name": "IGKV1-16", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0B4J1V7-1", "protein_name": "Probable non-functional immunoglobulin heavy variable 7-81", "gene_name": "IGHV7-81", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01857-2", "protein_name": "Immunoglobulin heavy constant gamma 1", "gene_name": "IGHG1", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0A0MS00-1", "protein_name": "Probable non-functional immunoglobulin lambda variable 3-32", "gene_name": "IGLV3-32", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0C4DH36-1", "protein_name": "Probable non-functional immunoglobulin heavy variable 3-38", "gene_name": "IGHV3-38", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0C4DH26-1", "protein_name": "Probable non-functional immunoglobulin kappa variable 6D-41", "gene_name": "IGKV6D-41", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "A0A075B6H9", "url": "https://www.uniprot.org/uniprotkb/A0A075B6H9" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "glycosylation": [ { "glytoucan_ac": "", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "icn3d_view": {}, "start_pos": 227, "start_aa": "Asn", "end_pos": 227, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn227", "evidence": [ { "id": "P01860", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P01860#ptm_processing" }, { "id": "19159218", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19159218" }, { "id": "16335952", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/16335952" }, { "id": "11406581", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/11406581" }, { "id": "20357243", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/20357243" }, { "id": "26536155", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/26536155" }, { "id": "29445378", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29445378" }, { "id": "39983994", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/39983994" }, { "id": "20176268", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/20176268" } ], "filter_code": "001000000000000000000.00010000000000.00.01000", "uniprot_canonical_ac": "P01860-2" } ], "record_id": "pubmed.20176268", "abstract": "", "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 162 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_sites", "count": 1 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "exact_sites", "count": 1 }, { "field": "exact_n_linked_sites", "count": 1 }, { "field": "fuzzy_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl", "filter_code", "uniprot_canonical_ac" ] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_sites", "count": 1 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "exact_sites", "count": 1 }, { "field": "exact_n_linked_sites", "count": 1 }, { "field": "fuzzy_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl", "filter_code", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Molecular programming of B cell memory.", "journal": "Nature reviews. Immunology", "date": "2011-12-09", "authors": "McHeyzer-Williams Michael, Okitsu Shinji, Wang Nathaniel, McHeyzer-Williams Louise", "reference": { "type": "PubMed", "id": "22158414", "url": "https://pubmed.ncbi.nlm.nih.gov/22158414" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "A0A075B6H9-1", "protein_name": "Immunoglobulin lambda variable 4-69", "gene_name": "IGLV4-69", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A075B6J6-1", "protein_name": "Immunoglobulin lambda variable 3-22", "gene_name": "IGLV3-22", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A075B6J9-1", "protein_name": "Immunoglobulin lambda variable 2-18", "gene_name": "IGLV2-18", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A075B6K0-1", "protein_name": "Immunoglobulin lambda variable 3-16", "gene_name": "IGLV3-16", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A075B6K5-1", "protein_name": "Immunoglobulin lambda variable 3-9", "gene_name": "IGLV3-9", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0A0MT89-1", "protein_name": "Immunoglobulin kappa joining 1", "gene_name": "IGKJ1", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0G2JS06-1", "protein_name": "Immunoglobulin lambda variable 5-39", "gene_name": "IGLV5-39", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01700-1", "protein_name": "Immunoglobulin lambda variable 1-47", "gene_name": "IGLV1-47", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01714-1", "protein_name": "Immunoglobulin lambda variable 3-19", "gene_name": "IGLV3-19", "tax_name": "Human" }, { "uniprot_canonical_ac": "P80748-1", "protein_name": "Immunoglobulin lambda variable 3-21", "gene_name": "IGLV3-21", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A075B6P5-1", "protein_name": "Immunoglobulin kappa variable 2-28", "gene_name": "IGKV2-28", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A075B6S4-1", "protein_name": "Immunoglobulin kappa variable 1D-17", "gene_name": "IGKV1D-17", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A075B6S6-1", "protein_name": "Immunoglobulin kappa variable 2D-30", "gene_name": "IGKV2D-30", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A087WSY6-1", "protein_name": "Immunoglobulin kappa variable 3D-15", "gene_name": "IGKV3D-15", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A087WW87-1", "protein_name": "Immunoglobulin kappa variable 2-40", "gene_name": "IGKV2-40", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0A0MRZ8-1", "protein_name": "Immunoglobulin kappa variable 3D-11", "gene_name": "IGKV3D-11", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0B4J1Z2-1", "protein_name": "Immunoglobulin kappa variable 1D-43", "gene_name": "IGKV1D-43", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0B4J2D9-1", "protein_name": "Immunoglobulin kappa variable 1D-13", "gene_name": "IGKV1D-13", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0C4DH24-1", "protein_name": "Immunoglobulin kappa variable 6-21", "gene_name": "IGKV6-21", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0C4DH25-1", "protein_name": "Immunoglobulin kappa variable 3D-20", "gene_name": "IGKV3D-20", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0C4DH55-1", "protein_name": "Immunoglobulin kappa variable 3D-7", "gene_name": "IGKV3D-7", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0C4DH69-1", "protein_name": "Immunoglobulin kappa variable 1-9", "gene_name": "IGKV1-9", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01593-1", "protein_name": "Immunoglobulin kappa variable 1D-33", "gene_name": "IGKV1D-33", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01599-1", "protein_name": "Immunoglobulin kappa variable 1-17", "gene_name": "IGKV1-17", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01601-1", "protein_name": "Immunoglobulin kappa variable 1D-16", "gene_name": "IGKV1D-16", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01611-1", "protein_name": "Immunoglobulin kappa variable 1D-12", "gene_name": "IGKV1D-12", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01615-1", "protein_name": "Immunoglobulin kappa variable 2D-28", "gene_name": "IGKV2D-28", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01619-1", "protein_name": "Immunoglobulin kappa variable 3-20", "gene_name": "IGKV3-20", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01624-1", "protein_name": "Immunoglobulin kappa variable 3-15", "gene_name": "IGKV3-15", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04433-1", "protein_name": "Immunoglobulin kappa variable 3-11", "gene_name": "IGKV3-11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DP09-1", "protein_name": "Immunoglobulin kappa variable 1-13", "gene_name": "IGKV1-13", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A087WSZ0-1", "protein_name": "Immunoglobulin kappa variable 1D-8", "gene_name": "IGKV1D-8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01602-1", "protein_name": "Immunoglobulin kappa variable 1-5", "gene_name": "IGKV1-5", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A075B6R9-1", "protein_name": "Probable non-functional immunoglobulin kappa variable 2D-24", "gene_name": "IGKV2D-24", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01871-2", "protein_name": "Immunoglobulin heavy constant mu", "gene_name": "IGHM", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0C4DH62-1", "protein_name": "Immunoglobulin heavy joining 1", "gene_name": "IGHJ1", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A075B6R2-1", "protein_name": "Immunoglobulin heavy variable 4-4", "gene_name": "IGHV4-4", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0B4J1U7-1", "protein_name": "Immunoglobulin heavy variable 6-1", "gene_name": "IGHV6-1", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0B4J1V0-1", "protein_name": "Immunoglobulin heavy variable 3-15", "gene_name": "IGHV3-15", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0J9YVY3-1", "protein_name": "Immunoglobulin heavy variable 7-4-1", "gene_name": "IGHV7-4-1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01767-1", "protein_name": "Immunoglobulin heavy variable 3-53", "gene_name": "IGHV3-53", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06331-1", "protein_name": "Immunoglobulin heavy variable 4-34", "gene_name": "IGHV4-34", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DP03-1", "protein_name": "Immunoglobulin heavy variable 3-30-5", "gene_name": "IGHV3-30-5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DP04-1", "protein_name": "Immunoglobulin heavy variable 3-43D", "gene_name": "IGHV3-43D", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DP06-1", "protein_name": "Immunoglobulin heavy variable 4-30-4", "gene_name": "IGHV4-30-4", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0A0MT36-1", "protein_name": "Immunoglobulin kappa variable 6D-21", "gene_name": "IGKV6D-21", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0C4DH67-1", "protein_name": "Immunoglobulin kappa variable 1-8", "gene_name": "IGKV1-8", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0C4DH72-1", "protein_name": "Immunoglobulin kappa variable 1-6", "gene_name": "IGKV1-6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01597-1", "protein_name": "Immunoglobulin kappa variable 1-39", "gene_name": "IGKV1-39", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06310-1", "protein_name": "Immunoglobulin kappa variable 2-30", "gene_name": "IGKV2-30", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06312-1", "protein_name": "Immunoglobulin kappa variable 4-1", "gene_name": "IGKV4-1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01614-1", "protein_name": "Immunoglobulin kappa variable 2D-40", "gene_name": "IGKV2D-40", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DOY2-1", "protein_name": "Immunoglobulin lambda constant 2", "gene_name": "IGLC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0C4DH35-1", "protein_name": "Probable non-functional immunoglobulin heavy variable 3-35", "gene_name": "IGHV3-35", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DTW3-1", "protein_name": "Probable non-functional immunoglobulin heavy variable 1-38-4", "gene_name": "IGHV1-38-4", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A075B6H7-1", "protein_name": "Probable non-functional immunoglobulin kappa variable 3-7", "gene_name": "IGKV3-7", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A087WSX0-1", "protein_name": "Immunoglobulin lambda variable 5-45", "gene_name": "IGLV5-45", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A075B6S2-1", "protein_name": "Immunoglobulin kappa variable 2D-29", "gene_name": "IGKV2D-29", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0A0MRZ7-1", "protein_name": "Immunoglobulin kappa variable 2D-26", "gene_name": "IGKV2D-26", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04432-1", "protein_name": "Immunoglobulin kappa variable 1D-39", "gene_name": "IGKV1D-39", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06315-1", "protein_name": "Immunoglobulin kappa variable 5-2", "gene_name": "IGKV5-2", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A075B6I0-1", "protein_name": "Immunoglobulin lambda variable 8-61", "gene_name": "IGLV8-61", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A075B6K2-1", "protein_name": "Immunoglobulin lambda variable 3-12", "gene_name": "IGLV3-12", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0B4J1U3-1", "protein_name": "Immunoglobulin lambda variable 1-36", "gene_name": "IGLV1-36", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01699-1", "protein_name": "Immunoglobulin lambda variable 1-44", "gene_name": "IGLV1-44", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01701-1", "protein_name": "Immunoglobulin lambda variable 1-51", "gene_name": "IGLV1-51", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01704-1", "protein_name": "Immunoglobulin lambda variable 2-14", "gene_name": "IGLV2-14", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01706-1", "protein_name": "Immunoglobulin lambda variable 2-11", "gene_name": "IGLV2-11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01709-1", "protein_name": "Immunoglobulin lambda variable 2-8", "gene_name": "IGLV2-8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01717-1", "protein_name": "Immunoglobulin lambda variable 3-25", "gene_name": "IGLV3-25", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01721-1", "protein_name": "Immunoglobulin lambda variable 6-57", "gene_name": "IGLV6-57", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A075B6K4-1", "protein_name": "Immunoglobulin lambda variable 3-10", "gene_name": "IGLV3-10", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A075B6K6-1", "protein_name": "Immunoglobulin lambda variable 4-3", "gene_name": "IGLV4-3", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0A0MRZ9-1", "protein_name": "Immunoglobulin lambda variable 5-52", "gene_name": "IGLV5-52", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0B4J1Y8-1", "protein_name": "Immunoglobulin lambda variable 9-49", "gene_name": "IGLV9-49", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01703-1", "protein_name": "Immunoglobulin lambda variable 1-40", "gene_name": "IGLV1-40", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01705-1", "protein_name": "Immunoglobulin lambda variable 2-23", "gene_name": "IGLV2-23", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01715-1", "protein_name": "Immunoglobulin lambda variable 3-1", "gene_name": "IGLV3-1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01718-1", "protein_name": "Immunoglobulin lambda variable 3-27", "gene_name": "IGLV3-27", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04211-1", "protein_name": "Immunoglobulin lambda variable 7-43", "gene_name": "IGLV7-43", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A075B6S9-1", "protein_name": "Probable non-functional immunoglobulin kappa variable 1-37", "gene_name": "IGKV1-37", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A075B6I4-1", "protein_name": "Immunoglobulin lambda variable 10-54", "gene_name": "IGLV10-54", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01860-2", "protein_name": "Immunoglobulin heavy constant gamma 3", "gene_name": "IGHG3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01861-2", "protein_name": "Immunoglobulin heavy constant gamma 4", "gene_name": "IGHG4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01876-2", "protein_name": "Immunoglobulin heavy constant alpha 1", "gene_name": "IGHA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01880-2", "protein_name": "Immunoglobulin heavy constant delta", "gene_name": "IGHD", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CF74-1", "protein_name": "Immunoglobulin lambda constant 6", "gene_name": "IGLC6", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A075B6I1-1", "protein_name": "Immunoglobulin lambda variable 4-60", "gene_name": "IGLV4-60", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A075B6I9-1", "protein_name": "Immunoglobulin lambda variable 7-46", "gene_name": "IGLV7-46", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A075B6J1-1", "protein_name": "Immunoglobulin lambda variable 5-37", "gene_name": "IGLV5-37", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A075B6H8-1", "protein_name": "Probable non-functional immunoglobulin kappa variable 1D-42", "gene_name": "IGKV1D-42", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0C4DH30-1", "protein_name": "Probable non-functional immunoglobulin heavy variable 3-16", "gene_name": "IGHV3-16", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A075B6J2-1", "protein_name": "Probable non-functional immunoglobulin lambda variable 2-33", "gene_name": "IGLV2-33", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DSN7-1", "protein_name": "Probable non-functional immunoglobulin kappa variable 1D-37", "gene_name": "IGKV1D-37", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DTE2-1", "protein_name": "Probable non-functional immunoglobulin heavy variable 8-51-1", "gene_name": "IGHV8-51-1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DTE1-1", "protein_name": "Probable non-functional immunoglobulin heavy variable 3-38-3", "gene_name": "IGHV3-38-3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01825-1", "protein_name": "Immunoglobulin heavy variable 4-59", "gene_name": "IGHV4-59", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DOY5-1", "protein_name": "Immunoglobulin heavy diversity 1-1", "gene_name": "IGHD1-1", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0A0MS15-1", "protein_name": "Immunoglobulin heavy variable 3-49", "gene_name": "IGHV3-49", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0B4J1X8-1", "protein_name": "Immunoglobulin heavy variable 3-43", "gene_name": "IGHV3-43", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0B4J1Y9-1", "protein_name": "Immunoglobulin heavy variable 3-72", "gene_name": "IGHV3-72", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0C4DH34-1", "protein_name": "Immunoglobulin heavy variable 4-28", "gene_name": "IGHV4-28", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0C4DH38-1", "protein_name": "Immunoglobulin heavy variable 5-51", "gene_name": "IGHV5-51", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0C4DH39-1", "protein_name": "Immunoglobulin heavy variable 1-58", "gene_name": "IGHV1-58", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0C4DH42-1", "protein_name": "Immunoglobulin heavy variable 3-66", "gene_name": "IGHV3-66", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01817-1", "protein_name": "Immunoglobulin heavy variable 2-5", "gene_name": "IGHV2-5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01824-1", "protein_name": "Immunoglobulin heavy variable 4-39", "gene_name": "IGHV4-39", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DP07-1", "protein_name": "Immunoglobulin heavy variable 4-31", "gene_name": "IGHV4-31", "tax_name": "Human" }, { "uniprot_canonical_ac": "P23083-1", "protein_name": "Immunoglobulin heavy variable 1-2", "gene_name": "IGHV1-2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01742-1", "protein_name": "Immunoglobulin heavy variable 1-69", "gene_name": "IGHV1-69", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01768-1", "protein_name": "Immunoglobulin heavy variable 3-30", "gene_name": "IGHV3-30", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01814-1", "protein_name": "Immunoglobulin heavy variable 2-70", "gene_name": "IGHV2-70", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01772-1", "protein_name": "Immunoglobulin heavy variable 3-33", "gene_name": "IGHV3-33", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A075B6Q5-1", "protein_name": "Immunoglobulin heavy variable 3-64", "gene_name": "IGHV3-64", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A087WSY4-1", "protein_name": "Immunoglobulin heavy variable 4-30-2", "gene_name": "IGHV4-30-2", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0B4J1V1-1", "protein_name": "Immunoglobulin heavy variable 3-21", "gene_name": "IGHV3-21", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0B4J1V2-1", "protein_name": "Immunoglobulin heavy variable 2-26", "gene_name": "IGHV2-26", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0B4J1V6-1", "protein_name": "Immunoglobulin heavy variable 3-73", "gene_name": "IGHV3-73", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0B4J1X5-1", "protein_name": "Immunoglobulin heavy variable 3-74", "gene_name": "IGHV3-74", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0B4J2H0-1", "protein_name": "Immunoglobulin heavy variable 1-69D", "gene_name": "IGHV1-69D", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0C4DH31-1", "protein_name": "Immunoglobulin heavy variable 1-18", "gene_name": "IGHV1-18", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0C4DH32-1", "protein_name": "Immunoglobulin heavy variable 3-20", "gene_name": "IGHV3-20", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0J9YXX1-1", "protein_name": "Immunoglobulin heavy variable 5-10-1", "gene_name": "IGHV5-10-1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01762-1", "protein_name": "Immunoglobulin heavy variable 3-11", "gene_name": "IGHV3-11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01763-1", "protein_name": "Immunoglobulin heavy variable 3-48", "gene_name": "IGHV3-48", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01764-1", "protein_name": "Immunoglobulin heavy variable 3-23", "gene_name": "IGHV3-23", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01766-1", "protein_name": "Immunoglobulin heavy variable 3-13", "gene_name": "IGHV3-13", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01780-1", "protein_name": "Immunoglobulin heavy variable 3-7", "gene_name": "IGHV3-7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01782-1", "protein_name": "Immunoglobulin heavy variable 3-9", "gene_name": "IGHV3-9", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DP02-1", "protein_name": "Immunoglobulin heavy variable 3-30-3", "gene_name": "IGHV3-30-3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DP08-1", "protein_name": "Immunoglobulin heavy variable 4-38-2", "gene_name": "IGHV4-38-2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01877-2", "protein_name": "Immunoglobulin heavy constant alpha 2", "gene_name": "IGHA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0M8Q6-1", "protein_name": "Immunoglobulin lambda constant 7", "gene_name": "IGLC7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01834-1", "protein_name": "Immunoglobulin kappa constant", "gene_name": "IGKC", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01859-2", "protein_name": "Immunoglobulin heavy constant gamma 2", "gene_name": "IGHG2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG04-1", "protein_name": "Immunoglobulin lambda constant 1", "gene_name": "IGLC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DOY3-1", "protein_name": "Immunoglobulin lambda constant 3", "gene_name": "IGLC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A075B6I7-1", "protein_name": "Probable non-functional immunoglobulin lambda variable 5-48", "gene_name": "IGLV5-48", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A075B6I3-1", "protein_name": "Probable non-functional immunoglobulin lambda variable 11-55", "gene_name": "IGLV11-55", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A075B6I6-1", "protein_name": "Probable non-functional immunoglobulin lambda variable 1-50", "gene_name": "IGLV1-50", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0A0MS14-1", "protein_name": "Immunoglobulin heavy variable 1-45", "gene_name": "IGHV1-45", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0C4DH29-1", "protein_name": "Immunoglobulin heavy variable 1-3", "gene_name": "IGHV1-3", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0C4DH33-1", "protein_name": "Immunoglobulin heavy variable 1-24", "gene_name": "IGHV1-24", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0C4DH41-1", "protein_name": "Immunoglobulin heavy variable 4-61", "gene_name": "IGHV4-61", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0C4DH43-1", "protein_name": "Immunoglobulin heavy variable 2-70D", "gene_name": "IGHV2-70D", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0G2JMI3-1", "protein_name": "Immunoglobulin heavy variable 1-69-2", "gene_name": "IGHV1-69-2", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0J9YX35-1", "protein_name": "Immunoglobulin heavy variable 3-64D", "gene_name": "IGHV3-64D", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01743-1", "protein_name": "Immunoglobulin heavy variable 1-46", "gene_name": "IGHV1-46", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01854-2", "protein_name": "Immunoglobulin heavy constant epsilon", "gene_name": "IGHE", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DP01-1", "protein_name": "Immunoglobulin heavy variable 1-8", "gene_name": "IGHV1-8", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A075B6S5-1", "protein_name": "Immunoglobulin kappa variable 1-27", "gene_name": "IGKV1-27", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0A0MT76-1", "protein_name": "Immunoglobulin lambda joining 1", "gene_name": "IGLJ1", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0C4DH68-1", "protein_name": "Immunoglobulin kappa variable 2-24", "gene_name": "IGKV2-24", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0C4DH73-1", "protein_name": "Immunoglobulin kappa variable 1-12", "gene_name": "IGKV1-12", "tax_name": "Human" }, { "uniprot_canonical_ac": "A2NJV5-1", "protein_name": "Immunoglobulin kappa variable 2-29", "gene_name": "IGKV2-29", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01594-1", "protein_name": "Immunoglobulin kappa variable 1-33", "gene_name": "IGKV1-33", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04430-1", "protein_name": "Immunoglobulin kappa variable 1-16", "gene_name": "IGKV1-16", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0B4J1V7-1", "protein_name": "Probable non-functional immunoglobulin heavy variable 7-81", "gene_name": "IGHV7-81", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01857-2", "protein_name": "Immunoglobulin heavy constant gamma 1", "gene_name": "IGHG1", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0A0MS00-1", "protein_name": "Probable non-functional immunoglobulin lambda variable 3-32", "gene_name": "IGLV3-32", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0C4DH36-1", "protein_name": "Probable non-functional immunoglobulin heavy variable 3-38", "gene_name": "IGHV3-38", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0C4DH26-1", "protein_name": "Probable non-functional immunoglobulin kappa variable 6D-41", "gene_name": "IGKV6D-41", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "A0A075B6H9", "url": "https://www.uniprot.org/uniprotkb/A0A075B6H9" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.22158414", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 162 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Immunoglobulin and T Cell Receptor Genes: IMGT(\u00ae) and the Birth and Rise of Immunoinformatics.", "journal": "Frontiers in immunology", "date": "2014", "authors": "Lefranc Marie-Paule", "reference": { "type": "PubMed", "id": "24600447", "url": "https://pubmed.ncbi.nlm.nih.gov/24600447" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "A0A075B6H9-1", "protein_name": "Immunoglobulin lambda variable 4-69", "gene_name": "IGLV4-69", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A075B6J6-1", "protein_name": "Immunoglobulin lambda variable 3-22", "gene_name": "IGLV3-22", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A075B6J9-1", "protein_name": "Immunoglobulin lambda variable 2-18", "gene_name": "IGLV2-18", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A075B6K0-1", "protein_name": "Immunoglobulin lambda variable 3-16", "gene_name": "IGLV3-16", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A075B6K5-1", "protein_name": "Immunoglobulin lambda variable 3-9", "gene_name": "IGLV3-9", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0A0MT89-1", "protein_name": "Immunoglobulin kappa joining 1", "gene_name": "IGKJ1", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0G2JS06-1", "protein_name": "Immunoglobulin lambda variable 5-39", "gene_name": "IGLV5-39", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01700-1", "protein_name": "Immunoglobulin lambda variable 1-47", "gene_name": "IGLV1-47", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01714-1", "protein_name": "Immunoglobulin lambda variable 3-19", "gene_name": "IGLV3-19", "tax_name": "Human" }, { "uniprot_canonical_ac": "P80748-1", "protein_name": "Immunoglobulin lambda variable 3-21", "gene_name": "IGLV3-21", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A075B6P5-1", "protein_name": "Immunoglobulin kappa variable 2-28", "gene_name": "IGKV2-28", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A075B6S4-1", "protein_name": "Immunoglobulin kappa variable 1D-17", "gene_name": "IGKV1D-17", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A075B6S6-1", "protein_name": "Immunoglobulin kappa variable 2D-30", "gene_name": "IGKV2D-30", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A087WSY6-1", "protein_name": "Immunoglobulin kappa variable 3D-15", "gene_name": "IGKV3D-15", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A087WW87-1", "protein_name": "Immunoglobulin kappa variable 2-40", "gene_name": "IGKV2-40", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0A0MRZ8-1", "protein_name": "Immunoglobulin kappa variable 3D-11", "gene_name": "IGKV3D-11", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0B4J1Z2-1", "protein_name": "Immunoglobulin kappa variable 1D-43", "gene_name": "IGKV1D-43", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0B4J2D9-1", "protein_name": "Immunoglobulin kappa variable 1D-13", "gene_name": "IGKV1D-13", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0C4DH24-1", "protein_name": "Immunoglobulin kappa variable 6-21", "gene_name": "IGKV6-21", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0C4DH25-1", "protein_name": "Immunoglobulin kappa variable 3D-20", "gene_name": "IGKV3D-20", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0C4DH55-1", "protein_name": "Immunoglobulin kappa variable 3D-7", "gene_name": "IGKV3D-7", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0C4DH69-1", "protein_name": "Immunoglobulin kappa variable 1-9", "gene_name": "IGKV1-9", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01593-1", "protein_name": "Immunoglobulin kappa variable 1D-33", "gene_name": "IGKV1D-33", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01599-1", "protein_name": "Immunoglobulin kappa variable 1-17", "gene_name": "IGKV1-17", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01601-1", "protein_name": "Immunoglobulin kappa variable 1D-16", "gene_name": "IGKV1D-16", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01611-1", "protein_name": "Immunoglobulin kappa variable 1D-12", "gene_name": "IGKV1D-12", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01615-1", "protein_name": "Immunoglobulin kappa variable 2D-28", "gene_name": "IGKV2D-28", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01619-1", "protein_name": "Immunoglobulin kappa variable 3-20", "gene_name": "IGKV3-20", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01624-1", "protein_name": "Immunoglobulin kappa variable 3-15", "gene_name": "IGKV3-15", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04433-1", "protein_name": "Immunoglobulin kappa variable 3-11", "gene_name": "IGKV3-11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DP09-1", "protein_name": "Immunoglobulin kappa variable 1-13", "gene_name": "IGKV1-13", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A087WSZ0-1", "protein_name": "Immunoglobulin kappa variable 1D-8", "gene_name": "IGKV1D-8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01602-1", "protein_name": "Immunoglobulin kappa variable 1-5", "gene_name": "IGKV1-5", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A5B0-1", "protein_name": "T cell receptor beta variable 14", "gene_name": "TRBV14", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A075B6S0-1", "protein_name": "T cell receptor gamma joining 1", "gene_name": "TRGJ1", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0J9YXY3-1", "protein_name": "T cell receptor beta variable 6-2", "gene_name": "TRBV6-2", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0K0K1A5-1", "protein_name": "T cell receptor beta variable 6-5", "gene_name": "TRBV6-5", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A539-1", "protein_name": "T cell receptor beta variable 4-2", "gene_name": "TRBV4-2", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0K0K1G6-1", "protein_name": "T cell receptor beta variable 10-3", "gene_name": "TRBV10-3", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0A0MT70-1", "protein_name": "T cell receptor beta joining 2-6", "gene_name": "TRBJ2-6", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A075B6W5-1", "protein_name": "T cell receptor alpha variable 23/delta variable 6", "gene_name": "TRAV23DV6", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0B4J238-1", "protein_name": "T cell receptor alpha variable 1-2", "gene_name": "TRAV1-2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DPR3-1", "protein_name": "T cell receptor delta diversity 1", "gene_name": "TRDD1", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A075B6R9-1", "protein_name": "Probable non-functional immunoglobulin kappa variable 2D-24", "gene_name": "IGKV2D-24", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0A6YYJ7-1", "protein_name": "T cell receptor alpha variable 8-3", "gene_name": "TRAV8-3", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0B4J244-1", "protein_name": "T cell receptor alpha variable 3", "gene_name": "TRAV3", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0B4J274-1", "protein_name": "T cell receptor alpha variable 20", "gene_name": "TRAV20", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0B4J275-1", "protein_name": "T cell receptor alpha variable 17", "gene_name": "TRAV17", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A075B6N4-1", "protein_name": "T cell receptor beta variable 25-1", "gene_name": "TRBV25-1", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0B4J264-1", "protein_name": "T cell receptor alpha variable 38-1", "gene_name": "TRAV38-1", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0A0MS03-1", "protein_name": "Probable non-functional T cell receptor beta variable 5-3", "gene_name": "TRBV5-3", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A1B0GX49-1", "protein_name": "T cell receptor beta variable 6-4", "gene_name": "TRBV6-4", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0B4J271-1", "protein_name": "T cell receptor alpha variable 12-3", "gene_name": "TRAV12-3", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0A6YYK6-1", "protein_name": "T cell receptor alpha variable 16", "gene_name": "TRAV16", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0B4J235-1", "protein_name": "T cell receptor alpha variable 13-2", "gene_name": "TRAV13-2", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A075B6Y3-1", "protein_name": "T cell receptor alpha joining 3", "gene_name": "TRAJ3", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0C4DH62-1", "protein_name": "Immunoglobulin heavy joining 1", "gene_name": "IGHJ1", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A075B6R2-1", "protein_name": "Immunoglobulin heavy variable 4-4", "gene_name": "IGHV4-4", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0B4J1U7-1", "protein_name": "Immunoglobulin heavy variable 6-1", "gene_name": "IGHV6-1", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0B4J1V0-1", "protein_name": "Immunoglobulin heavy variable 3-15", "gene_name": "IGHV3-15", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0J9YVY3-1", "protein_name": "Immunoglobulin heavy variable 7-4-1", "gene_name": "IGHV7-4-1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01767-1", "protein_name": "Immunoglobulin heavy variable 3-53", "gene_name": "IGHV3-53", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06331-1", "protein_name": "Immunoglobulin heavy variable 4-34", "gene_name": "IGHV4-34", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DP03-1", "protein_name": "Immunoglobulin heavy variable 3-30-5", "gene_name": "IGHV3-30-5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DP04-1", "protein_name": "Immunoglobulin heavy variable 3-43D", "gene_name": "IGHV3-43D", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DP06-1", "protein_name": "Immunoglobulin heavy variable 4-30-4", "gene_name": "IGHV4-30-4", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0A0MT36-1", "protein_name": "Immunoglobulin kappa variable 6D-21", "gene_name": "IGKV6D-21", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0C4DH67-1", "protein_name": "Immunoglobulin kappa variable 1-8", "gene_name": "IGKV1-8", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0C4DH72-1", "protein_name": "Immunoglobulin kappa variable 1-6", "gene_name": "IGKV1-6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01597-1", "protein_name": "Immunoglobulin kappa variable 1-39", "gene_name": "IGKV1-39", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06310-1", "protein_name": "Immunoglobulin kappa variable 2-30", "gene_name": "IGKV2-30", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06312-1", "protein_name": "Immunoglobulin kappa variable 4-1", "gene_name": "IGKV4-1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01614-1", "protein_name": "Immunoglobulin kappa variable 2D-40", "gene_name": "IGKV2D-40", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0A6YYC5-1", "protein_name": "T cell receptor alpha variable 14/delta variable 4", "gene_name": "TRAV14DV4", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A087WT01-1", "protein_name": "T cell receptor alpha variable 27", "gene_name": "TRAV27", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0B4J241-1", "protein_name": "T cell receptor alpha variable 13-1", "gene_name": "TRAV13-1", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0A0MT78-1", "protein_name": "T cell receptor beta joining 2-7", "gene_name": "TRBJ2-7", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0A0MS05-1", "protein_name": "Probable non-functional T cell receptor beta variable 5-7", "gene_name": "TRBV5-7", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0C4DH35-1", "protein_name": "Probable non-functional immunoglobulin heavy variable 3-35", "gene_name": "IGHV3-35", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0J9YXG5-1", "protein_name": "T cell receptor beta joining 1-4", "gene_name": "TRBJ1-4", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A5A2-1", "protein_name": "T cell receptor beta variable 5-8", "gene_name": "TRBV5-8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DTW3-1", "protein_name": "Probable non-functional immunoglobulin heavy variable 1-38-4", "gene_name": "IGHV1-38-4", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0A0MS02-1", "protein_name": "Probable non-functional T cell receptor gamma variable", "gene_name": "TRGV1", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A075B6U4-1", "protein_name": "T cell receptor alpha variable 7", "gene_name": "TRAV7", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A075B6X5-1", "protein_name": "T cell receptor alpha variable 18", "gene_name": "TRAV18", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A075B6H7-1", "protein_name": "Probable non-functional immunoglobulin kappa variable 3-7", "gene_name": "IGKV3-7", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0B4J276-1", "protein_name": "T cell receptor alpha variable 25", "gene_name": "TRAV25", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A075B6R0-1", "protein_name": "T cell receptor gamma variable 2", "gene_name": "TRGV2", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0B4J249-1", "protein_name": "T cell receptor alpha variable 5", "gene_name": "TRAV5", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0A6YYG2-1", "protein_name": "T cell receptor beta variable 6-6", "gene_name": "TRBV6-6", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A075B6Y9-1", "protein_name": "T cell receptor alpha joining 42", "gene_name": "TRAJ42", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0B4J280-1", "protein_name": "T cell receptor alpha variable 40", "gene_name": "TRAV40", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0B4J262-1", "protein_name": "T cell receptor alpha variable 8-6", "gene_name": "TRAV8-6", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A075B6T7-1", "protein_name": "T cell receptor alpha variable 6", "gene_name": "TRAV6", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A1B0GX51-1", "protein_name": "T cell receptor beta variable 7-8", "gene_name": "TRBV7-8", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0B4J240-1", "protein_name": "T cell receptor alpha variable 10", "gene_name": "TRAV10", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A075B6N1-1", "protein_name": "T cell receptor beta variable 19", "gene_name": "TRBV19", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0B4J234-1", "protein_name": "T cell receptor alpha variable 2", "gene_name": "TRAV2", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A087WSX0-1", "protein_name": "Immunoglobulin lambda variable 5-45", "gene_name": "IGLV5-45", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A075B6S2-1", "protein_name": "Immunoglobulin kappa variable 2D-29", "gene_name": "IGKV2D-29", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0A0MRZ7-1", "protein_name": "Immunoglobulin kappa variable 2D-26", "gene_name": "IGKV2D-26", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04432-1", "protein_name": "Immunoglobulin kappa variable 1D-39", "gene_name": "IGKV1D-39", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06315-1", "protein_name": "Immunoglobulin kappa variable 5-2", "gene_name": "IGKV5-2", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A075B6I0-1", "protein_name": "Immunoglobulin lambda variable 8-61", "gene_name": "IGLV8-61", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A075B6K2-1", "protein_name": "Immunoglobulin lambda variable 3-12", "gene_name": "IGLV3-12", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0B4J1U3-1", "protein_name": "Immunoglobulin lambda variable 1-36", "gene_name": "IGLV1-36", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01699-1", "protein_name": "Immunoglobulin lambda variable 1-44", "gene_name": "IGLV1-44", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01701-1", "protein_name": "Immunoglobulin lambda variable 1-51", "gene_name": "IGLV1-51", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01704-1", "protein_name": "Immunoglobulin lambda variable 2-14", "gene_name": "IGLV2-14", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01706-1", "protein_name": "Immunoglobulin lambda variable 2-11", "gene_name": "IGLV2-11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01709-1", "protein_name": "Immunoglobulin lambda variable 2-8", "gene_name": "IGLV2-8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01717-1", "protein_name": "Immunoglobulin lambda variable 3-25", "gene_name": "IGLV3-25", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01721-1", "protein_name": "Immunoglobulin lambda variable 6-57", "gene_name": "IGLV6-57", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A075B6K4-1", "protein_name": "Immunoglobulin lambda variable 3-10", "gene_name": "IGLV3-10", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A075B6K6-1", "protein_name": "Immunoglobulin lambda variable 4-3", "gene_name": "IGLV4-3", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0A0MRZ9-1", "protein_name": "Immunoglobulin lambda variable 5-52", "gene_name": "IGLV5-52", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0B4J1Y8-1", "protein_name": "Immunoglobulin lambda variable 9-49", "gene_name": "IGLV9-49", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01703-1", "protein_name": "Immunoglobulin lambda variable 1-40", "gene_name": "IGLV1-40", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01705-1", "protein_name": "Immunoglobulin lambda variable 2-23", "gene_name": "IGLV2-23", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01715-1", "protein_name": "Immunoglobulin lambda variable 3-1", "gene_name": "IGLV3-1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01718-1", "protein_name": "Immunoglobulin lambda variable 3-27", "gene_name": "IGLV3-27", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04211-1", "protein_name": "Immunoglobulin lambda variable 7-43", "gene_name": "IGLV7-43", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A075B6S9-1", "protein_name": "Probable non-functional immunoglobulin kappa variable 1-37", "gene_name": "IGKV1-37", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0JD36-1", "protein_name": "T cell receptor delta variable 2", "gene_name": "TRDV2", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0K0K1C4-1", "protein_name": "T cell receptor beta variable 27", "gene_name": "TRBV27", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0K0K1G8-1", "protein_name": "T cell receptor beta variable 10-2", "gene_name": "TRBV10-2", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A576-1", "protein_name": "T cell receptor beta variable 3-1", "gene_name": "TRBV3-1", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A087WV62-1", "protein_name": "T cell receptor beta variable 16", "gene_name": "TRBV16", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A597-1", "protein_name": "T cell receptor beta variable 5-5", "gene_name": "TRBV5-5", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A075B6I4-1", "protein_name": "Immunoglobulin lambda variable 10-54", "gene_name": "IGLV10-54", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A075B6I1-1", "protein_name": "Immunoglobulin lambda variable 4-60", "gene_name": "IGLV4-60", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A075B6I9-1", "protein_name": "Immunoglobulin lambda variable 7-46", "gene_name": "IGLV7-46", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A075B6J1-1", "protein_name": "Immunoglobulin lambda variable 5-37", "gene_name": "IGLV5-37", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01737-1", "protein_name": "T cell receptor alpha variable 8-4", "gene_name": "TRAV8-4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04437-1", "protein_name": "T cell receptor alpha variable 29/delta variable 5", "gene_name": "TRAV29DV5", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A087X0M5-1", "protein_name": "T cell receptor beta variable 18", "gene_name": "TRBV18", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0B4J265-1", "protein_name": "T cell receptor alpha variable 26-2", "gene_name": "TRAV26-2", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A075B700-1", "protein_name": "T cell receptor alpha joining 31", "gene_name": "TRAJ31", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A584-1", "protein_name": "T cell receptor beta variable 11-2", "gene_name": "TRBV11-2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DPF4-1", "protein_name": "T cell receptor alpha variable 35", "gene_name": "TRAV35", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DPF7-1", "protein_name": "T cell receptor beta variable 6-3", "gene_name": "TRBV6-3", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0B4J272-1", "protein_name": "T cell receptor alpha variable 24", "gene_name": "TRAV24", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A075B6N2-1", "protein_name": "T cell receptor beta variable 20-1", "gene_name": "TRBV20-1", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0C4DH28-1", "protein_name": "T cell receptor gamma variable 4", "gene_name": "TRGV4", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0J9YX75-1", "protein_name": "T cell receptor beta variable 6-9", "gene_name": "TRBV6-9", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0A6YYK1-1", "protein_name": "T cell receptor alpha variable 8-1", "gene_name": "TRAV8-1", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A075B6V5-1", "protein_name": "T cell receptor alpha variable 36/delta variable 7", "gene_name": "TRAV36DV7", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0B4J266-1", "protein_name": "T cell receptor alpha variable 41", "gene_name": "TRAV41", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0A6YYK7-1", "protein_name": "T cell receptor alpha variable 19", "gene_name": "TRAV19", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0C4DH59-1", "protein_name": "T cell receptor beta variable 5-4", "gene_name": "TRBV5-4", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A075B6H8-1", "protein_name": "Probable non-functional immunoglobulin kappa variable 1D-42", "gene_name": "IGKV1D-42", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A075B6L6-1", "protein_name": "Probable non-functional T cell receptor beta variable 7-3", "gene_name": "TRBV7-3", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0B4J273-1", "protein_name": "T cell receptor alpha variable 34", "gene_name": "TRAV34", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A1B0GX56-1", "protein_name": "T cell receptor delta variable 1", "gene_name": "TRDV1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04435-1", "protein_name": "T cell receptor beta variable 7-9", "gene_name": "TRBV7-9", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01733-1", "protein_name": "T cell receptor beta variable 12-3", "gene_name": "TRBV12-3", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0A0MS06-1", "protein_name": "Probable non-functional T cell receptor beta variable 23-1", "gene_name": "TRBV23-1", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A599-1", "protein_name": "T cell receptor beta variable 5-6", "gene_name": "TRBV5-6", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0C4DH30-1", "protein_name": "Probable non-functional immunoglobulin heavy variable 3-16", "gene_name": "IGHV3-16", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A577-1", "protein_name": "T cell receptor beta variable 4-1", "gene_name": "TRBV4-1", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0A0MT94-1", "protein_name": "T cell receptor beta joining 2-2", "gene_name": "TRBJ2-2", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0A0MT87-1", "protein_name": "T cell receptor beta joining 2-4", "gene_name": "TRBJ2-4", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0A6YYK4-1", "protein_name": "Probable non-functional T cell receptor beta variable 7-1", "gene_name": "TRBV7-1", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0A0MS04-1", "protein_name": "Probable non-functional T cell receptor beta variable 6-7", "gene_name": "TRBV6-7", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0JD37-1", "protein_name": "T cell receptor delta variable 3", "gene_name": "TRDV3", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0J9YWP8-1", "protein_name": "T cell receptor beta joining 1-3", "gene_name": "TRBJ1-3", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A075B6J2-1", "protein_name": "Probable non-functional immunoglobulin lambda variable 2-33", "gene_name": "IGLV2-33", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A087X0K7-1", "protein_name": "Probable non-functional T cell receptor beta variable 17", "gene_name": "TRBV17", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0A0MTA7-1", "protein_name": "T cell receptor beta joining 2-1", "gene_name": "TRBJ2-1", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0B4J200-1", "protein_name": "T cell receptor beta joining 2-3", "gene_name": "TRBJ2-3", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0J9YXM7-1", "protein_name": "T cell receptor beta joining 1-5", "gene_name": "TRBJ1-5", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0JD32-1", "protein_name": "T cell receptor alpha variable 38-2/delta variable 8", "gene_name": "TRAV38-2DV8", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A589-1", "protein_name": "T cell receptor beta variable 4-3", "gene_name": "TRBV4-3", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A5A6-1", "protein_name": "T cell receptor beta variable 11-3", "gene_name": "TRBV11-3", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0B4J268-1", "protein_name": "T cell receptor alpha variable 4", "gene_name": "TRAV4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DSN7-1", "protein_name": "Probable non-functional immunoglobulin kappa variable 1D-37", "gene_name": "IGKV1D-37", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DTE2-1", "protein_name": "Probable non-functional immunoglobulin heavy variable 8-51-1", "gene_name": "IGHV8-51-1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DTE1-1", "protein_name": "Probable non-functional immunoglobulin heavy variable 3-38-3", "gene_name": "IGHV3-38-3", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0B4J1U6-1", "protein_name": "T cell receptor beta variable 9", "gene_name": "TRBV9", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0B4J245-1", "protein_name": "T cell receptor alpha variable 12-1", "gene_name": "TRAV12-1", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0C4DH27-1", "protein_name": "T cell receptor gamma variable 8", "gene_name": "TRGV8", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0A6YYG3-1", "protein_name": "T cell receptor beta variable 6-8", "gene_name": "TRBV6-8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01825-1", "protein_name": "Immunoglobulin heavy variable 4-59", "gene_name": "IGHV4-59", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DOY5-1", "protein_name": "Immunoglobulin heavy diversity 1-1", "gene_name": "IGHD1-1", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0A0MS15-1", "protein_name": "Immunoglobulin heavy variable 3-49", "gene_name": "IGHV3-49", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0B4J1X8-1", "protein_name": "Immunoglobulin heavy variable 3-43", "gene_name": "IGHV3-43", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0B4J1Y9-1", "protein_name": "Immunoglobulin heavy variable 3-72", "gene_name": "IGHV3-72", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0C4DH34-1", "protein_name": "Immunoglobulin heavy variable 4-28", "gene_name": "IGHV4-28", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0C4DH38-1", "protein_name": "Immunoglobulin heavy variable 5-51", "gene_name": "IGHV5-51", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0C4DH39-1", "protein_name": "Immunoglobulin heavy variable 1-58", "gene_name": "IGHV1-58", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0C4DH42-1", "protein_name": "Immunoglobulin heavy variable 3-66", "gene_name": "IGHV3-66", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01817-1", "protein_name": "Immunoglobulin heavy variable 2-5", "gene_name": "IGHV2-5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01824-1", "protein_name": "Immunoglobulin heavy variable 4-39", "gene_name": "IGHV4-39", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DP07-1", "protein_name": "Immunoglobulin heavy variable 4-31", "gene_name": "IGHV4-31", "tax_name": "Human" }, { "uniprot_canonical_ac": "P23083-1", "protein_name": "Immunoglobulin heavy variable 1-2", "gene_name": "IGHV1-2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01742-1", "protein_name": "Immunoglobulin heavy variable 1-69", "gene_name": "IGHV1-69", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01768-1", "protein_name": "Immunoglobulin heavy variable 3-30", "gene_name": "IGHV3-30", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01814-1", "protein_name": "Immunoglobulin heavy variable 2-70", "gene_name": "IGHV2-70", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01772-1", "protein_name": "Immunoglobulin heavy variable 3-33", "gene_name": "IGHV3-33", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A075B6Q5-1", "protein_name": "Immunoglobulin heavy variable 3-64", "gene_name": "IGHV3-64", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A087WSY4-1", "protein_name": "Immunoglobulin heavy variable 4-30-2", "gene_name": "IGHV4-30-2", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0B4J1V1-1", "protein_name": "Immunoglobulin heavy variable 3-21", "gene_name": "IGHV3-21", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0B4J1V2-1", "protein_name": "Immunoglobulin heavy variable 2-26", "gene_name": "IGHV2-26", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0B4J1V6-1", "protein_name": "Immunoglobulin heavy variable 3-73", "gene_name": "IGHV3-73", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0B4J1X5-1", "protein_name": "Immunoglobulin heavy variable 3-74", "gene_name": "IGHV3-74", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0B4J2H0-1", "protein_name": "Immunoglobulin heavy variable 1-69D", "gene_name": "IGHV1-69D", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0C4DH31-1", "protein_name": "Immunoglobulin heavy variable 1-18", "gene_name": "IGHV1-18", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0C4DH32-1", "protein_name": "Immunoglobulin heavy variable 3-20", "gene_name": "IGHV3-20", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0J9YXX1-1", "protein_name": "Immunoglobulin heavy variable 5-10-1", "gene_name": "IGHV5-10-1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01762-1", "protein_name": "Immunoglobulin heavy variable 3-11", "gene_name": "IGHV3-11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01763-1", "protein_name": "Immunoglobulin heavy variable 3-48", "gene_name": "IGHV3-48", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01764-1", "protein_name": "Immunoglobulin heavy variable 3-23", "gene_name": "IGHV3-23", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01766-1", "protein_name": "Immunoglobulin heavy variable 3-13", "gene_name": "IGHV3-13", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01780-1", "protein_name": "Immunoglobulin heavy variable 3-7", "gene_name": "IGHV3-7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01782-1", "protein_name": "Immunoglobulin heavy variable 3-9", "gene_name": "IGHV3-9", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DP02-1", "protein_name": "Immunoglobulin heavy variable 3-30-3", "gene_name": "IGHV3-30-3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DP08-1", "protein_name": "Immunoglobulin heavy variable 4-38-2", "gene_name": "IGHV4-38-2", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0A6YYD4-1", "protein_name": "T cell receptor beta variable 13", "gene_name": "TRBV13", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0J9YX06-1", "protein_name": "T cell receptor beta joining 1-2", "gene_name": "TRBJ1-2", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0K0K1D8-1", "protein_name": "T cell receptor beta variable 6-1", "gene_name": "TRBV6-1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99603-1", "protein_name": "T cell receptor gamma variable 9", "gene_name": "TRGV9", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A5B7-1", "protein_name": "T cell receptor beta variable 29-1", "gene_name": "TRBV29-1", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0J9YWX3-1", "protein_name": "T cell receptor beta joining 1-6", "gene_name": "TRBJ1-6", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A087WSZ9-1", "protein_name": "T cell receptor alpha variable 30", "gene_name": "TRAV30", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A5B9-1", "protein_name": "T cell receptor beta constant 2", "gene_name": "TRBC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01848-1", "protein_name": "T cell receptor alpha chain constant", "gene_name": "TRAC", "tax_name": "Human" }, { "uniprot_canonical_ac": "P03979-1", "protein_name": "T cell receptor gamma variable 3", "gene_name": "TRGV3", "tax_name": "Human" }, { "uniprot_canonical_ac": "B7Z8K6-1", "protein_name": "T cell receptor delta constant", "gene_name": "TRDC", "tax_name": "Human" }, { "uniprot_canonical_ac": "P03986-1", "protein_name": "T cell receptor gamma constant 2", "gene_name": "TRGC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01850-1", "protein_name": "T cell receptor beta constant 1", "gene_name": "TRBC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A075B6I7-1", "protein_name": "Probable non-functional immunoglobulin lambda variable 5-48", "gene_name": "IGLV5-48", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A087WT02-1", "protein_name": "T cell receptor alpha variable 9-2", "gene_name": "TRAV9-2", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0B4J248-1", "protein_name": "T cell receptor alpha variable 1-1", "gene_name": "TRAV1-1", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A075B6L2-1", "protein_name": "Probable non-functional T cell receptor gamma variable 11", "gene_name": "TRGV11", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A075B6T8-1", "protein_name": "T cell receptor alpha variable 9-1", "gene_name": "TRAV9-1", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A075B6I3-1", "protein_name": "Probable non-functional immunoglobulin lambda variable 11-55", "gene_name": "IGLV11-55", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A1B0GX95-1", "protein_name": "T cell receptor beta variable 7-4", "gene_name": "TRBV7-4", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0B4J237-1", "protein_name": "T cell receptor alpha variable 8-2", "gene_name": "TRAV8-2", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A075B6I6-1", "protein_name": "Probable non-functional immunoglobulin lambda variable 1-50", "gene_name": "IGLV1-50", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A087WT03-1", "protein_name": "T cell receptor alpha variable 26-1", "gene_name": "TRAV26-1", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A1B0GX31-1", "protein_name": "T cell receptor beta variable 7-6", "gene_name": "TRBV7-6", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0A0MS14-1", "protein_name": "Immunoglobulin heavy variable 1-45", "gene_name": "IGHV1-45", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0C4DH29-1", "protein_name": "Immunoglobulin heavy variable 1-3", "gene_name": "IGHV1-3", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0C4DH33-1", "protein_name": "Immunoglobulin heavy variable 1-24", "gene_name": "IGHV1-24", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0C4DH41-1", "protein_name": "Immunoglobulin heavy variable 4-61", "gene_name": "IGHV4-61", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0C4DH43-1", "protein_name": "Immunoglobulin heavy variable 2-70D", "gene_name": "IGHV2-70D", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0G2JMI3-1", "protein_name": "Immunoglobulin heavy variable 1-69-2", "gene_name": "IGHV1-69-2", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0J9YX35-1", "protein_name": "Immunoglobulin heavy variable 3-64D", "gene_name": "IGHV3-64D", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01743-1", "protein_name": "Immunoglobulin heavy variable 1-46", "gene_name": "IGHV1-46", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DP01-1", "protein_name": "Immunoglobulin heavy variable 1-8", "gene_name": "IGHV1-8", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A075B6S5-1", "protein_name": "Immunoglobulin kappa variable 1-27", "gene_name": "IGKV1-27", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0A0MT76-1", "protein_name": "Immunoglobulin lambda joining 1", "gene_name": "IGLJ1", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0C4DH68-1", "protein_name": "Immunoglobulin kappa variable 2-24", "gene_name": "IGKV2-24", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0C4DH73-1", "protein_name": "Immunoglobulin kappa variable 1-12", "gene_name": "IGKV1-12", "tax_name": "Human" }, { "uniprot_canonical_ac": "A2NJV5-1", "protein_name": "Immunoglobulin kappa variable 2-29", "gene_name": "IGKV2-29", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01594-1", "protein_name": "Immunoglobulin kappa variable 1-33", "gene_name": "IGKV1-33", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04430-1", "protein_name": "Immunoglobulin kappa variable 1-16", "gene_name": "IGKV1-16", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0B4J263-1", "protein_name": "T cell receptor alpha variable 39", "gene_name": "TRAV39", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0B4J1V7-1", "protein_name": "Probable non-functional immunoglobulin heavy variable 7-81", "gene_name": "IGHV7-81", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A075B6N3-1", "protein_name": "T cell receptor beta variable 24-1", "gene_name": "TRBV24-1", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A075B706-1", "protein_name": "T cell receptor delta joining 1", "gene_name": "TRDJ1", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0B4J277-1", "protein_name": "T cell receptor alpha variable 22", "gene_name": "TRAV22", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A075B6T6-1", "protein_name": "T cell receptor alpha variable 12-2", "gene_name": "TRAV12-2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CF51-1", "protein_name": "T cell receptor gamma constant 1", "gene_name": "TRGC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0K0K1B3-1", "protein_name": "T cell receptor beta variable 30", "gene_name": "TRBV30", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A5B6-1", "protein_name": "T cell receptor beta variable 28", "gene_name": "TRBV28", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0A0MS00-1", "protein_name": "Probable non-functional immunoglobulin lambda variable 3-32", "gene_name": "IGLV3-32", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0K0K1A3-1", "protein_name": "T cell receptor beta variable 10-1", "gene_name": "TRBV10-1", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0K0K1C0-1", "protein_name": "T cell receptor beta variable 11-1", "gene_name": "TRBV11-1", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0A0MTA4-1", "protein_name": "T cell receptor beta joining 2-5", "gene_name": "TRBJ2-5", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0C4DH36-1", "protein_name": "Probable non-functional immunoglobulin heavy variable 3-38", "gene_name": "IGHV3-38", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0J9YXA8-1", "protein_name": "T cell receptor beta joining 1-1", "gene_name": "TRBJ1-1", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0K0K1E9-1", "protein_name": "T cell receptor beta variable 7-7", "gene_name": "TRBV7-7", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A1B0GXF2-1", "protein_name": "T cell receptor beta variable 7-2", "gene_name": "TRBV7-2", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A578-1", "protein_name": "T cell receptor beta variable 5-1", "gene_name": "TRBV5-1", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0B4J1U4-1", "protein_name": "T cell receptor gamma variable 5", "gene_name": "TRGV5", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0B4J279-1", "protein_name": "T cell receptor alpha variable 21", "gene_name": "TRAV21", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0B4J2E0-1", "protein_name": "T cell receptor beta variable 12-4", "gene_name": "TRBV12-4", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0A0MS01-1", "protein_name": "Probable non-functional T cell receptor gamma variable 10", "gene_name": "TRGV10", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A1B0GX68-1", "protein_name": "T cell receptor beta variable 2", "gene_name": "TRBV2", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A1B0GX78-1", "protein_name": "T cell receptor beta variable 12-5", "gene_name": "TRBV12-5", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0C4DH26-1", "protein_name": "Probable non-functional immunoglobulin kappa variable 6D-41", "gene_name": "IGKV6D-41", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DPI4-1", "protein_name": "T cell receptor beta diversity 1", "gene_name": "TRBD1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "A0A075B6H9", "url": "https://www.uniprot.org/uniprotkb/A0A075B6H9" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.24600447", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 283 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Nomenclature of the human immunoglobulin kappa (IGK) genes.", "journal": "Exp. Clin. Immunogenet.", "date": "2001", "authors": "Lefranc M P", "reference": { "type": "PubMed", "id": "11549845", "url": "https://pubmed.ncbi.nlm.nih.gov/11549845" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "A0A0A0MT89-1", "protein_name": "Immunoglobulin kappa joining 1", "gene_name": "IGKJ1", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A075B6P5-1", "protein_name": "Immunoglobulin kappa variable 2-28", "gene_name": "IGKV2-28", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A075B6S4-1", "protein_name": "Immunoglobulin kappa variable 1D-17", "gene_name": "IGKV1D-17", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A075B6S6-1", "protein_name": "Immunoglobulin kappa variable 2D-30", "gene_name": "IGKV2D-30", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A087WSY6-1", "protein_name": "Immunoglobulin kappa variable 3D-15", "gene_name": "IGKV3D-15", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A087WW87-1", "protein_name": "Immunoglobulin kappa variable 2-40", "gene_name": "IGKV2-40", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0A0MRZ8-1", "protein_name": "Immunoglobulin kappa variable 3D-11", "gene_name": "IGKV3D-11", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0B4J1Z2-1", "protein_name": "Immunoglobulin kappa variable 1D-43", "gene_name": "IGKV1D-43", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0B4J2D9-1", "protein_name": "Immunoglobulin kappa variable 1D-13", "gene_name": "IGKV1D-13", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0C4DH24-1", "protein_name": "Immunoglobulin kappa variable 6-21", "gene_name": "IGKV6-21", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0C4DH25-1", "protein_name": "Immunoglobulin kappa variable 3D-20", "gene_name": "IGKV3D-20", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0C4DH55-1", "protein_name": "Immunoglobulin kappa variable 3D-7", "gene_name": "IGKV3D-7", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0C4DH69-1", "protein_name": "Immunoglobulin kappa variable 1-9", "gene_name": "IGKV1-9", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01593-1", "protein_name": "Immunoglobulin kappa variable 1D-33", "gene_name": "IGKV1D-33", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01599-1", "protein_name": "Immunoglobulin kappa variable 1-17", "gene_name": "IGKV1-17", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01601-1", "protein_name": "Immunoglobulin kappa variable 1D-16", "gene_name": "IGKV1D-16", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01611-1", "protein_name": "Immunoglobulin kappa variable 1D-12", "gene_name": "IGKV1D-12", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01615-1", "protein_name": "Immunoglobulin kappa variable 2D-28", "gene_name": "IGKV2D-28", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01619-1", "protein_name": "Immunoglobulin kappa variable 3-20", "gene_name": "IGKV3-20", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01624-1", "protein_name": "Immunoglobulin kappa variable 3-15", "gene_name": "IGKV3-15", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04433-1", "protein_name": "Immunoglobulin kappa variable 3-11", "gene_name": "IGKV3-11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DP09-1", "protein_name": "Immunoglobulin kappa variable 1-13", "gene_name": "IGKV1-13", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A087WSZ0-1", "protein_name": "Immunoglobulin kappa variable 1D-8", "gene_name": "IGKV1D-8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01602-1", "protein_name": "Immunoglobulin kappa variable 1-5", "gene_name": "IGKV1-5", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0A0MT36-1", "protein_name": "Immunoglobulin kappa variable 6D-21", "gene_name": "IGKV6D-21", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0C4DH67-1", "protein_name": "Immunoglobulin kappa variable 1-8", "gene_name": "IGKV1-8", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0C4DH72-1", "protein_name": "Immunoglobulin kappa variable 1-6", "gene_name": "IGKV1-6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01597-1", "protein_name": "Immunoglobulin kappa variable 1-39", "gene_name": "IGKV1-39", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06310-1", "protein_name": "Immunoglobulin kappa variable 2-30", "gene_name": "IGKV2-30", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06312-1", "protein_name": "Immunoglobulin kappa variable 4-1", "gene_name": "IGKV4-1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01614-1", "protein_name": "Immunoglobulin kappa variable 2D-40", "gene_name": "IGKV2D-40", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A075B6S2-1", "protein_name": "Immunoglobulin kappa variable 2D-29", "gene_name": "IGKV2D-29", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0A0MRZ7-1", "protein_name": "Immunoglobulin kappa variable 2D-26", "gene_name": "IGKV2D-26", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04432-1", "protein_name": "Immunoglobulin kappa variable 1D-39", "gene_name": "IGKV1D-39", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06315-1", "protein_name": "Immunoglobulin kappa variable 5-2", "gene_name": "IGKV5-2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01834-1", "protein_name": "Immunoglobulin kappa constant", "gene_name": "IGKC", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A075B6S5-1", "protein_name": "Immunoglobulin kappa variable 1-27", "gene_name": "IGKV1-27", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0C4DH68-1", "protein_name": "Immunoglobulin kappa variable 2-24", "gene_name": "IGKV2-24", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0C4DH73-1", "protein_name": "Immunoglobulin kappa variable 1-12", "gene_name": "IGKV1-12", "tax_name": "Human" }, { "uniprot_canonical_ac": "A2NJV5-1", "protein_name": "Immunoglobulin kappa variable 2-29", "gene_name": "IGKV2-29", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01594-1", "protein_name": "Immunoglobulin kappa variable 1-33", "gene_name": "IGKV1-33", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04430-1", "protein_name": "Immunoglobulin kappa variable 1-16", "gene_name": "IGKV1-16", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "A0A0A0MT89", "url": "https://www.uniprot.org/uniprotkb/A0A0A0MT89" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.11549845", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 42 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Structural basis for tandem L27 domain-mediated polymerization.", "journal": "FASEB J.", "date": "2010", "authors": "Yang X, Xie X, Chen L, Zhou H, Wang Z, Zhao W, Tian R, Zhang R, Tian C, Long J, Shen Y", "reference": { "type": "PubMed", "id": "20702775", "url": "https://pubmed.ncbi.nlm.nih.gov/20702775" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9NUP9-1", "protein_name": "Protein lin-7 homolog C", "gene_name": "LIN7C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5T2T1-1", "protein_name": "MAGUK p55 subfamily member 7", "gene_name": "MPP7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12959-1", "protein_name": "Disks large homolog 1", "gene_name": "DLG1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9NUP9", "url": "https://www.uniprot.org/uniprotkb/Q9NUP9" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.20702775", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The avian influenza virus NS1 ESEV PDZ binding motif associates with Dlg1 and Scribble to disrupt cellular tight junctions.", "journal": "J. Virol.", "date": "2011", "authors": "Golebiewski Lisa, Liu Hongbing, Javier Ronald T, Rice Andrew P", "reference": { "type": "PubMed", "id": "21849460", "url": "https://pubmed.ncbi.nlm.nih.gov/21849460" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9NUP9-1", "protein_name": "Protein lin-7 homolog C", "gene_name": "LIN7C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14160-3", "protein_name": "Protein scribble homolog", "gene_name": "SCRIB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12959-1", "protein_name": "Disks large homolog 1", "gene_name": "DLG1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9NUP9", "url": "https://www.uniprot.org/uniprotkb/Q9NUP9" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.21849460", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Molecular cloning, structural characterization and chromosomal localization of human lipoyltransferase gene.", "journal": "European journal of biochemistry", "date": "1999", "authors": "Fujiwara K, Suzuki M, Okumachi Y, Okamura-Ikeda K, Fujiwara T, Takahashi E, Motokawa Y", "reference": { "type": "PubMed", "id": "10103005", "url": "https://pubmed.ncbi.nlm.nih.gov/10103005" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "A6NK58-1", "protein_name": "Octanoyl-[acyl-carrier-protein]:protein N-octanoyltransferase LIPT2, mitochondrial", "gene_name": "LIPT2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14561-1", "protein_name": "Acyl carrier protein, mitochondrial", "gene_name": "NDUFAB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P36957-1", "protein_name": "Dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex, mitochondrial", "gene_name": "DLST", "tax_name": "Human" }, { "uniprot_canonical_ac": "P10515-1", "protein_name": "Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex, mitochondrial", "gene_name": "DLAT", "tax_name": "Human" }, { "uniprot_canonical_ac": "P11182-1", "protein_name": "Lipoamide acyltransferase component of branched-chain alpha-keto acid dehydrogenase complex, mitochondrial", "gene_name": "DBT", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UMS0-1", "protein_name": "NFU1 iron-sulfur cluster scaffold homolog, mitochondrial", "gene_name": "NFU1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43766-1", "protein_name": "Lipoyl synthase, mitochondrial", "gene_name": "LIAS", "tax_name": "Human" }, { "uniprot_canonical_ac": "P10109-1", "protein_name": "Adrenodoxin, mitochondrial", "gene_name": "FDX1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P23434-1", "protein_name": "Glycine cleavage system H protein, mitochondrial", "gene_name": "GCSH", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y234-1", "protein_name": "Lipoyl amidotransferase LIPT1, mitochondrial", "gene_name": "LIPT1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "A6NK58", "url": "https://www.uniprot.org/uniprotkb/A6NK58" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.10103005", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 10 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Do mammalian cells synthesize lipoic acid? Identification of a mouse cDNA encoding a lipoic acid synthase located in mitochondria.", "journal": "FEBS letters", "date": "2001", "authors": "Morikawa T, Yasuno R, Wada H", "reference": { "type": "PubMed", "id": "11389890", "url": "https://pubmed.ncbi.nlm.nih.gov/11389890" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "A6NK58-1", "protein_name": "Octanoyl-[acyl-carrier-protein]:protein N-octanoyltransferase LIPT2, mitochondrial", "gene_name": "LIPT2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14561-1", "protein_name": "Acyl carrier protein, mitochondrial", "gene_name": "NDUFAB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P36957-1", "protein_name": "Dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex, mitochondrial", "gene_name": "DLST", "tax_name": "Human" }, { "uniprot_canonical_ac": "P10515-1", "protein_name": "Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex, mitochondrial", "gene_name": "DLAT", "tax_name": "Human" }, { "uniprot_canonical_ac": "P11182-1", "protein_name": "Lipoamide acyltransferase component of branched-chain alpha-keto acid dehydrogenase complex, mitochondrial", "gene_name": "DBT", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UMS0-1", "protein_name": "NFU1 iron-sulfur cluster scaffold homolog, mitochondrial", "gene_name": "NFU1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99M04-1", "protein_name": "Lipoyl synthase, mitochondrial", "gene_name": "Lias", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "O43766-1", "protein_name": "Lipoyl synthase, mitochondrial", "gene_name": "LIAS", "tax_name": "Human" }, { "uniprot_canonical_ac": "P10109-1", "protein_name": "Adrenodoxin, mitochondrial", "gene_name": "FDX1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P23434-1", "protein_name": "Glycine cleavage system H protein, mitochondrial", "gene_name": "GCSH", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y234-1", "protein_name": "Lipoyl amidotransferase LIPT1, mitochondrial", "gene_name": "LIPT1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "A6NK58", "url": "https://www.uniprot.org/uniprotkb/A6NK58" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.11389890", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 11 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Lipoic acid synthesis and attachment in yeast mitochondria.", "journal": "The Journal of biological chemistry", "date": "2009", "authors": "Schonauer MS, Kastaniotis AJ, Kursu VA, Hiltunen JK, Dieckmann CL", "reference": { "type": "PubMed", "id": "19570983", "url": "https://pubmed.ncbi.nlm.nih.gov/19570983" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "A6NK58-1", "protein_name": "Octanoyl-[acyl-carrier-protein]:protein N-octanoyltransferase LIPT2, mitochondrial", "gene_name": "LIPT2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14561-1", "protein_name": "Acyl carrier protein, mitochondrial", "gene_name": "NDUFAB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P36957-1", "protein_name": "Dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex, mitochondrial", "gene_name": "DLST", "tax_name": "Human" }, { "uniprot_canonical_ac": "P10515-1", "protein_name": "Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex, mitochondrial", "gene_name": "DLAT", "tax_name": "Human" }, { "uniprot_canonical_ac": "P11182-1", "protein_name": "Lipoamide acyltransferase component of branched-chain alpha-keto acid dehydrogenase complex, mitochondrial", "gene_name": "DBT", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UMS0-1", "protein_name": "NFU1 iron-sulfur cluster scaffold homolog, mitochondrial", "gene_name": "NFU1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43766-1", "protein_name": "Lipoyl synthase, mitochondrial", "gene_name": "LIAS", "tax_name": "Human" }, { "uniprot_canonical_ac": "P10109-1", "protein_name": "Adrenodoxin, mitochondrial", "gene_name": "FDX1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P23434-1", "protein_name": "Glycine cleavage system H protein, mitochondrial", "gene_name": "GCSH", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y234-1", "protein_name": "Lipoyl amidotransferase LIPT1, mitochondrial", "gene_name": "LIPT1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P32875-1", "protein_name": "Lipoyl synthase, mitochondrial", "gene_name": "LIP5", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "A6NK58", "url": "https://www.uniprot.org/uniprotkb/A6NK58" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.19570983", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 11 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Mammalian ACSF3 protein is a malonyl-CoA synthetase that supplies the chain extender units for mitochondrial fatty acid synthesis.", "journal": "The Journal of biological chemistry", "date": "2011", "authors": "Witkowski A, Thweatt J, Smith S", "reference": { "type": "PubMed", "id": "21846720", "url": "https://pubmed.ncbi.nlm.nih.gov/21846720" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "A6NK58-1", "protein_name": "Octanoyl-[acyl-carrier-protein]:protein N-octanoyltransferase LIPT2, mitochondrial", "gene_name": "LIPT2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14561-1", "protein_name": "Acyl carrier protein, mitochondrial", "gene_name": "NDUFAB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P36957-1", "protein_name": "Dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex, mitochondrial", "gene_name": "DLST", "tax_name": "Human" }, { "uniprot_canonical_ac": "P10515-1", "protein_name": "Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex, mitochondrial", "gene_name": "DLAT", "tax_name": "Human" }, { "uniprot_canonical_ac": "P11182-1", "protein_name": "Lipoamide acyltransferase component of branched-chain alpha-keto acid dehydrogenase complex, mitochondrial", "gene_name": "DBT", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UMS0-1", "protein_name": "NFU1 iron-sulfur cluster scaffold homolog, mitochondrial", "gene_name": "NFU1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43766-1", "protein_name": "Lipoyl synthase, mitochondrial", "gene_name": "LIAS", "tax_name": "Human" }, { "uniprot_canonical_ac": "P10109-1", "protein_name": "Adrenodoxin, mitochondrial", "gene_name": "FDX1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q4G176-1", "protein_name": "Malonate--CoA ligase ACSF3, mitochondrial", "gene_name": "ACSF3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P23434-1", "protein_name": "Glycine cleavage system H protein, mitochondrial", "gene_name": "GCSH", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y234-1", "protein_name": "Lipoyl amidotransferase LIPT1, mitochondrial", "gene_name": "LIPT1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "A6NK58", "url": "https://www.uniprot.org/uniprotkb/A6NK58" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 354, "end_pos": 354, "sequence_org": "R", "sequence_mut": "A", "comment": "Impairs malonyl-CoA synthase activity.", "evidence": [ { "database": "UniProtKB", "id": "Q4G176", "url": "https://www.uniprot.org/uniprotkb/Q4G176" }, { "database": "PubMed", "id": "21846720", "url": "https://pubmed.ncbi.nlm.nih.gov/21846720" } ], "uniprot_canonical_ac": "Q4G176-1" }, { "start_pos": 354, "end_pos": 354, "sequence_org": "R", "sequence_mut": "L", "comment": "Impairs malonyl-CoA synthase activity.", "evidence": [ { "database": "UniProtKB", "id": "Q4G176", "url": "https://www.uniprot.org/uniprotkb/Q4G176" }, { "database": "PubMed", "id": "21846720", "url": "https://pubmed.ncbi.nlm.nih.gov/21846720" } ], "uniprot_canonical_ac": "Q4G176-1" } ], "record_id": "pubmed.21846720", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 11 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Lipoic acid synthetase deficiency causes neonatal-onset epilepsy, defective mitochondrial energy metabolism, and glycine elevation.", "journal": "American journal of human genetics", "date": "2011", "authors": "Mayr JA, Zimmermann FA, Fauth C, Bergheim C, Meierhofer D, Radmayr D, Zschocke J, Koch J, Sperl W", "reference": { "type": "PubMed", "id": "22152680", "url": "https://pubmed.ncbi.nlm.nih.gov/22152680" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "A6NK58-1", "protein_name": "Octanoyl-[acyl-carrier-protein]:protein N-octanoyltransferase LIPT2, mitochondrial", "gene_name": "LIPT2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14561-1", "protein_name": "Acyl carrier protein, mitochondrial", "gene_name": "NDUFAB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P36957-1", "protein_name": "Dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex, mitochondrial", "gene_name": "DLST", "tax_name": "Human" }, { "uniprot_canonical_ac": "P10515-1", "protein_name": "Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex, mitochondrial", "gene_name": "DLAT", "tax_name": "Human" }, { "uniprot_canonical_ac": "P11182-1", "protein_name": "Lipoamide acyltransferase component of branched-chain alpha-keto acid dehydrogenase complex, mitochondrial", "gene_name": "DBT", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UMS0-1", "protein_name": "NFU1 iron-sulfur cluster scaffold homolog, mitochondrial", "gene_name": "NFU1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43766-1", "protein_name": "Lipoyl synthase, mitochondrial", "gene_name": "LIAS", "tax_name": "Human" }, { "uniprot_canonical_ac": "P10109-1", "protein_name": "Adrenodoxin, mitochondrial", "gene_name": "FDX1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P23434-1", "protein_name": "Glycine cleavage system H protein, mitochondrial", "gene_name": "GCSH", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y234-1", "protein_name": "Lipoyl amidotransferase LIPT1, mitochondrial", "gene_name": "LIPT1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "A6NK58", "url": "https://www.uniprot.org/uniprotkb/A6NK58" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "snv": [ { "evidence": [ { "id": "rs144133667", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs144133667" }, { "id": "rs144133667", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs144133667" }, { "id": "rs144133667", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs144133667#frequency_tab" }, { "id": "rs144133667", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs144133667" }, { "id": "22152680", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/22152680" } ], "glycoeffect": [], "start_pos": 249, "end_pos": 249, "sequence_org": "R", "sequence_mut": "H", "comment": "Germline mutation passed 1 filters: glycogene of type=glycogene, unassigned.", "chr_id": "4", "chr_pos": "39470027", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "R249", "keywords": [ "ebi", "germline" ], "filter_code": "010000000000000000000.00000000000000.000000000001000000.00001.11.000.000", "uniprot_canonical_ac": "O43766-1" } ], "record_id": "pubmed.22152680", "abstract": "", "glycosylation": [], "mutagenesis": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 10 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Mutations in the lipoyltransferase LIPT1 gene cause a fatal disease associated with a specific lipoylation defect of the 2-ketoacid dehydrogenase complexes.", "journal": "Human molecular genetics", "date": "2014", "authors": "Tort F, Ferrer-Cortes X, Thio M, Navarro-Sastre A, Matalonga L, Quintana E, Bujan N, Arias A, Garcia-Villoria J, Acquaviva C, Vianey-Saban C, Artuch R, Garcia-Cazorla A, Briones P, Ribes A", "reference": { "type": "PubMed", "id": "24256811", "url": "https://pubmed.ncbi.nlm.nih.gov/24256811" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "A6NK58-1", "protein_name": "Octanoyl-[acyl-carrier-protein]:protein N-octanoyltransferase LIPT2, mitochondrial", "gene_name": "LIPT2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14561-1", "protein_name": "Acyl carrier protein, mitochondrial", "gene_name": "NDUFAB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P36957-1", "protein_name": "Dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex, mitochondrial", "gene_name": "DLST", "tax_name": "Human" }, { "uniprot_canonical_ac": "P10515-1", "protein_name": "Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex, mitochondrial", "gene_name": "DLAT", "tax_name": "Human" }, { "uniprot_canonical_ac": "P11182-1", "protein_name": "Lipoamide acyltransferase component of branched-chain alpha-keto acid dehydrogenase complex, mitochondrial", "gene_name": "DBT", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UMS0-1", "protein_name": "NFU1 iron-sulfur cluster scaffold homolog, mitochondrial", "gene_name": "NFU1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43766-1", "protein_name": "Lipoyl synthase, mitochondrial", "gene_name": "LIAS", "tax_name": "Human" }, { "uniprot_canonical_ac": "P10109-1", "protein_name": "Adrenodoxin, mitochondrial", "gene_name": "FDX1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P23434-1", "protein_name": "Glycine cleavage system H protein, mitochondrial", "gene_name": "GCSH", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y234-1", "protein_name": "Lipoyl amidotransferase LIPT1, mitochondrial", "gene_name": "LIPT1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "A6NK58", "url": "https://www.uniprot.org/uniprotkb/A6NK58" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.24256811", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 10 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Mutations in human lipoyltransferase gene LIPT1 cause a Leigh disease with secondary deficiency for pyruvate and alpha-ketoglutarate dehydrogenase.", "journal": "Orphanet journal of rare diseases", "date": "2013", "authors": "Soreze Y, Boutron A, Habarou F, Barnerias C, Nonnenmacher L, Delpech H, Mamoune A, Chretien D, Hubert L, Bole-Feysot C, Nitschke P, Correia I, Sardet C, Boddaert N, Hamel Y, Delahodde A, Ottolenghi C, de Lonlay P", "reference": { "type": "PubMed", "id": "24341803", "url": "https://pubmed.ncbi.nlm.nih.gov/24341803" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "A6NK58-1", "protein_name": "Octanoyl-[acyl-carrier-protein]:protein N-octanoyltransferase LIPT2, mitochondrial", "gene_name": "LIPT2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14561-1", "protein_name": "Acyl carrier protein, mitochondrial", "gene_name": "NDUFAB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P36957-1", "protein_name": "Dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex, mitochondrial", "gene_name": "DLST", "tax_name": "Human" }, { "uniprot_canonical_ac": "P10515-1", "protein_name": "Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex, mitochondrial", "gene_name": "DLAT", "tax_name": "Human" }, { "uniprot_canonical_ac": "P11182-1", "protein_name": "Lipoamide acyltransferase component of branched-chain alpha-keto acid dehydrogenase complex, mitochondrial", "gene_name": "DBT", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UMS0-1", "protein_name": "NFU1 iron-sulfur cluster scaffold homolog, mitochondrial", "gene_name": "NFU1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43766-1", "protein_name": "Lipoyl synthase, mitochondrial", "gene_name": "LIAS", "tax_name": "Human" }, { "uniprot_canonical_ac": "P10109-1", "protein_name": "Adrenodoxin, mitochondrial", "gene_name": "FDX1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P23434-1", "protein_name": "Glycine cleavage system H protein, mitochondrial", "gene_name": "GCSH", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y234-1", "protein_name": "Lipoyl amidotransferase LIPT1, mitochondrial", "gene_name": "LIPT1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "A6NK58", "url": "https://www.uniprot.org/uniprotkb/A6NK58" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.24341803", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 10 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Mis-targeting of the mitochondrial protein LIPT2 leads to apoptotic cell death.", "journal": "PloS one", "date": "2017", "authors": "Bernardinelli E, Costa R, Scantamburlo G, To J, Morabito R, Nofziger C, Doerrier C, Krumschnabel G, Paulmichl M, Dossena S", "reference": { "type": "PubMed", "id": "28628643", "url": "https://pubmed.ncbi.nlm.nih.gov/28628643" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "A6NK58-1", "protein_name": "Octanoyl-[acyl-carrier-protein]:protein N-octanoyltransferase LIPT2, mitochondrial", "gene_name": "LIPT2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "A6NK58", "url": "https://www.uniprot.org/uniprotkb/A6NK58" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 1, "end_pos": 31, "sequence_org": "MRQPAVRLVRLGRVPYAELLGLQDRWLRRLQ", "sequence_mut": "", "comment": "Mislocalization to the cytosol; induces apoptotic cell death.", "evidence": [ { "database": "UniProtKB", "id": "A6NK58", "url": "https://www.uniprot.org/uniprotkb/A6NK58" }, { "database": "PubMed", "id": "28628643", "url": "https://pubmed.ncbi.nlm.nih.gov/28628643" } ], "uniprot_canonical_ac": "A6NK58-1" } ], "record_id": "pubmed.28628643", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Biallelic Mutations in LIPT2 Cause a Mitochondrial Lipoylation Defect Associated with Severe Neonatal Encephalopathy.", "journal": "American journal of human genetics", "date": "2017", "authors": "Habarou F, Hamel Y, Haack TB, Feichtinger RG, Lebigot E, Marquardt I, Busiah K, Laroche C, Madrange M, Grisel C, Pontoizeau C, Eisermann M, Boutron A, Chretien D, Chadefaux-Vekemans B, Barouki R, Bole-Feysot C, Nitschke P, Goudin N, Boddaert N, Nemazanyy I, Delahodde A, Kolker S, Rodenburg RJ, Korenke GC, Meitinger T, Strom TM, Prokisch H, Rotig A, Ottolenghi C, Mayr JA, de Lonlay P", "reference": { "type": "PubMed", "id": "28757203", "url": "https://pubmed.ncbi.nlm.nih.gov/28757203" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "A6NK58-1", "protein_name": "Octanoyl-[acyl-carrier-protein]:protein N-octanoyltransferase LIPT2, mitochondrial", "gene_name": "LIPT2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14561-1", "protein_name": "Acyl carrier protein, mitochondrial", "gene_name": "NDUFAB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P36957-1", "protein_name": "Dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex, mitochondrial", "gene_name": "DLST", "tax_name": "Human" }, { "uniprot_canonical_ac": "P10515-1", "protein_name": "Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex, mitochondrial", "gene_name": "DLAT", "tax_name": "Human" }, { "uniprot_canonical_ac": "P11182-1", "protein_name": "Lipoamide acyltransferase component of branched-chain alpha-keto acid dehydrogenase complex, mitochondrial", "gene_name": "DBT", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UMS0-1", "protein_name": "NFU1 iron-sulfur cluster scaffold homolog, mitochondrial", "gene_name": "NFU1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43766-1", "protein_name": "Lipoyl synthase, mitochondrial", "gene_name": "LIAS", "tax_name": "Human" }, { "uniprot_canonical_ac": "P10109-1", "protein_name": "Adrenodoxin, mitochondrial", "gene_name": "FDX1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P23434-1", "protein_name": "Glycine cleavage system H protein, mitochondrial", "gene_name": "GCSH", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y234-1", "protein_name": "Lipoyl amidotransferase LIPT1, mitochondrial", "gene_name": "LIPT1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "A6NK58", "url": "https://www.uniprot.org/uniprotkb/A6NK58" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.28757203", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 10 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Protein moonlighting elucidates the essential human pathway catalyzing lipoic acid assembly on its cognate enzymes.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2018-07-24", "authors": "Cao Xinyun, Zhu Lei, Song Xuejiao, Hu Zhe, Cronan John E", "reference": { "type": "PubMed", "id": "29987032", "url": "https://pubmed.ncbi.nlm.nih.gov/29987032" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "A6NK58-1", "protein_name": "Octanoyl-[acyl-carrier-protein]:protein N-octanoyltransferase LIPT2, mitochondrial", "gene_name": "LIPT2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14561-1", "protein_name": "Acyl carrier protein, mitochondrial", "gene_name": "NDUFAB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9D009-1", "protein_name": "Octanoyl-[acyl-carrier-protein]:protein N-octanoyltransferase LIPT2, mitochondrial", "gene_name": "Lipt2", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "P36957-1", "protein_name": "Dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex, mitochondrial", "gene_name": "DLST", "tax_name": "Human" }, { "uniprot_canonical_ac": "P10515-1", "protein_name": "Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex, mitochondrial", "gene_name": "DLAT", "tax_name": "Human" }, { "uniprot_canonical_ac": "P11182-1", "protein_name": "Lipoamide acyltransferase component of branched-chain alpha-keto acid dehydrogenase complex, mitochondrial", "gene_name": "DBT", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UMS0-1", "protein_name": "NFU1 iron-sulfur cluster scaffold homolog, mitochondrial", "gene_name": "NFU1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43766-1", "protein_name": "Lipoyl synthase, mitochondrial", "gene_name": "LIAS", "tax_name": "Human" }, { "uniprot_canonical_ac": "P10109-1", "protein_name": "Adrenodoxin, mitochondrial", "gene_name": "FDX1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P23434-1", "protein_name": "Glycine cleavage system H protein, mitochondrial", "gene_name": "GCSH", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y234-1", "protein_name": "Lipoyl amidotransferase LIPT1, mitochondrial", "gene_name": "LIPT1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "A6NK58", "url": "https://www.uniprot.org/uniprotkb/A6NK58" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 185, "end_pos": 185, "sequence_org": "C", "sequence_mut": "A", "comment": "Loss of octanoyl transferase activity.", "evidence": [ { "database": "UniProtKB", "id": "Q9D009", "url": "https://www.uniprot.org/uniprotkb/Q9D009" }, { "database": "PubMed", "id": "29987032", "url": "https://pubmed.ncbi.nlm.nih.gov/29987032" } ], "uniprot_canonical_ac": "Q9D009-1" }, { "start_pos": 185, "end_pos": 185, "sequence_org": "C", "sequence_mut": "S", "comment": "Loss of octanoyl transferase activity.", "evidence": [ { "database": "UniProtKB", "id": "Q9D009", "url": "https://www.uniprot.org/uniprotkb/Q9D009" }, { "database": "PubMed", "id": "29987032", "url": "https://pubmed.ncbi.nlm.nih.gov/29987032" } ], "uniprot_canonical_ac": "Q9D009-1" } ], "record_id": "pubmed.29987032", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 11 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Functional Assessment of Lipoyltransferase-1 Deficiency in Cells, Mice, and Humans.", "journal": "Cell reports", "date": "2019", "authors": "Ni M, Solmonson A, Pan C, Yang C, Li D, Notzon A, Cai L, Guevara G, Zacharias LG, Faubert B, Vu HS, Jiang L, Ko B, Morales NM, Pei J, Vale G, Rakheja D, Grishin NV, McDonald JG, Gotway GK, McNutt MC, Pascual JM, DeBerardinis RJ", "reference": { "type": "PubMed", "id": "31042466", "url": "https://pubmed.ncbi.nlm.nih.gov/31042466" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "A6NK58-1", "protein_name": "Octanoyl-[acyl-carrier-protein]:protein N-octanoyltransferase LIPT2, mitochondrial", "gene_name": "LIPT2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14561-1", "protein_name": "Acyl carrier protein, mitochondrial", "gene_name": "NDUFAB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P36957-1", "protein_name": "Dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex, mitochondrial", "gene_name": "DLST", "tax_name": "Human" }, { "uniprot_canonical_ac": "P10515-1", "protein_name": "Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex, mitochondrial", "gene_name": "DLAT", "tax_name": "Human" }, { "uniprot_canonical_ac": "P11182-1", "protein_name": "Lipoamide acyltransferase component of branched-chain alpha-keto acid dehydrogenase complex, mitochondrial", "gene_name": "DBT", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UMS0-1", "protein_name": "NFU1 iron-sulfur cluster scaffold homolog, mitochondrial", "gene_name": "NFU1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43766-1", "protein_name": "Lipoyl synthase, mitochondrial", "gene_name": "LIAS", "tax_name": "Human" }, { "uniprot_canonical_ac": "P10109-1", "protein_name": "Adrenodoxin, mitochondrial", "gene_name": "FDX1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P23434-1", "protein_name": "Glycine cleavage system H protein, mitochondrial", "gene_name": "GCSH", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y234-1", "protein_name": "Lipoyl amidotransferase LIPT1, mitochondrial", "gene_name": "LIPT1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "A6NK58", "url": "https://www.uniprot.org/uniprotkb/A6NK58" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.31042466", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 10 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "FDX1 regulates cellular protein lipoylation through direct binding to LIAS.", "journal": "The Journal of biological chemistry", "date": "2023-09", "authors": "Dreishpoon Margaret B, Bick Nolan R, Petrova Boryana, Warui Douglas M, Cameron Alison, Booker Squire J, Kanarek Naama, Golub Todd R, Tsvetkov Peter", "reference": { "type": "PubMed", "id": "37453661", "url": "https://pubmed.ncbi.nlm.nih.gov/37453661" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "A6NK58-1", "protein_name": "Octanoyl-[acyl-carrier-protein]:protein N-octanoyltransferase LIPT2, mitochondrial", "gene_name": "LIPT2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14561-1", "protein_name": "Acyl carrier protein, mitochondrial", "gene_name": "NDUFAB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P36957-1", "protein_name": "Dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex, mitochondrial", "gene_name": "DLST", "tax_name": "Human" }, { "uniprot_canonical_ac": "P10515-1", "protein_name": "Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex, mitochondrial", "gene_name": "DLAT", "tax_name": "Human" }, { "uniprot_canonical_ac": "P11182-1", "protein_name": "Lipoamide acyltransferase component of branched-chain alpha-keto acid dehydrogenase complex, mitochondrial", "gene_name": "DBT", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UMS0-1", "protein_name": "NFU1 iron-sulfur cluster scaffold homolog, mitochondrial", "gene_name": "NFU1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43766-1", "protein_name": "Lipoyl synthase, mitochondrial", "gene_name": "LIAS", "tax_name": "Human" }, { "uniprot_canonical_ac": "P10109-1", "protein_name": "Adrenodoxin, mitochondrial", "gene_name": "FDX1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P23434-1", "protein_name": "Glycine cleavage system H protein, mitochondrial", "gene_name": "GCSH", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y234-1", "protein_name": "Lipoyl amidotransferase LIPT1, mitochondrial", "gene_name": "LIPT1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "A6NK58", "url": "https://www.uniprot.org/uniprotkb/A6NK58" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.37453661", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 10 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Lipoylation is dependent on the ferredoxin FDX1 and dispensable under hypoxia in human cells.", "journal": "The Journal of biological chemistry", "date": "2023-09", "authors": "Joshi Pallavi R, Sadre Shayan, Guo Xiaoyan A, McCoy Jason G, Mootha Vamsi K", "reference": { "type": "PubMed", "id": "37481209", "url": "https://pubmed.ncbi.nlm.nih.gov/37481209" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "A6NK58-1", "protein_name": "Octanoyl-[acyl-carrier-protein]:protein N-octanoyltransferase LIPT2, mitochondrial", "gene_name": "LIPT2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14561-1", "protein_name": "Acyl carrier protein, mitochondrial", "gene_name": "NDUFAB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P36957-1", "protein_name": "Dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex, mitochondrial", "gene_name": "DLST", "tax_name": "Human" }, { "uniprot_canonical_ac": "P10515-1", "protein_name": "Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex, mitochondrial", "gene_name": "DLAT", "tax_name": "Human" }, { "uniprot_canonical_ac": "P11182-1", "protein_name": "Lipoamide acyltransferase component of branched-chain alpha-keto acid dehydrogenase complex, mitochondrial", "gene_name": "DBT", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UMS0-1", "protein_name": "NFU1 iron-sulfur cluster scaffold homolog, mitochondrial", "gene_name": "NFU1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43766-1", "protein_name": "Lipoyl synthase, mitochondrial", "gene_name": "LIAS", "tax_name": "Human" }, { "uniprot_canonical_ac": "P10109-1", "protein_name": "Adrenodoxin, mitochondrial", "gene_name": "FDX1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P23434-1", "protein_name": "Glycine cleavage system H protein, mitochondrial", "gene_name": "GCSH", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y234-1", "protein_name": "Lipoyl amidotransferase LIPT1, mitochondrial", "gene_name": "LIPT1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "A6NK58", "url": "https://www.uniprot.org/uniprotkb/A6NK58" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.37481209", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 10 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Tyrosine phosphorylation of SLP-76 is downstream of Syk following stimulation of the collagen receptor in platelets.", "journal": "The Journal of biological chemistry", "date": "1999", "authors": "Gross BS, Lee JR, Clements JL, Turner M, Tybulewicz VL, Findell PR, Koretzky GA, Watson SP", "reference": { "type": "PubMed", "id": "10026222", "url": "https://pubmed.ncbi.nlm.nih.gov/10026222" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P01700-1", "protein_name": "Immunoglobulin lambda variable 1-47", "gene_name": "IGLV1-47", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01714-1", "protein_name": "Immunoglobulin lambda variable 3-19", "gene_name": "IGLV3-19", "tax_name": "Human" }, { "uniprot_canonical_ac": "P80748-1", "protein_name": "Immunoglobulin lambda variable 3-21", "gene_name": "IGLV3-21", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A075B6P5-1", "protein_name": "Immunoglobulin kappa variable 2-28", "gene_name": "IGKV2-28", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A075B6S6-1", "protein_name": "Immunoglobulin kappa variable 2D-30", "gene_name": "IGKV2D-30", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0C4DH25-1", "protein_name": "Immunoglobulin kappa variable 3D-20", "gene_name": "IGKV3D-20", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01593-1", "protein_name": "Immunoglobulin kappa variable 1D-33", "gene_name": "IGKV1D-33", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01599-1", "protein_name": "Immunoglobulin kappa variable 1-17", "gene_name": "IGKV1-17", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01601-1", "protein_name": "Immunoglobulin kappa variable 1D-16", "gene_name": "IGKV1D-16", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01611-1", "protein_name": "Immunoglobulin kappa variable 1D-12", "gene_name": "IGKV1D-12", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01615-1", "protein_name": "Immunoglobulin kappa variable 2D-28", "gene_name": "IGKV2D-28", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01619-1", "protein_name": "Immunoglobulin kappa variable 3-20", "gene_name": "IGKV3-20", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01624-1", "protein_name": "Immunoglobulin kappa variable 3-15", "gene_name": "IGKV3-15", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04433-1", "protein_name": "Immunoglobulin kappa variable 3-11", "gene_name": "IGKV3-11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01602-1", "protein_name": "Immunoglobulin kappa variable 1-5", "gene_name": "IGKV1-5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P02452-1", "protein_name": "Collagen alpha-1(I) chain", "gene_name": "COL1A1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q05513-1", "protein_name": "Protein kinase C zeta type", "gene_name": "PRKCZ", "tax_name": "Human" }, { "uniprot_canonical_ac": "P28482-1", "protein_name": "Mitogen-activated protein kinase 1", "gene_name": "MAPK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P45984-1", "protein_name": "Mitogen-activated protein kinase 9", "gene_name": "MAPK9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13233-1", "protein_name": "Mitogen-activated protein kinase kinase kinase 1", "gene_name": "MAP3K1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13153-1", "protein_name": "Serine/threonine-protein kinase PAK 1", "gene_name": "PAK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61586-1", "protein_name": "Transforming protein RhoA", "gene_name": "RHOA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13177-1", "protein_name": "Serine/threonine-protein kinase PAK 2", "gene_name": "PAK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01112-1", "protein_name": "GTPase HRas", "gene_name": "HRAS", "tax_name": "Human" }, { "uniprot_canonical_ac": "P53779-1", "protein_name": "Mitogen-activated protein kinase 10", "gene_name": "MAPK10", "tax_name": "Human" }, { "uniprot_canonical_ac": "P43405-1", "protein_name": "Tyrosine-protein kinase SYK", "gene_name": "SYK", "tax_name": "Human" }, { "uniprot_canonical_ac": "P26717-1", "protein_name": "NKG2-C type II integral membrane protein", "gene_name": "KLRC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86YL7-1", "protein_name": "Podoplanin", "gene_name": "PDPN", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9P126-1", "protein_name": "C-type lectin domain family 1 member B", "gene_name": "CLEC1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42336-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform", "gene_name": "PIK3CA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01362-1", "protein_name": "High affinity immunoglobulin epsilon receptor subunit beta", "gene_name": "MS4A2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P30273-1", "protein_name": "High affinity immunoglobulin epsilon receptor subunit gamma", "gene_name": "FCER1G", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01767-1", "protein_name": "Immunoglobulin heavy variable 3-53", "gene_name": "IGHV3-53", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06331-1", "protein_name": "Immunoglobulin heavy variable 4-34", "gene_name": "IGHV4-34", "tax_name": "Human" }, { "uniprot_canonical_ac": "P26718-1", "protein_name": "NKG2-D type II integral membrane protein", "gene_name": "KLRK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01597-1", "protein_name": "Immunoglobulin kappa variable 1-39", "gene_name": "IGKV1-39", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06310-1", "protein_name": "Immunoglobulin kappa variable 2-30", "gene_name": "IGKV2-30", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06312-1", "protein_name": "Immunoglobulin kappa variable 4-1", "gene_name": "IGKV4-1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01614-1", "protein_name": "Immunoglobulin kappa variable 2D-40", "gene_name": "IGKV2D-40", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14733-1", "protein_name": "Dual specificity mitogen-activated protein kinase kinase 7", "gene_name": "MAP2K7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01111-1", "protein_name": "GTPase NRas", "gene_name": "NRAS", "tax_name": "Human" }, { "uniprot_canonical_ac": "P13747-1", "protein_name": "HLA class I histocompatibility antigen, alpha chain E", "gene_name": "HLA-E", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DOY2-1", "protein_name": "Immunoglobulin lambda constant 2", "gene_name": "IGLC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5UE93-1", "protein_name": "Phosphoinositide 3-kinase regulatory subunit 6", "gene_name": "PIK3R6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P48736-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit gamma isoform", "gene_name": "PIK3CG", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43561-1", "protein_name": "Linker for activation of T-cells family member 1", "gene_name": "LAT", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75791-1", "protein_name": "GRB2-related adapter protein 2", "gene_name": "GRAP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P84095-1", "protein_name": "Rho-related GTP-binding protein RhoG", "gene_name": "RHOG", "tax_name": "Human" }, { "uniprot_canonical_ac": "P29350-1", "protein_name": "Tyrosine-protein phosphatase non-receptor type 6", "gene_name": "PTPN6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04432-1", "protein_name": "Immunoglobulin kappa variable 1D-39", "gene_name": "IGKV1D-39", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06315-1", "protein_name": "Immunoglobulin kappa variable 5-2", "gene_name": "IGKV5-2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01699-1", "protein_name": "Immunoglobulin lambda variable 1-44", "gene_name": "IGLV1-44", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01701-1", "protein_name": "Immunoglobulin lambda variable 1-51", "gene_name": "IGLV1-51", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01704-1", "protein_name": "Immunoglobulin lambda variable 2-14", "gene_name": "IGLV2-14", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01706-1", "protein_name": "Immunoglobulin lambda variable 2-11", "gene_name": "IGLV2-11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01709-1", "protein_name": "Immunoglobulin lambda variable 2-8", "gene_name": "IGLV2-8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01717-1", "protein_name": "Immunoglobulin lambda variable 3-25", "gene_name": "IGLV3-25", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01721-1", "protein_name": "Immunoglobulin lambda variable 6-57", "gene_name": "IGLV6-57", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01703-1", "protein_name": "Immunoglobulin lambda variable 1-40", "gene_name": "IGLV1-40", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01705-1", "protein_name": "Immunoglobulin lambda variable 2-23", "gene_name": "IGLV2-23", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01715-1", "protein_name": "Immunoglobulin lambda variable 3-1", "gene_name": "IGLV3-1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01718-1", "protein_name": "Immunoglobulin lambda variable 3-27", "gene_name": "IGLV3-27", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04211-1", "protein_name": "Immunoglobulin lambda variable 7-43", "gene_name": "IGLV7-43", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13241-1", "protein_name": "Natural killer cells antigen CD94", "gene_name": "KLRD1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8WYR1-1", "protein_name": "Phosphoinositide 3-kinase regulatory subunit 5", "gene_name": "PIK3R5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q07889-1", "protein_name": "Son of sevenless homolog 1", "gene_name": "SOS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95866-1", "protein_name": "Megakaryocyte and platelet inhibitory receptor G6b", "gene_name": "MPIG6B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P45985-1", "protein_name": "Dual specificity mitogen-activated protein kinase kinase 4", "gene_name": "MAP2K4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CF74-1", "protein_name": "Immunoglobulin lambda constant 6", "gene_name": "IGLC6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q06187-1", "protein_name": "Tyrosine-protein kinase BTK", "gene_name": "BTK", "tax_name": "Human" }, { "uniprot_canonical_ac": "P52735-1", "protein_name": "Guanine nucleotide exchange factor VAV2", "gene_name": "VAV2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P60953-2", "protein_name": "Cell division control protein 42 homolog", "gene_name": "CDC42", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61769-1", "protein_name": "Beta-2-microglobulin", "gene_name": "B2M", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92569-1", "protein_name": "Phosphatidylinositol 3-kinase regulatory subunit gamma", "gene_name": "PIK3R3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P63000-1", "protein_name": "Ras-related C3 botulinum toxin substrate 1", "gene_name": "RAC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00459-1", "protein_name": "Phosphatidylinositol 3-kinase regulatory subunit beta", "gene_name": "PIK3R2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06239-1", "protein_name": "Tyrosine-protein kinase Lck", "gene_name": "LCK", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q06124-2", "protein_name": "Tyrosine-protein phosphatase non-receptor type 11", "gene_name": "PTPN11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P07948-1", "protein_name": "Tyrosine-protein kinase Lyn", "gene_name": "LYN", "tax_name": "Human" }, { "uniprot_canonical_ac": "P16885-1", "protein_name": "1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-2", "gene_name": "PLCG2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P08123-1", "protein_name": "Collagen alpha-2(I) chain", "gene_name": "COL1A2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UKW4-1", "protein_name": "Guanine nucleotide exchange factor VAV3", "gene_name": "VAV3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HCN6-1", "protein_name": "Platelet glycoprotein VI", "gene_name": "GP6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P45983-1", "protein_name": "Mitogen-activated protein kinase 8", "gene_name": "MAPK8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62745-1", "protein_name": "Rho-related GTP-binding protein RhoB", "gene_name": "RHOB", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01825-1", "protein_name": "Immunoglobulin heavy variable 4-59", "gene_name": "IGHV4-59", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42338-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit beta isoform", "gene_name": "PIK3CB", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01817-1", "protein_name": "Immunoglobulin heavy variable 2-5", "gene_name": "IGHV2-5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01824-1", "protein_name": "Immunoglobulin heavy variable 4-39", "gene_name": "IGHV4-39", "tax_name": "Human" }, { "uniprot_canonical_ac": "P23083-1", "protein_name": "Immunoglobulin heavy variable 1-2", "gene_name": "IGHV1-2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43914-1", "protein_name": "TYRO protein tyrosine kinase-binding protein", "gene_name": "TYROBP", "tax_name": "Human" }, { "uniprot_canonical_ac": "P15153-1", "protein_name": "Ras-related C3 botulinum toxin substrate 2", "gene_name": "RAC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01742-1", "protein_name": "Immunoglobulin heavy variable 1-69", "gene_name": "IGHV1-69", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01768-1", "protein_name": "Immunoglobulin heavy variable 3-30", "gene_name": "IGHV3-30", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01814-1", "protein_name": "Immunoglobulin heavy variable 2-70", "gene_name": "IGHV2-70", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01772-1", "protein_name": "Immunoglobulin heavy variable 3-33", "gene_name": "IGHV3-33", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01762-1", "protein_name": "Immunoglobulin heavy variable 3-11", "gene_name": "IGHV3-11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01763-1", "protein_name": "Immunoglobulin heavy variable 3-48", "gene_name": "IGHV3-48", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01764-1", "protein_name": "Immunoglobulin heavy variable 3-23", "gene_name": "IGHV3-23", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01766-1", "protein_name": "Immunoglobulin heavy variable 3-13", "gene_name": "IGHV3-13", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01780-1", "protein_name": "Immunoglobulin heavy variable 3-7", "gene_name": "IGHV3-7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01782-1", "protein_name": "Immunoglobulin heavy variable 3-9", "gene_name": "IGHV3-9", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0M8Q6-1", "protein_name": "Immunoglobulin lambda constant 7", "gene_name": "IGLC7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01834-1", "protein_name": "Immunoglobulin kappa constant", "gene_name": "IGKC", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG04-1", "protein_name": "Immunoglobulin lambda constant 1", "gene_name": "IGLC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DOY3-1", "protein_name": "Immunoglobulin lambda constant 3", "gene_name": "IGLC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NZC2-1", "protein_name": "Triggering receptor expressed on myeloid cells 2", "gene_name": "TREM2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13094-1", "protein_name": "Lymphocyte cytosolic protein 2", "gene_name": "LCP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27361-1", "protein_name": "Mitogen-activated protein kinase 3", "gene_name": "MAPK3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01743-1", "protein_name": "Immunoglobulin heavy variable 1-46", "gene_name": "IGHV1-46", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01854-2", "protein_name": "Immunoglobulin heavy constant epsilon", "gene_name": "IGHE", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0C4DH73-1", "protein_name": "Immunoglobulin kappa variable 1-12", "gene_name": "IGKV1-12", "tax_name": "Human" }, { "uniprot_canonical_ac": "A2NJV5-1", "protein_name": "Immunoglobulin kappa variable 2-29", "gene_name": "IGKV2-29", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01594-1", "protein_name": "Immunoglobulin kappa variable 1-33", "gene_name": "IGKV1-33", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04430-1", "protein_name": "Immunoglobulin kappa variable 1-16", "gene_name": "IGKV1-16", "tax_name": "Human" }, { "uniprot_canonical_ac": "P12319-1", "protein_name": "High affinity immunoglobulin epsilon receptor subunit alpha", "gene_name": "FCER1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01100-1", "protein_name": "Protein c-Fos", "gene_name": "FOS", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27986-1", "protein_name": "Phosphatidylinositol 3-kinase regulatory subunit alpha", "gene_name": "PIK3R1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P19174-1", "protein_name": "1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-1", "gene_name": "PLCG1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05412-1", "protein_name": "Transcription factor Jun", "gene_name": "JUN", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06241-1", "protein_name": "Tyrosine-protein kinase Fyn", "gene_name": "FYN", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15530-1", "protein_name": "3-phosphoinositide-dependent protein kinase 1", "gene_name": "PDPK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P15498-1", "protein_name": "Proto-oncogene vav", "gene_name": "VAV1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P01700", "url": "https://www.uniprot.org/uniprotkb/P01700" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.10026222", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 123 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "In situ detection of activated Bruton's tyrosine kinase in the Ig signaling complex by phosphopeptide-specific monoclonal antibodies.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1999", "authors": "Nisitani S, Kato RM, Rawlings DJ, Witte ON, Wahl MI", "reference": { "type": "PubMed", "id": "10051622", "url": "https://pubmed.ncbi.nlm.nih.gov/10051622" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P01700-1", "protein_name": "Immunoglobulin lambda variable 1-47", "gene_name": "IGLV1-47", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01714-1", "protein_name": "Immunoglobulin lambda variable 3-19", "gene_name": "IGLV3-19", "tax_name": "Human" }, { "uniprot_canonical_ac": "P80748-1", "protein_name": "Immunoglobulin lambda variable 3-21", "gene_name": "IGLV3-21", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A075B6P5-1", "protein_name": "Immunoglobulin kappa variable 2-28", "gene_name": "IGKV2-28", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A075B6S6-1", "protein_name": "Immunoglobulin kappa variable 2D-30", "gene_name": "IGKV2D-30", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0C4DH25-1", "protein_name": "Immunoglobulin kappa variable 3D-20", "gene_name": "IGKV3D-20", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01593-1", "protein_name": "Immunoglobulin kappa variable 1D-33", "gene_name": "IGKV1D-33", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01599-1", "protein_name": "Immunoglobulin kappa variable 1-17", "gene_name": "IGKV1-17", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01601-1", "protein_name": "Immunoglobulin kappa variable 1D-16", "gene_name": "IGKV1D-16", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01611-1", "protein_name": "Immunoglobulin kappa variable 1D-12", "gene_name": "IGKV1D-12", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01615-1", "protein_name": "Immunoglobulin kappa variable 2D-28", "gene_name": "IGKV2D-28", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01619-1", "protein_name": "Immunoglobulin kappa variable 3-20", "gene_name": "IGKV3-20", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01624-1", "protein_name": "Immunoglobulin kappa variable 3-15", "gene_name": "IGKV3-15", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04433-1", "protein_name": "Immunoglobulin kappa variable 3-11", "gene_name": "IGKV3-11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01602-1", "protein_name": "Immunoglobulin kappa variable 1-5", "gene_name": "IGKV1-5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8WV28-1", "protein_name": "B-cell linker protein", "gene_name": "BLNK", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14643-1", "protein_name": "Inositol 1,4,5-trisphosphate-gated calcium channel ITPR1", "gene_name": "ITPR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UN19-1", "protein_name": "Dual adapter for phosphotyrosine and 3-phosphotyrosine and 3-phosphoinositide", "gene_name": "DAPP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P43405-1", "protein_name": "Tyrosine-protein kinase SYK", "gene_name": "SYK", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96SN7-1", "protein_name": "Protein orai-2", "gene_name": "ORAI2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P15391-1", "protein_name": "B-lymphocyte antigen CD19", "gene_name": "CD19", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01871-2", "protein_name": "Immunoglobulin heavy constant mu", "gene_name": "IGHM", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13586-1", "protein_name": "Stromal interaction molecule 1", "gene_name": "STIM1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01767-1", "protein_name": "Immunoglobulin heavy variable 3-53", "gene_name": "IGHV3-53", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06331-1", "protein_name": "Immunoglobulin heavy variable 4-34", "gene_name": "IGHV4-34", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14571-1", "protein_name": "Inositol 1,4,5-trisphosphate-gated calcium channel ITPR2", "gene_name": "ITPR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01597-1", "protein_name": "Immunoglobulin kappa variable 1-39", "gene_name": "IGKV1-39", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06310-1", "protein_name": "Immunoglobulin kappa variable 2-30", "gene_name": "IGKV2-30", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06312-1", "protein_name": "Immunoglobulin kappa variable 4-1", "gene_name": "IGKV4-1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01614-1", "protein_name": "Immunoglobulin kappa variable 2D-40", "gene_name": "IGKV2D-40", "tax_name": "Human" }, { "uniprot_canonical_ac": "P48995-1", "protein_name": "Short transient receptor potential channel 1", "gene_name": "TRPC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DOY2-1", "protein_name": "Immunoglobulin lambda constant 2", "gene_name": "IGLC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6ZUJ8-1", "protein_name": "Phosphoinositide 3-kinase adapter protein 1", "gene_name": "PIK3AP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96D31-1", "protein_name": "Calcium release-activated calcium channel protein 1", "gene_name": "ORAI1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DP23-1", "protein_name": "Calmodulin-1", "gene_name": "CALM1; CALM2; CALM3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P29350-1", "protein_name": "Tyrosine-protein phosphatase non-receptor type 6", "gene_name": "PTPN6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P20273-1", "protein_name": "B-cell receptor CD22", "gene_name": "CD22", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04432-1", "protein_name": "Immunoglobulin kappa variable 1D-39", "gene_name": "IGKV1D-39", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06315-1", "protein_name": "Immunoglobulin kappa variable 5-2", "gene_name": "IGKV5-2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01699-1", "protein_name": "Immunoglobulin lambda variable 1-44", "gene_name": "IGLV1-44", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01701-1", "protein_name": "Immunoglobulin lambda variable 1-51", "gene_name": "IGLV1-51", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01704-1", "protein_name": "Immunoglobulin lambda variable 2-14", "gene_name": "IGLV2-14", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01706-1", "protein_name": "Immunoglobulin lambda variable 2-11", "gene_name": "IGLV2-11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01709-1", "protein_name": "Immunoglobulin lambda variable 2-8", "gene_name": "IGLV2-8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01717-1", "protein_name": "Immunoglobulin lambda variable 3-25", "gene_name": "IGLV3-25", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01721-1", "protein_name": "Immunoglobulin lambda variable 6-57", "gene_name": "IGLV6-57", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01703-1", "protein_name": "Immunoglobulin lambda variable 1-40", "gene_name": "IGLV1-40", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01705-1", "protein_name": "Immunoglobulin lambda variable 2-23", "gene_name": "IGLV2-23", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01715-1", "protein_name": "Immunoglobulin lambda variable 3-1", "gene_name": "IGLV3-1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01718-1", "protein_name": "Immunoglobulin lambda variable 3-27", "gene_name": "IGLV3-27", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04211-1", "protein_name": "Immunoglobulin lambda variable 7-43", "gene_name": "IGLV7-43", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q07889-1", "protein_name": "Son of sevenless homolog 1", "gene_name": "SOS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01880-2", "protein_name": "Immunoglobulin heavy constant delta", "gene_name": "IGHD", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CF74-1", "protein_name": "Immunoglobulin lambda constant 6", "gene_name": "IGLC6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q06187-1", "protein_name": "Tyrosine-protein kinase BTK", "gene_name": "BTK", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96B97-1", "protein_name": "SH3 domain-containing kinase-binding protein 1", "gene_name": "SH3KBP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P07948-1", "protein_name": "Tyrosine-protein kinase Lyn", "gene_name": "LYN", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51451-1", "protein_name": "Tyrosine-protein kinase Blk", "gene_name": "BLK", "tax_name": "Human" }, { "uniprot_canonical_ac": "P16885-1", "protein_name": "1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-2", "gene_name": "PLCG2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43865-1", "protein_name": "S-adenosylhomocysteine hydrolase-like protein 1", "gene_name": "AHCYL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01825-1", "protein_name": "Immunoglobulin heavy variable 4-59", "gene_name": "IGHV4-59", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01817-1", "protein_name": "Immunoglobulin heavy variable 2-5", "gene_name": "IGHV2-5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01824-1", "protein_name": "Immunoglobulin heavy variable 4-39", "gene_name": "IGHV4-39", "tax_name": "Human" }, { "uniprot_canonical_ac": "P23083-1", "protein_name": "Immunoglobulin heavy variable 1-2", "gene_name": "IGHV1-2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00329-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit delta isoform", "gene_name": "PIK3CD", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01742-1", "protein_name": "Immunoglobulin heavy variable 1-69", "gene_name": "IGHV1-69", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01768-1", "protein_name": "Immunoglobulin heavy variable 3-30", "gene_name": "IGHV3-30", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01814-1", "protein_name": "Immunoglobulin heavy variable 2-70", "gene_name": "IGHV2-70", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01772-1", "protein_name": "Immunoglobulin heavy variable 3-33", "gene_name": "IGHV3-33", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01762-1", "protein_name": "Immunoglobulin heavy variable 3-11", "gene_name": "IGHV3-11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01763-1", "protein_name": "Immunoglobulin heavy variable 3-48", "gene_name": "IGHV3-48", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01764-1", "protein_name": "Immunoglobulin heavy variable 3-23", "gene_name": "IGHV3-23", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01766-1", "protein_name": "Immunoglobulin heavy variable 3-13", "gene_name": "IGHV3-13", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01780-1", "protein_name": "Immunoglobulin heavy variable 3-7", "gene_name": "IGHV3-7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01782-1", "protein_name": "Immunoglobulin heavy variable 3-9", "gene_name": "IGHV3-9", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0M8Q6-1", "protein_name": "Immunoglobulin lambda constant 7", "gene_name": "IGLC7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01834-1", "protein_name": "Immunoglobulin kappa constant", "gene_name": "IGKC", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG04-1", "protein_name": "Immunoglobulin lambda constant 1", "gene_name": "IGLC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DOY3-1", "protein_name": "Immunoglobulin lambda constant 3", "gene_name": "IGLC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P11912-1", "protein_name": "B-cell antigen receptor complex-associated protein alpha chain", "gene_name": "CD79A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P40259-1", "protein_name": "B-cell antigen receptor complex-associated protein beta chain", "gene_name": "CD79B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01743-1", "protein_name": "Immunoglobulin heavy variable 1-46", "gene_name": "IGHV1-46", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14573-1", "protein_name": "Inositol 1,4,5-trisphosphate-gated calcium channel ITPR3", "gene_name": "ITPR3", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0C4DH73-1", "protein_name": "Immunoglobulin kappa variable 1-12", "gene_name": "IGKV1-12", "tax_name": "Human" }, { "uniprot_canonical_ac": "A2NJV5-1", "protein_name": "Immunoglobulin kappa variable 2-29", "gene_name": "IGKV2-29", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01594-1", "protein_name": "Immunoglobulin kappa variable 1-33", "gene_name": "IGKV1-33", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04430-1", "protein_name": "Immunoglobulin kappa variable 1-16", "gene_name": "IGKV1-16", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27986-1", "protein_name": "Phosphatidylinositol 3-kinase regulatory subunit alpha", "gene_name": "PIK3R1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06241-1", "protein_name": "Tyrosine-protein kinase Fyn", "gene_name": "FYN", "tax_name": "Human" }, { "uniprot_canonical_ac": "P16333-1", "protein_name": "SH2/SH3 adapter protein NCK1", "gene_name": "NCK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P15498-1", "protein_name": "Proto-oncogene vav", "gene_name": "VAV1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P01700", "url": "https://www.uniprot.org/uniprotkb/P01700" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.10051622", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 91 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Gab-family adapter proteins act downstream of cytokine and growth factor receptors and T- and B-cell antigen receptors.", "journal": "Blood", "date": "1999", "authors": "Nishida K, Yoshida Y, Itoh M, Fukada T, Ohtani T, Shirogane T, Atsumi T, Takahashi-Tezuka M, Ishihara K, Hibi M, Hirano T", "reference": { "type": "PubMed", "id": "10068651", "url": "https://pubmed.ncbi.nlm.nih.gov/10068651" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P01700-1", "protein_name": "Immunoglobulin lambda variable 1-47", "gene_name": "IGLV1-47", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01714-1", "protein_name": "Immunoglobulin lambda variable 3-19", "gene_name": "IGLV3-19", "tax_name": "Human" }, { "uniprot_canonical_ac": "P80748-1", "protein_name": "Immunoglobulin lambda variable 3-21", "gene_name": "IGLV3-21", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A075B6P5-1", "protein_name": "Immunoglobulin kappa variable 2-28", "gene_name": "IGKV2-28", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A075B6S6-1", "protein_name": "Immunoglobulin kappa variable 2D-30", "gene_name": "IGKV2D-30", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0C4DH25-1", "protein_name": "Immunoglobulin kappa variable 3D-20", "gene_name": "IGKV3D-20", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01593-1", "protein_name": "Immunoglobulin kappa variable 1D-33", "gene_name": "IGKV1D-33", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01599-1", "protein_name": "Immunoglobulin kappa variable 1-17", "gene_name": "IGKV1-17", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01601-1", "protein_name": "Immunoglobulin kappa variable 1D-16", "gene_name": "IGKV1D-16", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01611-1", "protein_name": "Immunoglobulin kappa variable 1D-12", "gene_name": "IGKV1D-12", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01615-1", "protein_name": "Immunoglobulin kappa variable 2D-28", "gene_name": "IGKV2D-28", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01619-1", "protein_name": "Immunoglobulin kappa variable 3-20", "gene_name": "IGKV3-20", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01624-1", "protein_name": "Immunoglobulin kappa variable 3-15", "gene_name": "IGKV3-15", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04433-1", "protein_name": "Immunoglobulin kappa variable 3-11", "gene_name": "IGKV3-11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01602-1", "protein_name": "Immunoglobulin kappa variable 1-5", "gene_name": "IGKV1-5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P43405-1", "protein_name": "Tyrosine-protein kinase SYK", "gene_name": "SYK", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Z1S8-1", "protein_name": "GRB2-associated-binding protein 2", "gene_name": "Gab2", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "Q60631-1", "protein_name": "Growth factor receptor-bound protein 2", "gene_name": "Grb2", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "P42336-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform", "gene_name": "PIK3CA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01362-1", "protein_name": "High affinity immunoglobulin epsilon receptor subunit beta", "gene_name": "MS4A2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P30273-1", "protein_name": "High affinity immunoglobulin epsilon receptor subunit gamma", "gene_name": "FCER1G", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01767-1", "protein_name": "Immunoglobulin heavy variable 3-53", "gene_name": "IGHV3-53", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06331-1", "protein_name": "Immunoglobulin heavy variable 4-34", "gene_name": "IGHV4-34", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01597-1", "protein_name": "Immunoglobulin kappa variable 1-39", "gene_name": "IGKV1-39", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06310-1", "protein_name": "Immunoglobulin kappa variable 2-30", "gene_name": "IGKV2-30", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06312-1", "protein_name": "Immunoglobulin kappa variable 4-1", "gene_name": "IGKV4-1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01614-1", "protein_name": "Immunoglobulin kappa variable 2D-40", "gene_name": "IGKV2D-40", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DOY2-1", "protein_name": "Immunoglobulin lambda constant 2", "gene_name": "IGLC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9GZY6-1", "protein_name": "Linker for activation of T-cells family member 2", "gene_name": "LAT2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04432-1", "protein_name": "Immunoglobulin kappa variable 1D-39", "gene_name": "IGKV1D-39", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06315-1", "protein_name": "Immunoglobulin kappa variable 5-2", "gene_name": "IGKV5-2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01699-1", "protein_name": "Immunoglobulin lambda variable 1-44", "gene_name": "IGLV1-44", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01701-1", "protein_name": "Immunoglobulin lambda variable 1-51", "gene_name": "IGLV1-51", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01704-1", "protein_name": "Immunoglobulin lambda variable 2-14", "gene_name": "IGLV2-14", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01706-1", "protein_name": "Immunoglobulin lambda variable 2-11", "gene_name": "IGLV2-11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01709-1", "protein_name": "Immunoglobulin lambda variable 2-8", "gene_name": "IGLV2-8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01717-1", "protein_name": "Immunoglobulin lambda variable 3-25", "gene_name": "IGLV3-25", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01721-1", "protein_name": "Immunoglobulin lambda variable 6-57", "gene_name": "IGLV6-57", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01703-1", "protein_name": "Immunoglobulin lambda variable 1-40", "gene_name": "IGLV1-40", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01705-1", "protein_name": "Immunoglobulin lambda variable 2-23", "gene_name": "IGLV2-23", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01715-1", "protein_name": "Immunoglobulin lambda variable 3-1", "gene_name": "IGLV3-1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01718-1", "protein_name": "Immunoglobulin lambda variable 3-27", "gene_name": "IGLV3-27", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04211-1", "protein_name": "Immunoglobulin lambda variable 7-43", "gene_name": "IGLV7-43", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q07889-1", "protein_name": "Son of sevenless homolog 1", "gene_name": "SOS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CF74-1", "protein_name": "Immunoglobulin lambda constant 6", "gene_name": "IGLC6", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00459-1", "protein_name": "Phosphatidylinositol 3-kinase regulatory subunit beta", "gene_name": "PIK3R2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q06124-2", "protein_name": "Tyrosine-protein phosphatase non-receptor type 11", "gene_name": "PTPN11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P07948-1", "protein_name": "Tyrosine-protein kinase Lyn", "gene_name": "LYN", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35235-2", "protein_name": "Tyrosine-protein phosphatase non-receptor type 11", "gene_name": "Ptpn11", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "P01825-1", "protein_name": "Immunoglobulin heavy variable 4-59", "gene_name": "IGHV4-59", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42338-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit beta isoform", "gene_name": "PIK3CB", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01817-1", "protein_name": "Immunoglobulin heavy variable 2-5", "gene_name": "IGHV2-5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01824-1", "protein_name": "Immunoglobulin heavy variable 4-39", "gene_name": "IGHV4-39", "tax_name": "Human" }, { "uniprot_canonical_ac": "P23083-1", "protein_name": "Immunoglobulin heavy variable 1-2", "gene_name": "IGHV1-2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01742-1", "protein_name": "Immunoglobulin heavy variable 1-69", "gene_name": "IGHV1-69", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01768-1", "protein_name": "Immunoglobulin heavy variable 3-30", "gene_name": "IGHV3-30", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01814-1", "protein_name": "Immunoglobulin heavy variable 2-70", "gene_name": "IGHV2-70", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01772-1", "protein_name": "Immunoglobulin heavy variable 3-33", "gene_name": "IGHV3-33", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01762-1", "protein_name": "Immunoglobulin heavy variable 3-11", "gene_name": "IGHV3-11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01763-1", "protein_name": "Immunoglobulin heavy variable 3-48", "gene_name": "IGHV3-48", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01764-1", "protein_name": "Immunoglobulin heavy variable 3-23", "gene_name": "IGHV3-23", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01766-1", "protein_name": "Immunoglobulin heavy variable 3-13", "gene_name": "IGHV3-13", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01780-1", "protein_name": "Immunoglobulin heavy variable 3-7", "gene_name": "IGHV3-7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01782-1", "protein_name": "Immunoglobulin heavy variable 3-9", "gene_name": "IGHV3-9", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0M8Q6-1", "protein_name": "Immunoglobulin lambda constant 7", "gene_name": "IGLC7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01834-1", "protein_name": "Immunoglobulin kappa constant", "gene_name": "IGKC", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG04-1", "protein_name": "Immunoglobulin lambda constant 1", "gene_name": "IGLC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DOY3-1", "protein_name": "Immunoglobulin lambda constant 3", "gene_name": "IGLC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01743-1", "protein_name": "Immunoglobulin heavy variable 1-46", "gene_name": "IGHV1-46", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01854-2", "protein_name": "Immunoglobulin heavy constant epsilon", "gene_name": "IGHE", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0C4DH73-1", "protein_name": "Immunoglobulin kappa variable 1-12", "gene_name": "IGKV1-12", "tax_name": "Human" }, { "uniprot_canonical_ac": "A2NJV5-1", "protein_name": "Immunoglobulin kappa variable 2-29", "gene_name": "IGKV2-29", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01594-1", "protein_name": "Immunoglobulin kappa variable 1-33", "gene_name": "IGKV1-33", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04430-1", "protein_name": "Immunoglobulin kappa variable 1-16", "gene_name": "IGKV1-16", "tax_name": "Human" }, { "uniprot_canonical_ac": "P12319-1", "protein_name": "High affinity immunoglobulin epsilon receptor subunit alpha", "gene_name": "FCER1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27986-1", "protein_name": "Phosphatidylinositol 3-kinase regulatory subunit alpha", "gene_name": "PIK3R1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06241-1", "protein_name": "Tyrosine-protein kinase Fyn", "gene_name": "FYN", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UQC2-1", "protein_name": "GRB2-associated-binding protein 2", "gene_name": "GAB2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15530-1", "protein_name": "3-phosphoinositide-dependent protein kinase 1", "gene_name": "PDPK1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P01700", "url": "https://www.uniprot.org/uniprotkb/P01700" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.10068651", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 79 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Cutting edge: a role for the adaptor protein LAT in human NK cell-mediated cytotoxicity.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "1999", "authors": "Jevremovic D, Billadeau DD, Schoon RA, Dick CJ, Irvin BJ, Zhang W, Samelson LE, Abraham RT, Leibson PJ", "reference": { "type": "PubMed", "id": "10072481", "url": "https://pubmed.ncbi.nlm.nih.gov/10072481" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P01700-1", "protein_name": "Immunoglobulin lambda variable 1-47", "gene_name": "IGLV1-47", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01714-1", "protein_name": "Immunoglobulin lambda variable 3-19", "gene_name": "IGLV3-19", "tax_name": "Human" }, { "uniprot_canonical_ac": "P80748-1", "protein_name": "Immunoglobulin lambda variable 3-21", "gene_name": "IGLV3-21", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A075B6P5-1", "protein_name": "Immunoglobulin kappa variable 2-28", "gene_name": "IGKV2-28", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A075B6S6-1", "protein_name": "Immunoglobulin kappa variable 2D-30", "gene_name": "IGKV2D-30", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0C4DH25-1", "protein_name": "Immunoglobulin kappa variable 3D-20", "gene_name": "IGKV3D-20", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01593-1", "protein_name": "Immunoglobulin kappa variable 1D-33", "gene_name": "IGKV1D-33", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01599-1", "protein_name": "Immunoglobulin kappa variable 1-17", "gene_name": "IGKV1-17", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01601-1", "protein_name": "Immunoglobulin kappa variable 1D-16", "gene_name": "IGKV1D-16", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01611-1", "protein_name": "Immunoglobulin kappa variable 1D-12", "gene_name": "IGKV1D-12", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01615-1", "protein_name": "Immunoglobulin kappa variable 2D-28", "gene_name": "IGKV2D-28", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01619-1", "protein_name": "Immunoglobulin kappa variable 3-20", "gene_name": "IGKV3-20", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01624-1", "protein_name": "Immunoglobulin kappa variable 3-15", "gene_name": "IGKV3-15", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04433-1", "protein_name": "Immunoglobulin kappa variable 3-11", "gene_name": "IGKV3-11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01602-1", "protein_name": "Immunoglobulin kappa variable 1-5", "gene_name": "IGKV1-5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01112-1", "protein_name": "GTPase HRas", "gene_name": "HRAS", "tax_name": "Human" }, { "uniprot_canonical_ac": "P43405-1", "protein_name": "Tyrosine-protein kinase SYK", "gene_name": "SYK", "tax_name": "Human" }, { "uniprot_canonical_ac": "P26717-1", "protein_name": "NKG2-C type II integral membrane protein", "gene_name": "KLRC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42336-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform", "gene_name": "PIK3CA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01362-1", "protein_name": "High affinity immunoglobulin epsilon receptor subunit beta", "gene_name": "MS4A2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P30273-1", "protein_name": "High affinity immunoglobulin epsilon receptor subunit gamma", "gene_name": "FCER1G", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01767-1", "protein_name": "Immunoglobulin heavy variable 3-53", "gene_name": "IGHV3-53", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06331-1", "protein_name": "Immunoglobulin heavy variable 4-34", "gene_name": "IGHV4-34", "tax_name": "Human" }, { "uniprot_canonical_ac": "P26718-1", "protein_name": "NKG2-D type II integral membrane protein", "gene_name": "KLRK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01597-1", "protein_name": "Immunoglobulin kappa variable 1-39", "gene_name": "IGKV1-39", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06310-1", "protein_name": "Immunoglobulin kappa variable 2-30", "gene_name": "IGKV2-30", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06312-1", "protein_name": "Immunoglobulin kappa variable 4-1", "gene_name": "IGKV4-1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01614-1", "protein_name": "Immunoglobulin kappa variable 2D-40", "gene_name": "IGKV2D-40", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01111-1", "protein_name": "GTPase NRas", "gene_name": "NRAS", "tax_name": "Human" }, { "uniprot_canonical_ac": "P13747-1", "protein_name": "HLA class I histocompatibility antigen, alpha chain E", "gene_name": "HLA-E", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DOY2-1", "protein_name": "Immunoglobulin lambda constant 2", "gene_name": "IGLC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43561-1", "protein_name": "Linker for activation of T-cells family member 1", "gene_name": "LAT", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75791-1", "protein_name": "GRB2-related adapter protein 2", "gene_name": "GRAP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04432-1", "protein_name": "Immunoglobulin kappa variable 1D-39", "gene_name": "IGKV1D-39", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06315-1", "protein_name": "Immunoglobulin kappa variable 5-2", "gene_name": "IGKV5-2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01699-1", "protein_name": "Immunoglobulin lambda variable 1-44", "gene_name": "IGLV1-44", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01701-1", "protein_name": "Immunoglobulin lambda variable 1-51", "gene_name": "IGLV1-51", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01704-1", "protein_name": "Immunoglobulin lambda variable 2-14", "gene_name": "IGLV2-14", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01706-1", "protein_name": "Immunoglobulin lambda variable 2-11", "gene_name": "IGLV2-11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01709-1", "protein_name": "Immunoglobulin lambda variable 2-8", "gene_name": "IGLV2-8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01717-1", "protein_name": "Immunoglobulin lambda variable 3-25", "gene_name": "IGLV3-25", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01721-1", "protein_name": "Immunoglobulin lambda variable 6-57", "gene_name": "IGLV6-57", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01703-1", "protein_name": "Immunoglobulin lambda variable 1-40", "gene_name": "IGLV1-40", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01705-1", "protein_name": "Immunoglobulin lambda variable 2-23", "gene_name": "IGLV2-23", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01715-1", "protein_name": "Immunoglobulin lambda variable 3-1", "gene_name": "IGLV3-1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01718-1", "protein_name": "Immunoglobulin lambda variable 3-27", "gene_name": "IGLV3-27", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04211-1", "protein_name": "Immunoglobulin lambda variable 7-43", "gene_name": "IGLV7-43", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13241-1", "protein_name": "Natural killer cells antigen CD94", "gene_name": "KLRD1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q07889-1", "protein_name": "Son of sevenless homolog 1", "gene_name": "SOS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CF74-1", "protein_name": "Immunoglobulin lambda constant 6", "gene_name": "IGLC6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q06187-1", "protein_name": "Tyrosine-protein kinase BTK", "gene_name": "BTK", "tax_name": "Human" }, { "uniprot_canonical_ac": "P52735-1", "protein_name": "Guanine nucleotide exchange factor VAV2", "gene_name": "VAV2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61769-1", "protein_name": "Beta-2-microglobulin", "gene_name": "B2M", "tax_name": "Human" }, { "uniprot_canonical_ac": "P63000-1", "protein_name": "Ras-related C3 botulinum toxin substrate 1", "gene_name": "RAC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00459-1", "protein_name": "Phosphatidylinositol 3-kinase regulatory subunit beta", "gene_name": "PIK3R2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06239-1", "protein_name": "Tyrosine-protein kinase Lck", "gene_name": "LCK", "tax_name": "Human" }, { "uniprot_canonical_ac": "P07948-1", "protein_name": "Tyrosine-protein kinase Lyn", "gene_name": "LYN", "tax_name": "Human" }, { "uniprot_canonical_ac": "P16885-1", "protein_name": "1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-2", "gene_name": "PLCG2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UKW4-1", "protein_name": "Guanine nucleotide exchange factor VAV3", "gene_name": "VAV3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01825-1", "protein_name": "Immunoglobulin heavy variable 4-59", "gene_name": "IGHV4-59", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42338-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit beta isoform", "gene_name": "PIK3CB", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01817-1", "protein_name": "Immunoglobulin heavy variable 2-5", "gene_name": "IGHV2-5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01824-1", "protein_name": "Immunoglobulin heavy variable 4-39", "gene_name": "IGHV4-39", "tax_name": "Human" }, { "uniprot_canonical_ac": "P23083-1", "protein_name": "Immunoglobulin heavy variable 1-2", "gene_name": "IGHV1-2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43914-1", "protein_name": "TYRO protein tyrosine kinase-binding protein", "gene_name": "TYROBP", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01742-1", "protein_name": "Immunoglobulin heavy variable 1-69", "gene_name": "IGHV1-69", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01768-1", "protein_name": "Immunoglobulin heavy variable 3-30", "gene_name": "IGHV3-30", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01814-1", "protein_name": "Immunoglobulin heavy variable 2-70", "gene_name": "IGHV2-70", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01772-1", "protein_name": "Immunoglobulin heavy variable 3-33", "gene_name": "IGHV3-33", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01762-1", "protein_name": "Immunoglobulin heavy variable 3-11", "gene_name": "IGHV3-11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01763-1", "protein_name": "Immunoglobulin heavy variable 3-48", "gene_name": "IGHV3-48", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01764-1", "protein_name": "Immunoglobulin heavy variable 3-23", "gene_name": "IGHV3-23", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01766-1", "protein_name": "Immunoglobulin heavy variable 3-13", "gene_name": "IGHV3-13", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01780-1", "protein_name": "Immunoglobulin heavy variable 3-7", "gene_name": "IGHV3-7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01782-1", "protein_name": "Immunoglobulin heavy variable 3-9", "gene_name": "IGHV3-9", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0M8Q6-1", "protein_name": "Immunoglobulin lambda constant 7", "gene_name": "IGLC7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01834-1", "protein_name": "Immunoglobulin kappa constant", "gene_name": "IGKC", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG04-1", "protein_name": "Immunoglobulin lambda constant 1", "gene_name": "IGLC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DOY3-1", "protein_name": "Immunoglobulin lambda constant 3", "gene_name": "IGLC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NZC2-1", "protein_name": "Triggering receptor expressed on myeloid cells 2", "gene_name": "TREM2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13094-1", "protein_name": "Lymphocyte cytosolic protein 2", "gene_name": "LCP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01743-1", "protein_name": "Immunoglobulin heavy variable 1-46", "gene_name": "IGHV1-46", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01854-2", "protein_name": "Immunoglobulin heavy constant epsilon", "gene_name": "IGHE", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0C4DH73-1", "protein_name": "Immunoglobulin kappa variable 1-12", "gene_name": "IGKV1-12", "tax_name": "Human" }, { "uniprot_canonical_ac": "A2NJV5-1", "protein_name": "Immunoglobulin kappa variable 2-29", "gene_name": "IGKV2-29", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01594-1", "protein_name": "Immunoglobulin kappa variable 1-33", "gene_name": "IGKV1-33", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04430-1", "protein_name": "Immunoglobulin kappa variable 1-16", "gene_name": "IGKV1-16", "tax_name": "Human" }, { "uniprot_canonical_ac": "P12319-1", "protein_name": "High affinity immunoglobulin epsilon receptor subunit alpha", "gene_name": "FCER1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27986-1", "protein_name": "Phosphatidylinositol 3-kinase regulatory subunit alpha", "gene_name": "PIK3R1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P19174-1", "protein_name": "1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-1", "gene_name": "PLCG1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06241-1", "protein_name": "Tyrosine-protein kinase Fyn", "gene_name": "FYN", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P01700", "url": "https://www.uniprot.org/uniprotkb/P01700" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.10072481", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 91 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The binding and transport of heme by hemopexin.", "journal": "Annals of clinical research", "date": "1976", "authors": "Morgan WT", "reference": { "type": "PubMed", "id": "1008494", "url": "https://pubmed.ncbi.nlm.nih.gov/1008494" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P01700-1", "protein_name": "Immunoglobulin lambda variable 1-47", "gene_name": "IGLV1-47", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01714-1", "protein_name": "Immunoglobulin lambda variable 3-19", "gene_name": "IGLV3-19", "tax_name": "Human" }, { "uniprot_canonical_ac": "P80748-1", "protein_name": "Immunoglobulin lambda variable 3-21", "gene_name": "IGLV3-21", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A075B6P5-1", "protein_name": "Immunoglobulin kappa variable 2-28", "gene_name": "IGKV2-28", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A075B6S6-1", "protein_name": "Immunoglobulin kappa variable 2D-30", "gene_name": "IGKV2D-30", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0C4DH25-1", "protein_name": "Immunoglobulin kappa variable 3D-20", "gene_name": "IGKV3D-20", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01593-1", "protein_name": "Immunoglobulin kappa variable 1D-33", "gene_name": "IGKV1D-33", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01599-1", "protein_name": "Immunoglobulin kappa variable 1-17", "gene_name": "IGKV1-17", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01601-1", "protein_name": "Immunoglobulin kappa variable 1D-16", "gene_name": "IGKV1D-16", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01611-1", "protein_name": "Immunoglobulin kappa variable 1D-12", "gene_name": "IGKV1D-12", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01615-1", "protein_name": "Immunoglobulin kappa variable 2D-28", "gene_name": "IGKV2D-28", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01619-1", "protein_name": "Immunoglobulin kappa variable 3-20", "gene_name": "IGKV3-20", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01624-1", "protein_name": "Immunoglobulin kappa variable 3-15", "gene_name": "IGKV3-15", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04433-1", "protein_name": "Immunoglobulin kappa variable 3-11", "gene_name": "IGKV3-11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01602-1", "protein_name": "Immunoglobulin kappa variable 1-5", "gene_name": "IGKV1-5", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14791-1", "protein_name": "Apolipoprotein L1", "gene_name": "APOL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P02760-1", "protein_name": "Protein AMBP", "gene_name": "AMBP", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q07954-1", "protein_name": "Prolow-density lipoprotein receptor-related protein 1", "gene_name": "LRP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P00739-1", "protein_name": "Haptoglobin-related protein", "gene_name": "HPR", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01767-1", "protein_name": "Immunoglobulin heavy variable 3-53", "gene_name": "IGHV3-53", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06331-1", "protein_name": "Immunoglobulin heavy variable 4-34", "gene_name": "IGHV4-34", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01597-1", "protein_name": "Immunoglobulin kappa variable 1-39", "gene_name": "IGKV1-39", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06310-1", "protein_name": "Immunoglobulin kappa variable 2-30", "gene_name": "IGKV2-30", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06312-1", "protein_name": "Immunoglobulin kappa variable 4-1", "gene_name": "IGKV4-1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01614-1", "protein_name": "Immunoglobulin kappa variable 2D-40", "gene_name": "IGKV2D-40", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DOY2-1", "protein_name": "Immunoglobulin lambda constant 2", "gene_name": "IGLC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86VB7-1", "protein_name": "Scavenger receptor cysteine-rich type 1 protein M130", "gene_name": "CD163", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04432-1", "protein_name": "Immunoglobulin kappa variable 1D-39", "gene_name": "IGKV1D-39", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06315-1", "protein_name": "Immunoglobulin kappa variable 5-2", "gene_name": "IGKV5-2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01699-1", "protein_name": "Immunoglobulin lambda variable 1-44", "gene_name": "IGLV1-44", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01701-1", "protein_name": "Immunoglobulin lambda variable 1-51", "gene_name": "IGLV1-51", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01704-1", "protein_name": "Immunoglobulin lambda variable 2-14", "gene_name": "IGLV2-14", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01706-1", "protein_name": "Immunoglobulin lambda variable 2-11", "gene_name": "IGLV2-11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01709-1", "protein_name": "Immunoglobulin lambda variable 2-8", "gene_name": "IGLV2-8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01717-1", "protein_name": "Immunoglobulin lambda variable 3-25", "gene_name": "IGLV3-25", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01721-1", "protein_name": "Immunoglobulin lambda variable 6-57", "gene_name": "IGLV6-57", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01703-1", "protein_name": "Immunoglobulin lambda variable 1-40", "gene_name": "IGLV1-40", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01705-1", "protein_name": "Immunoglobulin lambda variable 2-23", "gene_name": "IGLV2-23", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01715-1", "protein_name": "Immunoglobulin lambda variable 3-1", "gene_name": "IGLV3-1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01718-1", "protein_name": "Immunoglobulin lambda variable 3-27", "gene_name": "IGLV3-27", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04211-1", "protein_name": "Immunoglobulin lambda variable 7-43", "gene_name": "IGLV7-43", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01876-2", "protein_name": "Immunoglobulin heavy constant alpha 1", "gene_name": "IGHA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CF74-1", "protein_name": "Immunoglobulin lambda constant 6", "gene_name": "IGLC6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P69905-1", "protein_name": "Hemoglobin subunit alpha", "gene_name": "HBA1; HBA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P02768-1", "protein_name": "Albumin", "gene_name": "ALB", "tax_name": "Human" }, { "uniprot_canonical_ac": "P00738-1", "protein_name": "Haptoglobin", "gene_name": "HP", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01825-1", "protein_name": "Immunoglobulin heavy variable 4-59", "gene_name": "IGHV4-59", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01817-1", "protein_name": "Immunoglobulin heavy variable 2-5", "gene_name": "IGHV2-5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01824-1", "protein_name": "Immunoglobulin heavy variable 4-39", "gene_name": "IGHV4-39", "tax_name": "Human" }, { "uniprot_canonical_ac": "P23083-1", "protein_name": "Immunoglobulin heavy variable 1-2", "gene_name": "IGHV1-2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68871-1", "protein_name": "Hemoglobin subunit beta", "gene_name": "HBB", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01742-1", "protein_name": "Immunoglobulin heavy variable 1-69", "gene_name": "IGHV1-69", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01768-1", "protein_name": "Immunoglobulin heavy variable 3-30", "gene_name": "IGHV3-30", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01814-1", "protein_name": "Immunoglobulin heavy variable 2-70", "gene_name": "IGHV2-70", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01772-1", "protein_name": "Immunoglobulin heavy variable 3-33", "gene_name": "IGHV3-33", "tax_name": "Human" }, { "uniprot_canonical_ac": "P02790-1", "protein_name": "Hemopexin", "gene_name": "HPX", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01762-1", "protein_name": "Immunoglobulin heavy variable 3-11", "gene_name": "IGHV3-11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01763-1", "protein_name": "Immunoglobulin heavy variable 3-48", "gene_name": "IGHV3-48", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01764-1", "protein_name": "Immunoglobulin heavy variable 3-23", "gene_name": "IGHV3-23", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01766-1", "protein_name": "Immunoglobulin heavy variable 3-13", "gene_name": "IGHV3-13", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01780-1", "protein_name": "Immunoglobulin heavy variable 3-7", "gene_name": "IGHV3-7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01782-1", "protein_name": "Immunoglobulin heavy variable 3-9", "gene_name": "IGHV3-9", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01877-2", "protein_name": "Immunoglobulin heavy constant alpha 2", "gene_name": "IGHA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01591-1", "protein_name": "Immunoglobulin J chain", "gene_name": "JCHAIN", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0M8Q6-1", "protein_name": "Immunoglobulin lambda constant 7", "gene_name": "IGLC7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01834-1", "protein_name": "Immunoglobulin kappa constant", "gene_name": "IGKC", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG04-1", "protein_name": "Immunoglobulin lambda constant 1", "gene_name": "IGLC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DOY3-1", "protein_name": "Immunoglobulin lambda constant 3", "gene_name": "IGLC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01743-1", "protein_name": "Immunoglobulin heavy variable 1-46", "gene_name": "IGHV1-46", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0C4DH73-1", "protein_name": "Immunoglobulin kappa variable 1-12", "gene_name": "IGKV1-12", "tax_name": "Human" }, { "uniprot_canonical_ac": "A2NJV5-1", "protein_name": "Immunoglobulin kappa variable 2-29", "gene_name": "IGKV2-29", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01594-1", "protein_name": "Immunoglobulin kappa variable 1-33", "gene_name": "IGKV1-33", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04430-1", "protein_name": "Immunoglobulin kappa variable 1-16", "gene_name": "IGKV1-16", "tax_name": "Human" }, { "uniprot_canonical_ac": "P02647-1", "protein_name": "Apolipoprotein A-I", "gene_name": "APOA1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P01700", "url": "https://www.uniprot.org/uniprotkb/P01700" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.1008494", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 74 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Molecular and ligand-binding characterization of the sigma-receptor in the Jurkat human T lymphocyte cell line.", "journal": "The Journal of pharmacology and experimental therapeutics", "date": "1999", "authors": "Ganapathy ME, Prasad PD, Huang W, Seth P, Leibach FH, Ganapathy V", "reference": { "type": "PubMed", "id": "10087012", "url": "https://pubmed.ncbi.nlm.nih.gov/10087012" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P01700-1", "protein_name": "Immunoglobulin lambda variable 1-47", "gene_name": "IGLV1-47", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01714-1", "protein_name": "Immunoglobulin lambda variable 3-19", "gene_name": "IGLV3-19", "tax_name": "Human" }, { "uniprot_canonical_ac": "P80748-1", "protein_name": "Immunoglobulin lambda variable 3-21", "gene_name": "IGLV3-21", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A075B6P5-1", "protein_name": "Immunoglobulin kappa variable 2-28", "gene_name": "IGKV2-28", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A075B6S6-1", "protein_name": "Immunoglobulin kappa variable 2D-30", "gene_name": "IGKV2D-30", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0C4DH25-1", "protein_name": "Immunoglobulin kappa variable 3D-20", "gene_name": "IGKV3D-20", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01593-1", "protein_name": "Immunoglobulin kappa variable 1D-33", "gene_name": "IGKV1D-33", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01599-1", "protein_name": "Immunoglobulin kappa variable 1-17", "gene_name": "IGKV1-17", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01601-1", "protein_name": "Immunoglobulin kappa variable 1D-16", "gene_name": "IGKV1D-16", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01611-1", "protein_name": "Immunoglobulin kappa variable 1D-12", "gene_name": "IGKV1D-12", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01615-1", "protein_name": "Immunoglobulin kappa variable 2D-28", "gene_name": "IGKV2D-28", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01619-1", "protein_name": "Immunoglobulin kappa variable 3-20", "gene_name": "IGKV3-20", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01624-1", "protein_name": "Immunoglobulin kappa variable 3-15", "gene_name": "IGKV3-15", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04433-1", "protein_name": "Immunoglobulin kappa variable 3-11", "gene_name": "IGKV3-11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01602-1", "protein_name": "Immunoglobulin kappa variable 1-5", "gene_name": "IGKV1-5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8WV28-1", "protein_name": "B-cell linker protein", "gene_name": "BLNK", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UHD2-1", "protein_name": "Serine/threonine-protein kinase TBK1", "gene_name": "TBK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P58549-1", "protein_name": "FXYD domain-containing ion transport regulator 7", "gene_name": "FXYD7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15185-1", "protein_name": "Prostaglandin E synthase 3", "gene_name": "PTGES3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04150-1", "protein_name": "Glucocorticoid receptor", "gene_name": "NR3C1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95782-1", "protein_name": "AP-2 complex subunit alpha-1", "gene_name": "AP2A1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q4LE39-1", "protein_name": "AT-rich interactive domain-containing protein 4B", "gene_name": "ARID4B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13546-1", "protein_name": "Receptor-interacting serine/threonine-protein kinase 1", "gene_name": "RIPK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13330-1", "protein_name": "Metastasis-associated protein MTA1", "gene_name": "MTA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P29374-1", "protein_name": "AT-rich interactive domain-containing protein 4A", "gene_name": "ARID4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P43405-1", "protein_name": "Tyrosine-protein kinase SYK", "gene_name": "SYK", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13547-1", "protein_name": "Histone deacetylase 1", "gene_name": "HDAC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86YP4-1", "protein_name": "Transcriptional repressor p66-alpha", "gene_name": "GATAD2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P21453-1", "protein_name": "Sphingosine 1-phosphate receptor 1", "gene_name": "S1PR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01871-2", "protein_name": "Immunoglobulin heavy constant mu", "gene_name": "IGHM", "tax_name": "Human" }, { "uniprot_canonical_ac": "P21964-1", "protein_name": "Catechol O-methyltransferase", "gene_name": "COMT", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16576-1", "protein_name": "Histone-binding protein RBBP7", "gene_name": "RBBP7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49354-1", "protein_name": "Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha", "gene_name": "FNTA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P09958-1", "protein_name": "Furin", "gene_name": "FURIN", "tax_name": "Human" }, { "uniprot_canonical_ac": "P14778-1", "protein_name": "Interleukin-1 receptor type 1", "gene_name": "IL1R1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P38484-1", "protein_name": "Interferon gamma receptor 2", "gene_name": "IFNGR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01767-1", "protein_name": "Immunoglobulin heavy variable 3-53", "gene_name": "IGHV3-53", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06331-1", "protein_name": "Immunoglobulin heavy variable 4-34", "gene_name": "IGHV4-34", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60674-1", "protein_name": "Tyrosine-protein kinase JAK2", "gene_name": "JAK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01597-1", "protein_name": "Immunoglobulin kappa variable 1-39", "gene_name": "IGKV1-39", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06310-1", "protein_name": "Immunoglobulin kappa variable 2-30", "gene_name": "IGKV2-30", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06312-1", "protein_name": "Immunoglobulin kappa variable 4-1", "gene_name": "IGKV4-1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01614-1", "protein_name": "Immunoglobulin kappa variable 2D-40", "gene_name": "IGKV2D-40", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HAJ7-1", "protein_name": "Histone deacetylase complex subunit SAP30L", "gene_name": "SAP30L", "tax_name": "Human" }, { "uniprot_canonical_ac": "P08887-1", "protein_name": "Interleukin-6 receptor subunit alpha", "gene_name": "IL6R", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DOY2-1", "protein_name": "Immunoglobulin lambda constant 2", "gene_name": "IGLC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P15260-1", "protein_name": "Interferon gamma receptor 1", "gene_name": "IFNGR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75446-1", "protein_name": "Histone deacetylase complex subunit SAP30", "gene_name": "SAP30", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13464-1", "protein_name": "Rho-associated protein kinase 1", "gene_name": "ROCK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75116-1", "protein_name": "Rho-associated protein kinase 2", "gene_name": "ROCK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05023-1", "protein_name": "Sodium/potassium-transporting ATPase subunit alpha-1", "gene_name": "ATP1A1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P54710-1", "protein_name": "Sodium/potassium-transporting ATPase subunit gamma", "gene_name": "FXYD2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P13637-1", "protein_name": "Sodium/potassium-transporting ATPase subunit alpha-3", "gene_name": "ATP1A3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P14415-1", "protein_name": "Sodium/potassium-transporting ATPase subunit beta-2", "gene_name": "ATP1B2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05026-1", "protein_name": "Sodium/potassium-transporting ATPase subunit beta-1", "gene_name": "ATP1B1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P50993-1", "protein_name": "Sodium/potassium-transporting ATPase subunit alpha-2", "gene_name": "ATP1A2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P54709-1", "protein_name": "Sodium/potassium-transporting ATPase subunit beta-3", "gene_name": "ATP1B3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13733-1", "protein_name": "Sodium/potassium-transporting ATPase subunit alpha-4", "gene_name": "ATP1A4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9P0W2-1", "protein_name": "SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily E member 1-related", "gene_name": "HMG20B", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95983-1", "protein_name": "Methyl-CpG-binding domain protein 3", "gene_name": "MBD3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14839-1", "protein_name": "ATP-dependent chromatin remodeler CHD4", "gene_name": "CHD4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y271-1", "protein_name": "Cysteinyl leukotriene receptor 1", "gene_name": "CYSLTR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04432-1", "protein_name": "Immunoglobulin kappa variable 1D-39", "gene_name": "IGKV1D-39", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06315-1", "protein_name": "Immunoglobulin kappa variable 5-2", "gene_name": "IGKV5-2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01699-1", "protein_name": "Immunoglobulin lambda variable 1-44", "gene_name": "IGLV1-44", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01701-1", "protein_name": "Immunoglobulin lambda variable 1-51", "gene_name": "IGLV1-51", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01704-1", "protein_name": "Immunoglobulin lambda variable 2-14", "gene_name": "IGLV2-14", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01706-1", "protein_name": "Immunoglobulin lambda variable 2-11", "gene_name": "IGLV2-11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01709-1", "protein_name": "Immunoglobulin lambda variable 2-8", "gene_name": "IGLV2-8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01717-1", "protein_name": "Immunoglobulin lambda variable 3-25", "gene_name": "IGLV3-25", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01721-1", "protein_name": "Immunoglobulin lambda variable 6-57", "gene_name": "IGLV6-57", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01703-1", "protein_name": "Immunoglobulin lambda variable 1-40", "gene_name": "IGLV1-40", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01705-1", "protein_name": "Immunoglobulin lambda variable 2-23", "gene_name": "IGLV2-23", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01715-1", "protein_name": "Immunoglobulin lambda variable 3-1", "gene_name": "IGLV3-1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01718-1", "protein_name": "Immunoglobulin lambda variable 3-27", "gene_name": "IGLV3-27", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04211-1", "protein_name": "Immunoglobulin lambda variable 7-43", "gene_name": "IGLV7-43", "tax_name": "Human" }, { "uniprot_canonical_ac": "P12268-1", "protein_name": "Inosine-5'-monophosphate dehydrogenase 2", "gene_name": "IMPDH2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P52333-1", "protein_name": "Tyrosine-protein kinase JAK3", "gene_name": "JAK3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P07437-1", "protein_name": "Tubulin beta chain", "gene_name": "TUBB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16236-1", "protein_name": "Nuclear factor erythroid 2-related factor 2", "gene_name": "NFE2L2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99720-1", "protein_name": "Sigma non-opioid intracellular receptor 1", "gene_name": "SIGMAR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q07889-1", "protein_name": "Son of sevenless homolog 1", "gene_name": "SOS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62877-1", "protein_name": "E3 ubiquitin-protein ligase RBX1", "gene_name": "RBX1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q09028-1", "protein_name": "Histone-binding protein RBBP4", "gene_name": "RBBP4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P52630-3", "protein_name": "Signal transducer and activator of transcription 2", "gene_name": "STAT2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01880-2", "protein_name": "Immunoglobulin heavy constant delta", "gene_name": "IGHD", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CF74-1", "protein_name": "Immunoglobulin lambda constant 6", "gene_name": "IGLC6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15116-1", "protein_name": "Programmed cell death protein 1", "gene_name": "PDCD1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NYK1-1", "protein_name": "Toll-like receptor 7", "gene_name": "TLR7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P08238-1", "protein_name": "Heat shock protein HSP 90-beta", "gene_name": "HSP90AB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BYF1-1", "protein_name": "Angiotensin-converting enzyme 2", "gene_name": "ACE2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q06187-1", "protein_name": "Tyrosine-protein kinase BTK", "gene_name": "BTK", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96B97-1", "protein_name": "SH3 domain-containing kinase-binding protein 1", "gene_name": "SH3KBP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P63010-1", "protein_name": "AP-2 complex subunit beta", "gene_name": "AP2B1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62942-1", "protein_name": "Peptidyl-prolyl cis-trans isomerase FKBP1A", "gene_name": "FKBP1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13618-1", "protein_name": "Cullin-3", "gene_name": "CUL3", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60341-1", "protein_name": "Lysine-specific histone demethylase 1A", "gene_name": "KDM1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P13612-1", "protein_name": "Integrin alpha-4", "gene_name": "ITGA4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P07900-1", "protein_name": "Heat shock protein HSP 90-alpha", "gene_name": "HSP90AA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96CW1-1", "protein_name": "AP-2 complex subunit mu", "gene_name": "AP2M1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q02790-1", "protein_name": "Peptidyl-prolyl cis-trans isomerase FKBP4", "gene_name": "FKBP4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P16885-1", "protein_name": "1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-2", "gene_name": "PLCG2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05556-1", "protein_name": "Integrin beta-1", "gene_name": "ITGB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96SW2-1", "protein_name": "Protein cereblon", "gene_name": "CRBN", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H0Q3-1", "protein_name": "FXYD domain-containing ion transport regulator 6", "gene_name": "FXYD6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P29597-1", "protein_name": "Non-receptor tyrosine-protein kinase TYK2", "gene_name": "TYK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14802-1", "protein_name": "FXYD domain-containing ion transport regulator 3", "gene_name": "FXYD3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P59646-1", "protein_name": "FXYD domain-containing ion transport regulator 4", "gene_name": "FXYD4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96BD5-1", "protein_name": "PHD finger protein 21A", "gene_name": "PHF21A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12873-1", "protein_name": "ATP-dependent chromatin remodeler CHD3", "gene_name": "CHD3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HCU9-1", "protein_name": "Breast cancer metastasis-suppressor 1", "gene_name": "BRMS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H7L9-1", "protein_name": "Sin3 histone deacetylase corepressor complex component SDS3", "gene_name": "SUDS3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92769-1", "protein_name": "Histone deacetylase 2", "gene_name": "HDAC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60885-1", "protein_name": "Bromodomain-containing protein 4", "gene_name": "BRD4", "tax_name": "Human" }, { "uniprot_canonical_ac": "O94776-1", "protein_name": "Metastasis-associated protein MTA2", "gene_name": "MTA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BTC8-1", "protein_name": "Metastasis-associated protein MTA3", "gene_name": "MTA3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01825-1", "protein_name": "Immunoglobulin heavy variable 4-59", "gene_name": "IGHV4-59", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01817-1", "protein_name": "Immunoglobulin heavy variable 2-5", "gene_name": "IGHV2-5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01824-1", "protein_name": "Immunoglobulin heavy variable 4-39", "gene_name": "IGHV4-39", "tax_name": "Human" }, { "uniprot_canonical_ac": "P23083-1", "protein_name": "Immunoglobulin heavy variable 1-2", "gene_name": "IGHV1-2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00168-1", "protein_name": "Phospholemman", "gene_name": "FXYD1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00422-1", "protein_name": "Histone deacetylase complex subunit SAP18", "gene_name": "SAP18", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01742-1", "protein_name": "Immunoglobulin heavy variable 1-69", "gene_name": "IGHV1-69", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01768-1", "protein_name": "Immunoglobulin heavy variable 3-30", "gene_name": "IGHV3-30", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01814-1", "protein_name": "Immunoglobulin heavy variable 2-70", "gene_name": "IGHV2-70", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UKL0-1", "protein_name": "REST corepressor 1", "gene_name": "RCOR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01772-1", "protein_name": "Immunoglobulin heavy variable 3-33", "gene_name": "IGHV3-33", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01762-1", "protein_name": "Immunoglobulin heavy variable 3-11", "gene_name": "IGHV3-11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01763-1", "protein_name": "Immunoglobulin heavy variable 3-48", "gene_name": "IGHV3-48", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01764-1", "protein_name": "Immunoglobulin heavy variable 3-23", "gene_name": "IGHV3-23", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01766-1", "protein_name": "Immunoglobulin heavy variable 3-13", "gene_name": "IGHV3-13", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01780-1", "protein_name": "Immunoglobulin heavy variable 3-7", "gene_name": "IGHV3-7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01782-1", "protein_name": "Immunoglobulin heavy variable 3-9", "gene_name": "IGHV3-9", "tax_name": "Human" }, { "uniprot_canonical_ac": "P20839-1", "protein_name": "Inosine-5'-monophosphate dehydrogenase 1", "gene_name": "IMPDH1", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0M8Q6-1", "protein_name": "Immunoglobulin lambda constant 7", "gene_name": "IGLC7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01834-1", "protein_name": "Immunoglobulin kappa constant", "gene_name": "IGKC", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG04-1", "protein_name": "Immunoglobulin lambda constant 1", "gene_name": "IGLC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DOY3-1", "protein_name": "Immunoglobulin lambda constant 3", "gene_name": "IGLC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NR96-1", "protein_name": "Toll-like receptor 9", "gene_name": "TLR9", "tax_name": "Human" }, { "uniprot_canonical_ac": "P11912-1", "protein_name": "B-cell antigen receptor complex-associated protein alpha chain", "gene_name": "CD79A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P40259-1", "protein_name": "B-cell antigen receptor complex-associated protein beta chain", "gene_name": "CD79B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49356-1", "protein_name": "Protein farnesyltransferase subunit beta", "gene_name": "FNTB", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01743-1", "protein_name": "Immunoglobulin heavy variable 1-46", "gene_name": "IGHV1-46", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H171-1", "protein_name": "Z-DNA-binding protein 1", "gene_name": "ZBP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0C4DH73-1", "protein_name": "Immunoglobulin kappa variable 1-12", "gene_name": "IGKV1-12", "tax_name": "Human" }, { "uniprot_canonical_ac": "A2NJV5-1", "protein_name": "Immunoglobulin kappa variable 2-29", "gene_name": "IGKV2-29", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01594-1", "protein_name": "Immunoglobulin kappa variable 1-33", "gene_name": "IGKV1-33", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04430-1", "protein_name": "Immunoglobulin kappa variable 1-16", "gene_name": "IGKV1-16", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13127-1", "protein_name": "RE1-silencing transcription factor", "gene_name": "REST", "tax_name": "Human" }, { "uniprot_canonical_ac": "P23458-1", "protein_name": "Tyrosine-protein kinase JAK1", "gene_name": "JAK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P17181-1", "protein_name": "Interferon alpha/beta receptor 1", "gene_name": "IFNAR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P53680-1", "protein_name": "AP-2 complex subunit sigma", "gene_name": "AP2S1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O94973-1", "protein_name": "AP-2 complex subunit alpha-2", "gene_name": "AP2A2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P16333-1", "protein_name": "SH2/SH3 adapter protein NCK1", "gene_name": "NCK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8WXI9-1", "protein_name": "Transcriptional repressor p66-beta", "gene_name": "GATAD2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14145-1", "protein_name": "Kelch-like ECH-associated protein 1", "gene_name": "KEAP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P15498-1", "protein_name": "Proto-oncogene vav", "gene_name": "VAV1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P01700", "url": "https://www.uniprot.org/uniprotkb/P01700" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.10087012", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 157 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Phospholipases and phagocytosis: the role of phospholipid-derived second messengers in phagocytosis.", "journal": "The international journal of biochemistry & cell biology", "date": "1999", "authors": "Lennartz MR", "reference": { "type": "PubMed", "id": "10224668", "url": "https://pubmed.ncbi.nlm.nih.gov/10224668" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P01700-1", "protein_name": "Immunoglobulin lambda variable 1-47", "gene_name": "IGLV1-47", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01714-1", "protein_name": "Immunoglobulin lambda variable 3-19", "gene_name": "IGLV3-19", "tax_name": "Human" }, { "uniprot_canonical_ac": "P80748-1", "protein_name": "Immunoglobulin lambda variable 3-21", "gene_name": "IGLV3-21", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A075B6P5-1", "protein_name": "Immunoglobulin kappa variable 2-28", "gene_name": "IGKV2-28", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A075B6S6-1", "protein_name": "Immunoglobulin kappa variable 2D-30", "gene_name": "IGKV2D-30", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0C4DH25-1", "protein_name": "Immunoglobulin kappa variable 3D-20", "gene_name": "IGKV3D-20", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01593-1", "protein_name": "Immunoglobulin kappa variable 1D-33", "gene_name": "IGKV1D-33", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01599-1", "protein_name": "Immunoglobulin kappa variable 1-17", "gene_name": "IGKV1-17", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01601-1", "protein_name": "Immunoglobulin kappa variable 1D-16", "gene_name": "IGKV1D-16", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01611-1", "protein_name": "Immunoglobulin kappa variable 1D-12", "gene_name": "IGKV1D-12", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01615-1", "protein_name": "Immunoglobulin kappa variable 2D-28", "gene_name": "IGKV2D-28", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01619-1", "protein_name": "Immunoglobulin kappa variable 3-20", "gene_name": "IGKV3-20", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01624-1", "protein_name": "Immunoglobulin kappa variable 3-15", "gene_name": "IGKV3-15", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04433-1", "protein_name": "Immunoglobulin kappa variable 3-11", "gene_name": "IGKV3-11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01602-1", "protein_name": "Immunoglobulin kappa variable 1-5", "gene_name": "IGKV1-5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14643-1", "protein_name": "Inositol 1,4,5-trisphosphate-gated calcium channel ITPR1", "gene_name": "ITPR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P43405-1", "protein_name": "Tyrosine-protein kinase SYK", "gene_name": "SYK", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42336-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform", "gene_name": "PIK3CA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P08637-1", "protein_name": "Low affinity immunoglobulin gamma Fc region receptor III-A", "gene_name": "FCGR3A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01767-1", "protein_name": "Immunoglobulin heavy variable 3-53", "gene_name": "IGHV3-53", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06331-1", "protein_name": "Immunoglobulin heavy variable 4-34", "gene_name": "IGHV4-34", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14571-1", "protein_name": "Inositol 1,4,5-trisphosphate-gated calcium channel ITPR2", "gene_name": "ITPR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01597-1", "protein_name": "Immunoglobulin kappa variable 1-39", "gene_name": "IGKV1-39", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06310-1", "protein_name": "Immunoglobulin kappa variable 2-30", "gene_name": "IGKV2-30", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06312-1", "protein_name": "Immunoglobulin kappa variable 4-1", "gene_name": "IGKV4-1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01614-1", "protein_name": "Immunoglobulin kappa variable 2D-40", "gene_name": "IGKV2D-40", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q05655-1", "protein_name": "Protein kinase C delta type", "gene_name": "PRKCD", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13393-1", "protein_name": "Phospholipase D1", "gene_name": "PLD1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14939-1", "protein_name": "Phospholipase D2", "gene_name": "PLD2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DOY2-1", "protein_name": "Immunoglobulin lambda constant 2", "gene_name": "IGLC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P09693-1", "protein_name": "T-cell surface glycoprotein CD3 gamma chain", "gene_name": "CD3G", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04432-1", "protein_name": "Immunoglobulin kappa variable 1D-39", "gene_name": "IGKV1D-39", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06315-1", "protein_name": "Immunoglobulin kappa variable 5-2", "gene_name": "IGKV5-2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01699-1", "protein_name": "Immunoglobulin lambda variable 1-44", "gene_name": "IGLV1-44", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01701-1", "protein_name": "Immunoglobulin lambda variable 1-51", "gene_name": "IGLV1-51", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01704-1", "protein_name": "Immunoglobulin lambda variable 2-14", "gene_name": "IGLV2-14", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01706-1", "protein_name": "Immunoglobulin lambda variable 2-11", "gene_name": "IGLV2-11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01709-1", "protein_name": "Immunoglobulin lambda variable 2-8", "gene_name": "IGLV2-8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01717-1", "protein_name": "Immunoglobulin lambda variable 3-25", "gene_name": "IGLV3-25", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01721-1", "protein_name": "Immunoglobulin lambda variable 6-57", "gene_name": "IGLV6-57", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01703-1", "protein_name": "Immunoglobulin lambda variable 1-40", "gene_name": "IGLV1-40", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01705-1", "protein_name": "Immunoglobulin lambda variable 2-23", "gene_name": "IGLV2-23", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01715-1", "protein_name": "Immunoglobulin lambda variable 3-1", "gene_name": "IGLV3-1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01718-1", "protein_name": "Immunoglobulin lambda variable 3-27", "gene_name": "IGLV3-27", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04211-1", "protein_name": "Immunoglobulin lambda variable 7-43", "gene_name": "IGLV7-43", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01860-2", "protein_name": "Immunoglobulin heavy constant gamma 3", "gene_name": "IGHG3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01861-2", "protein_name": "Immunoglobulin heavy constant gamma 4", "gene_name": "IGHG4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CF74-1", "protein_name": "Immunoglobulin lambda constant 6", "gene_name": "IGLC6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q02156-1", "protein_name": "Protein kinase C epsilon type", "gene_name": "PRKCE", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00459-1", "protein_name": "Phosphatidylinositol 3-kinase regulatory subunit beta", "gene_name": "PIK3R2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P16885-1", "protein_name": "1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-2", "gene_name": "PLCG2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P12314-1", "protein_name": "High affinity immunoglobulin gamma Fc receptor I", "gene_name": "FCGR1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43865-1", "protein_name": "S-adenosylhomocysteine hydrolase-like protein 1", "gene_name": "AHCYL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01825-1", "protein_name": "Immunoglobulin heavy variable 4-59", "gene_name": "IGHV4-59", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42338-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit beta isoform", "gene_name": "PIK3CB", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01817-1", "protein_name": "Immunoglobulin heavy variable 2-5", "gene_name": "IGHV2-5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01824-1", "protein_name": "Immunoglobulin heavy variable 4-39", "gene_name": "IGHV4-39", "tax_name": "Human" }, { "uniprot_canonical_ac": "P23083-1", "protein_name": "Immunoglobulin heavy variable 1-2", "gene_name": "IGHV1-2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60733-1", "protein_name": "85/88 kDa calcium-independent phospholipase A2", "gene_name": "PLA2G6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5VZY2-1", "protein_name": "Phospholipid phosphatase 4", "gene_name": "PLPP4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NEB5-1", "protein_name": "Phospholipid phosphatase 5", "gene_name": "PLPP5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96BZ4-1", "protein_name": "5'-3' exonuclease PLD4", "gene_name": "PLD4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01742-1", "protein_name": "Immunoglobulin heavy variable 1-69", "gene_name": "IGHV1-69", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01768-1", "protein_name": "Immunoglobulin heavy variable 3-30", "gene_name": "IGHV3-30", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01814-1", "protein_name": "Immunoglobulin heavy variable 2-70", "gene_name": "IGHV2-70", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01772-1", "protein_name": "Immunoglobulin heavy variable 3-33", "gene_name": "IGHV3-33", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01762-1", "protein_name": "Immunoglobulin heavy variable 3-11", "gene_name": "IGHV3-11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01763-1", "protein_name": "Immunoglobulin heavy variable 3-48", "gene_name": "IGHV3-48", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01764-1", "protein_name": "Immunoglobulin heavy variable 3-23", "gene_name": "IGHV3-23", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01766-1", "protein_name": "Immunoglobulin heavy variable 3-13", "gene_name": "IGHV3-13", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01780-1", "protein_name": "Immunoglobulin heavy variable 3-7", "gene_name": "IGHV3-7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01782-1", "protein_name": "Immunoglobulin heavy variable 3-9", "gene_name": "IGHV3-9", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0M8Q6-1", "protein_name": "Immunoglobulin lambda constant 7", "gene_name": "IGLC7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01834-1", "protein_name": "Immunoglobulin kappa constant", "gene_name": "IGKC", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01859-2", "protein_name": "Immunoglobulin heavy constant gamma 2", "gene_name": "IGHG2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG04-1", "protein_name": "Immunoglobulin lambda constant 1", "gene_name": "IGLC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DOY3-1", "protein_name": "Immunoglobulin lambda constant 3", "gene_name": "IGLC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8IV08-1", "protein_name": "5'-3' exonuclease PLD3", "gene_name": "PLD3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01743-1", "protein_name": "Immunoglobulin heavy variable 1-46", "gene_name": "IGHV1-46", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14573-1", "protein_name": "Inositol 1,4,5-trisphosphate-gated calcium channel ITPR3", "gene_name": "ITPR3", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0C4DH73-1", "protein_name": "Immunoglobulin kappa variable 1-12", "gene_name": "IGKV1-12", "tax_name": "Human" }, { "uniprot_canonical_ac": "A2NJV5-1", "protein_name": "Immunoglobulin kappa variable 2-29", "gene_name": "IGKV2-29", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01594-1", "protein_name": "Immunoglobulin kappa variable 1-33", "gene_name": "IGKV1-33", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04430-1", "protein_name": "Immunoglobulin kappa variable 1-16", "gene_name": "IGKV1-16", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01857-2", "protein_name": "Immunoglobulin heavy constant gamma 1", "gene_name": "IGHG1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P12318-1", "protein_name": "Low affinity immunoglobulin gamma Fc region receptor II-a", "gene_name": "FCGR2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27986-1", "protein_name": "Phosphatidylinositol 3-kinase regulatory subunit alpha", "gene_name": "PIK3R1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P19174-1", "protein_name": "1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-1", "gene_name": "PLCG1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P01700", "url": "https://www.uniprot.org/uniprotkb/P01700" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.10224668", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 88 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Kinetics of hemin distribution in plasma reveals its role in lipoprotein oxidation.", "journal": "Biochimica et biophysica acta", "date": "1999", "authors": "Miller YI, Shaklai N", "reference": { "type": "PubMed", "id": "10381560", "url": "https://pubmed.ncbi.nlm.nih.gov/10381560" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P01700-1", "protein_name": "Immunoglobulin lambda variable 1-47", "gene_name": "IGLV1-47", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01714-1", "protein_name": "Immunoglobulin lambda variable 3-19", "gene_name": "IGLV3-19", "tax_name": "Human" }, { "uniprot_canonical_ac": "P80748-1", "protein_name": "Immunoglobulin lambda variable 3-21", "gene_name": "IGLV3-21", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A075B6P5-1", "protein_name": "Immunoglobulin kappa variable 2-28", "gene_name": "IGKV2-28", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A075B6S6-1", "protein_name": "Immunoglobulin kappa variable 2D-30", "gene_name": "IGKV2D-30", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0C4DH25-1", "protein_name": "Immunoglobulin kappa variable 3D-20", "gene_name": "IGKV3D-20", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01593-1", "protein_name": "Immunoglobulin kappa variable 1D-33", "gene_name": "IGKV1D-33", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01599-1", "protein_name": "Immunoglobulin kappa variable 1-17", "gene_name": "IGKV1-17", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01601-1", "protein_name": "Immunoglobulin kappa variable 1D-16", "gene_name": "IGKV1D-16", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01611-1", "protein_name": "Immunoglobulin kappa variable 1D-12", "gene_name": "IGKV1D-12", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01615-1", "protein_name": "Immunoglobulin kappa variable 2D-28", "gene_name": "IGKV2D-28", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01619-1", "protein_name": "Immunoglobulin kappa variable 3-20", "gene_name": "IGKV3-20", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01624-1", "protein_name": "Immunoglobulin kappa variable 3-15", "gene_name": "IGKV3-15", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04433-1", "protein_name": "Immunoglobulin kappa variable 3-11", "gene_name": "IGKV3-11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01602-1", "protein_name": "Immunoglobulin kappa variable 1-5", "gene_name": "IGKV1-5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92793-1", "protein_name": "CREB-binding protein", "gene_name": "CREBBP", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15596-1", "protein_name": "Nuclear receptor coactivator 2", "gene_name": "NCOA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14686-1", "protein_name": "Nuclear receptor coactivator 6", "gene_name": "NCOA6", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15173-1", "protein_name": "Membrane-associated progesterone receptor component 2", "gene_name": "PGRMC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14791-1", "protein_name": "Apolipoprotein L1", "gene_name": "APOL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P02760-1", "protein_name": "Protein AMBP", "gene_name": "AMBP", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04114-1", "protein_name": "Apolipoprotein B-100", "gene_name": "APOB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q07954-1", "protein_name": "Prolow-density lipoprotein receptor-related protein 1", "gene_name": "LRP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P15336-1", "protein_name": "Cyclic AMP-dependent transcription factor ATF-2", "gene_name": "ATF2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q07869-1", "protein_name": "Peroxisome proliferator-activated receptor alpha", "gene_name": "PPARA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q3L8U1-1", "protein_name": "ATP-dependent chromatin remodeler CHD9", "gene_name": "CHD9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6UUV9-1", "protein_name": "CREB-regulated transcription coactivator 1", "gene_name": "CRTC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9P126-1", "protein_name": "C-type lectin domain family 1 member B", "gene_name": "CLEC1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15648-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 1", "gene_name": "MED1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P09601-1", "protein_name": "Heme oxygenase 1", "gene_name": "HMOX1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P00739-1", "protein_name": "Haptoglobin-related protein", "gene_name": "HPR", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01767-1", "protein_name": "Immunoglobulin heavy variable 3-53", "gene_name": "IGHV3-53", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06331-1", "protein_name": "Immunoglobulin heavy variable 4-34", "gene_name": "IGHV4-34", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01597-1", "protein_name": "Immunoglobulin kappa variable 1-39", "gene_name": "IGKV1-39", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06310-1", "protein_name": "Immunoglobulin kappa variable 2-30", "gene_name": "IGKV2-30", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06312-1", "protein_name": "Immunoglobulin kappa variable 4-1", "gene_name": "IGKV4-1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01614-1", "protein_name": "Immunoglobulin kappa variable 2D-40", "gene_name": "IGKV2D-40", "tax_name": "Human" }, { "uniprot_canonical_ac": "P19793-1", "protein_name": "Retinoic acid receptor RXR-alpha", "gene_name": "RXRA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DOY2-1", "protein_name": "Immunoglobulin lambda constant 2", "gene_name": "IGLC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96NT5-1", "protein_name": "Proton-coupled folate transporter", "gene_name": "SLC46A1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q7Z5J4-1", "protein_name": "Retinoic acid-induced protein 1", "gene_name": "RAI1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60907-1", "protein_name": "F-box-like/WD repeat-containing protein TBL1X", "gene_name": "TBL1X", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6STE5-1", "protein_name": "SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D member 3", "gene_name": "SMARCD3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BZK7-1", "protein_name": "F-box-like/WD repeat-containing protein TBL1XR1", "gene_name": "TBL1XR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86VB7-1", "protein_name": "Scavenger receptor cysteine-rich type 1 protein M130", "gene_name": "CD163", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86X55-3", "protein_name": "Histone-arginine methyltransferase CARM1", "gene_name": "CARM1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00206-1", "protein_name": "Toll-like receptor 4", "gene_name": "TLR4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04432-1", "protein_name": "Immunoglobulin kappa variable 1D-39", "gene_name": "IGKV1D-39", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06315-1", "protein_name": "Immunoglobulin kappa variable 5-2", "gene_name": "IGKV5-2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01699-1", "protein_name": "Immunoglobulin lambda variable 1-44", "gene_name": "IGLV1-44", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01701-1", "protein_name": "Immunoglobulin lambda variable 1-51", "gene_name": "IGLV1-51", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01704-1", "protein_name": "Immunoglobulin lambda variable 2-14", "gene_name": "IGLV2-14", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01706-1", "protein_name": "Immunoglobulin lambda variable 2-11", "gene_name": "IGLV2-11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01709-1", "protein_name": "Immunoglobulin lambda variable 2-8", "gene_name": "IGLV2-8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01717-1", "protein_name": "Immunoglobulin lambda variable 3-25", "gene_name": "IGLV3-25", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01721-1", "protein_name": "Immunoglobulin lambda variable 6-57", "gene_name": "IGLV6-57", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01703-1", "protein_name": "Immunoglobulin lambda variable 1-40", "gene_name": "IGLV1-40", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01705-1", "protein_name": "Immunoglobulin lambda variable 2-23", "gene_name": "IGLV2-23", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01715-1", "protein_name": "Immunoglobulin lambda variable 3-1", "gene_name": "IGLV3-1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01718-1", "protein_name": "Immunoglobulin lambda variable 3-27", "gene_name": "IGLV3-27", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04211-1", "protein_name": "Immunoglobulin lambda variable 7-43", "gene_name": "IGLV7-43", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14814-1", "protein_name": "Myocyte-specific enhancer factor 2D", "gene_name": "MEF2D", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y6Y9-1", "protein_name": "Lymphocyte antigen 96", "gene_name": "LY96", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16236-1", "protein_name": "Nuclear factor erythroid 2-related factor 2", "gene_name": "NFE2L2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01876-2", "protein_name": "Immunoglobulin heavy constant alpha 1", "gene_name": "IGHA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CF74-1", "protein_name": "Immunoglobulin lambda constant 6", "gene_name": "IGLC6", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60675-1", "protein_name": "Transcription factor MafK", "gene_name": "MAFK", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15379-1", "protein_name": "Histone deacetylase 3", "gene_name": "HDAC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14980-1", "protein_name": "Exportin-1", "gene_name": "XPO1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P69905-1", "protein_name": "Hemoglobin subunit alpha", "gene_name": "HBA1; HBA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P48552-1", "protein_name": "Nuclear receptor-interacting protein 1", "gene_name": "NRIP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q09472-1", "protein_name": "Histone acetyltransferase p300", "gene_name": "EP300", "tax_name": "Human" }, { "uniprot_canonical_ac": "P20393-1", "protein_name": "Nuclear receptor subfamily 1 group D member 1", "gene_name": "NR1D1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P02768-1", "protein_name": "Albumin", "gene_name": "ALB", "tax_name": "Human" }, { "uniprot_canonical_ac": "P00738-1", "protein_name": "Haptoglobin", "gene_name": "HP", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6UUV7-1", "protein_name": "CREB-regulated transcription coactivator 3", "gene_name": "CRTC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UBK2-1", "protein_name": "Peroxisome proliferator-activated receptor gamma coactivator 1-alpha", "gene_name": "PPARGC1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35398-2", "protein_name": "Nuclear receptor ROR-alpha", "gene_name": "RORA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q53ET0-1", "protein_name": "CREB-regulated transcription coactivator 2", "gene_name": "CRTC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99743-1", "protein_name": "Neuronal PAS domain-containing protein 2", "gene_name": "NPAS2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00327-2", "protein_name": "Basic helix-loop-helix ARNT-like protein 1", "gene_name": "BMAL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15516-1", "protein_name": "Circadian locomoter output cycles protein kaput", "gene_name": "CLOCK", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01825-1", "protein_name": "Immunoglobulin heavy variable 4-59", "gene_name": "IGHV4-59", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01817-1", "protein_name": "Immunoglobulin heavy variable 2-5", "gene_name": "IGHV2-5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01824-1", "protein_name": "Immunoglobulin heavy variable 4-39", "gene_name": "IGHV4-39", "tax_name": "Human" }, { "uniprot_canonical_ac": "P23083-1", "protein_name": "Immunoglobulin heavy variable 1-2", "gene_name": "IGHV1-2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68871-1", "protein_name": "Hemoglobin subunit beta", "gene_name": "HBB", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01742-1", "protein_name": "Immunoglobulin heavy variable 1-69", "gene_name": "IGHV1-69", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01768-1", "protein_name": "Immunoglobulin heavy variable 3-30", "gene_name": "IGHV3-30", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01814-1", "protein_name": "Immunoglobulin heavy variable 2-70", "gene_name": "IGHV2-70", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01772-1", "protein_name": "Immunoglobulin heavy variable 3-33", "gene_name": "IGHV3-33", "tax_name": "Human" }, { "uniprot_canonical_ac": "P02790-1", "protein_name": "Hemopexin", "gene_name": "HPX", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01762-1", "protein_name": "Immunoglobulin heavy variable 3-11", "gene_name": "IGHV3-11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01763-1", "protein_name": "Immunoglobulin heavy variable 3-48", "gene_name": "IGHV3-48", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01764-1", "protein_name": "Immunoglobulin heavy variable 3-23", "gene_name": "IGHV3-23", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01766-1", "protein_name": "Immunoglobulin heavy variable 3-13", "gene_name": "IGHV3-13", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01780-1", "protein_name": "Immunoglobulin heavy variable 3-7", "gene_name": "IGHV3-7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01782-1", "protein_name": "Immunoglobulin heavy variable 3-9", "gene_name": "IGHV3-9", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01877-2", "protein_name": "Immunoglobulin heavy constant alpha 2", "gene_name": "IGHA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01591-1", "protein_name": "Immunoglobulin J chain", "gene_name": "JCHAIN", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0M8Q6-1", "protein_name": "Immunoglobulin lambda constant 7", "gene_name": "IGLC7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01834-1", "protein_name": "Immunoglobulin kappa constant", "gene_name": "IGKC", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG04-1", "protein_name": "Immunoglobulin lambda constant 1", "gene_name": "IGLC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DOY3-1", "protein_name": "Immunoglobulin lambda constant 3", "gene_name": "IGLC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96RS0-1", "protein_name": "Trimethylguanosine synthase", "gene_name": "TGS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14867-1", "protein_name": "Transcription regulator protein BACH1", "gene_name": "BACH1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75376-1", "protein_name": "Nuclear receptor corepressor 1", "gene_name": "NCOR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15788-1", "protein_name": "Nuclear receptor coactivator 1", "gene_name": "NCOA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01743-1", "protein_name": "Immunoglobulin heavy variable 1-46", "gene_name": "IGHV1-46", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BYK8-1", "protein_name": "3'-5' exoribonuclease HELZ2", "gene_name": "HELZ2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q06413-1", "protein_name": "Myocyte-specific enhancer factor 2C", "gene_name": "MEF2C", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0C4DH73-1", "protein_name": "Immunoglobulin kappa variable 1-12", "gene_name": "IGKV1-12", "tax_name": "Human" }, { "uniprot_canonical_ac": "A2NJV5-1", "protein_name": "Immunoglobulin kappa variable 2-29", "gene_name": "IGKV2-29", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01594-1", "protein_name": "Immunoglobulin kappa variable 1-33", "gene_name": "IGKV1-33", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04430-1", "protein_name": "Immunoglobulin kappa variable 1-16", "gene_name": "IGKV1-16", "tax_name": "Human" }, { "uniprot_canonical_ac": "P02647-1", "protein_name": "Apolipoprotein A-I", "gene_name": "APOA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96EB6-1", "protein_name": "NAD-dependent protein deacetylase sirtuin-1", "gene_name": "SIRT1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P01700", "url": "https://www.uniprot.org/uniprotkb/P01700" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.10381560", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 117 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "DAPP1: a dual adaptor for phosphotyrosine and 3-phosphoinositides.", "journal": "The Biochemical journal", "date": "1999", "authors": "Dowler S, Currie RA, Downes CP, Alessi DR", "reference": { "type": "PubMed", "id": "10432293", "url": "https://pubmed.ncbi.nlm.nih.gov/10432293" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P01700-1", "protein_name": "Immunoglobulin lambda variable 1-47", "gene_name": "IGLV1-47", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01714-1", "protein_name": "Immunoglobulin lambda variable 3-19", "gene_name": "IGLV3-19", "tax_name": "Human" }, { "uniprot_canonical_ac": "P80748-1", "protein_name": "Immunoglobulin lambda variable 3-21", "gene_name": "IGLV3-21", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A075B6P5-1", "protein_name": "Immunoglobulin kappa variable 2-28", "gene_name": "IGKV2-28", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A075B6S6-1", "protein_name": "Immunoglobulin kappa variable 2D-30", "gene_name": "IGKV2D-30", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0C4DH25-1", "protein_name": "Immunoglobulin kappa variable 3D-20", "gene_name": "IGKV3D-20", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01593-1", "protein_name": "Immunoglobulin kappa variable 1D-33", "gene_name": "IGKV1D-33", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01599-1", "protein_name": "Immunoglobulin kappa variable 1-17", "gene_name": "IGKV1-17", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01601-1", "protein_name": "Immunoglobulin kappa variable 1D-16", "gene_name": "IGKV1D-16", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01611-1", "protein_name": "Immunoglobulin kappa variable 1D-12", "gene_name": "IGKV1D-12", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01615-1", "protein_name": "Immunoglobulin kappa variable 2D-28", "gene_name": "IGKV2D-28", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01619-1", "protein_name": "Immunoglobulin kappa variable 3-20", "gene_name": "IGKV3-20", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01624-1", "protein_name": "Immunoglobulin kappa variable 3-15", "gene_name": "IGKV3-15", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04433-1", "protein_name": "Immunoglobulin kappa variable 3-11", "gene_name": "IGKV3-11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01602-1", "protein_name": "Immunoglobulin kappa variable 1-5", "gene_name": "IGKV1-5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8WV28-1", "protein_name": "B-cell linker protein", "gene_name": "BLNK", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14643-1", "protein_name": "Inositol 1,4,5-trisphosphate-gated calcium channel ITPR1", "gene_name": "ITPR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UN19-1", "protein_name": "Dual adapter for phosphotyrosine and 3-phosphotyrosine and 3-phosphoinositide", "gene_name": "DAPP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P43405-1", "protein_name": "Tyrosine-protein kinase SYK", "gene_name": "SYK", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96SN7-1", "protein_name": "Protein orai-2", "gene_name": "ORAI2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P15391-1", "protein_name": "B-lymphocyte antigen CD19", "gene_name": "CD19", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01871-2", "protein_name": "Immunoglobulin heavy constant mu", "gene_name": "IGHM", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13586-1", "protein_name": "Stromal interaction molecule 1", "gene_name": "STIM1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01767-1", "protein_name": "Immunoglobulin heavy variable 3-53", "gene_name": "IGHV3-53", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06331-1", "protein_name": "Immunoglobulin heavy variable 4-34", "gene_name": "IGHV4-34", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14571-1", "protein_name": "Inositol 1,4,5-trisphosphate-gated calcium channel ITPR2", "gene_name": "ITPR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01597-1", "protein_name": "Immunoglobulin kappa variable 1-39", "gene_name": "IGKV1-39", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06310-1", "protein_name": "Immunoglobulin kappa variable 2-30", "gene_name": "IGKV2-30", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06312-1", "protein_name": "Immunoglobulin kappa variable 4-1", "gene_name": "IGKV4-1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01614-1", "protein_name": "Immunoglobulin kappa variable 2D-40", "gene_name": "IGKV2D-40", "tax_name": "Human" }, { "uniprot_canonical_ac": "P48995-1", "protein_name": "Short transient receptor potential channel 1", "gene_name": "TRPC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DOY2-1", "protein_name": "Immunoglobulin lambda constant 2", "gene_name": "IGLC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6ZUJ8-1", "protein_name": "Phosphoinositide 3-kinase adapter protein 1", "gene_name": "PIK3AP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96D31-1", "protein_name": "Calcium release-activated calcium channel protein 1", "gene_name": "ORAI1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DP23-1", "protein_name": "Calmodulin-1", "gene_name": "CALM1; CALM2; CALM3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P29350-1", "protein_name": "Tyrosine-protein phosphatase non-receptor type 6", "gene_name": "PTPN6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P20273-1", "protein_name": "B-cell receptor CD22", "gene_name": "CD22", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04432-1", "protein_name": "Immunoglobulin kappa variable 1D-39", "gene_name": "IGKV1D-39", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06315-1", "protein_name": "Immunoglobulin kappa variable 5-2", "gene_name": "IGKV5-2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01699-1", "protein_name": "Immunoglobulin lambda variable 1-44", "gene_name": "IGLV1-44", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01701-1", "protein_name": "Immunoglobulin lambda variable 1-51", "gene_name": "IGLV1-51", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01704-1", "protein_name": "Immunoglobulin lambda variable 2-14", "gene_name": "IGLV2-14", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01706-1", "protein_name": "Immunoglobulin lambda variable 2-11", "gene_name": "IGLV2-11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01709-1", "protein_name": "Immunoglobulin lambda variable 2-8", "gene_name": "IGLV2-8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01717-1", "protein_name": "Immunoglobulin lambda variable 3-25", "gene_name": "IGLV3-25", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01721-1", "protein_name": "Immunoglobulin lambda variable 6-57", "gene_name": "IGLV6-57", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01703-1", "protein_name": "Immunoglobulin lambda variable 1-40", "gene_name": "IGLV1-40", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01705-1", "protein_name": "Immunoglobulin lambda variable 2-23", "gene_name": "IGLV2-23", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01715-1", "protein_name": "Immunoglobulin lambda variable 3-1", "gene_name": "IGLV3-1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01718-1", "protein_name": "Immunoglobulin lambda variable 3-27", "gene_name": "IGLV3-27", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04211-1", "protein_name": "Immunoglobulin lambda variable 7-43", "gene_name": "IGLV7-43", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q07889-1", "protein_name": "Son of sevenless homolog 1", "gene_name": "SOS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9QXT1-1", "protein_name": "Dual adapter for phosphotyrosine and 3-phosphotyrosine and 3-phosphoinositide", "gene_name": "Dapp1", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "P01880-2", "protein_name": "Immunoglobulin heavy constant delta", "gene_name": "IGHD", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CF74-1", "protein_name": "Immunoglobulin lambda constant 6", "gene_name": "IGLC6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q06187-1", "protein_name": "Tyrosine-protein kinase BTK", "gene_name": "BTK", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96B97-1", "protein_name": "SH3 domain-containing kinase-binding protein 1", "gene_name": "SH3KBP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P07948-1", "protein_name": "Tyrosine-protein kinase Lyn", "gene_name": "LYN", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51451-1", "protein_name": "Tyrosine-protein kinase Blk", "gene_name": "BLK", "tax_name": "Human" }, { "uniprot_canonical_ac": "P16885-1", "protein_name": "1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-2", "gene_name": "PLCG2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43865-1", "protein_name": "S-adenosylhomocysteine hydrolase-like protein 1", "gene_name": "AHCYL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01825-1", "protein_name": "Immunoglobulin heavy variable 4-59", "gene_name": "IGHV4-59", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01817-1", "protein_name": "Immunoglobulin heavy variable 2-5", "gene_name": "IGHV2-5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01824-1", "protein_name": "Immunoglobulin heavy variable 4-39", "gene_name": "IGHV4-39", "tax_name": "Human" }, { "uniprot_canonical_ac": "P23083-1", "protein_name": "Immunoglobulin heavy variable 1-2", "gene_name": "IGHV1-2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00329-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit delta isoform", "gene_name": "PIK3CD", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01742-1", "protein_name": "Immunoglobulin heavy variable 1-69", "gene_name": "IGHV1-69", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01768-1", "protein_name": "Immunoglobulin heavy variable 3-30", "gene_name": "IGHV3-30", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01814-1", "protein_name": "Immunoglobulin heavy variable 2-70", "gene_name": "IGHV2-70", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01772-1", "protein_name": "Immunoglobulin heavy variable 3-33", "gene_name": "IGHV3-33", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01762-1", "protein_name": "Immunoglobulin heavy variable 3-11", "gene_name": "IGHV3-11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01763-1", "protein_name": "Immunoglobulin heavy variable 3-48", "gene_name": "IGHV3-48", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01764-1", "protein_name": "Immunoglobulin heavy variable 3-23", "gene_name": "IGHV3-23", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01766-1", "protein_name": "Immunoglobulin heavy variable 3-13", "gene_name": "IGHV3-13", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01780-1", "protein_name": "Immunoglobulin heavy variable 3-7", "gene_name": "IGHV3-7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01782-1", "protein_name": "Immunoglobulin heavy variable 3-9", "gene_name": "IGHV3-9", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0M8Q6-1", "protein_name": "Immunoglobulin lambda constant 7", "gene_name": "IGLC7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01834-1", "protein_name": "Immunoglobulin kappa constant", "gene_name": "IGKC", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG04-1", "protein_name": "Immunoglobulin lambda constant 1", "gene_name": "IGLC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DOY3-1", "protein_name": "Immunoglobulin lambda constant 3", "gene_name": "IGLC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P11912-1", "protein_name": "B-cell antigen receptor complex-associated protein alpha chain", "gene_name": "CD79A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P40259-1", "protein_name": "B-cell antigen receptor complex-associated protein beta chain", "gene_name": "CD79B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01743-1", "protein_name": "Immunoglobulin heavy variable 1-46", "gene_name": "IGHV1-46", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14573-1", "protein_name": "Inositol 1,4,5-trisphosphate-gated calcium channel ITPR3", "gene_name": "ITPR3", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0C4DH73-1", "protein_name": "Immunoglobulin kappa variable 1-12", "gene_name": "IGKV1-12", "tax_name": "Human" }, { "uniprot_canonical_ac": "A2NJV5-1", "protein_name": "Immunoglobulin kappa variable 2-29", "gene_name": "IGKV2-29", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01594-1", "protein_name": "Immunoglobulin kappa variable 1-33", "gene_name": "IGKV1-33", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04430-1", "protein_name": "Immunoglobulin kappa variable 1-16", "gene_name": "IGKV1-16", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27986-1", "protein_name": "Phosphatidylinositol 3-kinase regulatory subunit alpha", "gene_name": "PIK3R1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06241-1", "protein_name": "Tyrosine-protein kinase Fyn", "gene_name": "FYN", "tax_name": "Human" }, { "uniprot_canonical_ac": "P16333-1", "protein_name": "SH2/SH3 adapter protein NCK1", "gene_name": "NCK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P15498-1", "protein_name": "Proto-oncogene vav", "gene_name": "VAV1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P01700", "url": "https://www.uniprot.org/uniprotkb/P01700" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 173, "end_pos": 173, "sequence_org": "K", "sequence_mut": "L", "comment": "No interaction with 3-phosphoinositides.", "evidence": [ { "database": "UniProtKB", "id": "Q9UN19", "url": "https://www.uniprot.org/uniprotkb/Q9UN19" }, { "database": "PubMed", "id": "10432293", "url": "https://pubmed.ncbi.nlm.nih.gov/10432293" } ], "uniprot_canonical_ac": "Q9UN19-1" }, { "start_pos": 250, "end_pos": 250, "sequence_org": "W", "sequence_mut": "L", "comment": "No interaction with 3-phosphoinositides.", "evidence": [ { "database": "UniProtKB", "id": "Q9UN19", "url": "https://www.uniprot.org/uniprotkb/Q9UN19" }, { "database": "PubMed", "id": "10432293", "url": "https://pubmed.ncbi.nlm.nih.gov/10432293" } ], "uniprot_canonical_ac": "Q9UN19-1" } ], "record_id": "pubmed.10432293", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 92 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Identification of the SH2 domain binding protein of Bruton's tyrosine kinase as BLNK--functional significance of Btk-SH2 domain in B-cell antigen receptor-coupled calcium signaling.", "journal": "Blood", "date": "1999", "authors": "Hashimoto S, Iwamatsu A, Ishiai M, Okawa K, Yamadori T, Matsushita M, Baba Y, Kishimoto T, Kurosaki T, Tsukada S", "reference": { "type": "PubMed", "id": "10498607", "url": "https://pubmed.ncbi.nlm.nih.gov/10498607" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P01700-1", "protein_name": "Immunoglobulin lambda variable 1-47", "gene_name": "IGLV1-47", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01714-1", "protein_name": "Immunoglobulin lambda variable 3-19", "gene_name": "IGLV3-19", "tax_name": "Human" }, { "uniprot_canonical_ac": "P80748-1", "protein_name": "Immunoglobulin lambda variable 3-21", "gene_name": "IGLV3-21", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A075B6P5-1", "protein_name": "Immunoglobulin kappa variable 2-28", "gene_name": "IGKV2-28", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A075B6S6-1", "protein_name": "Immunoglobulin kappa variable 2D-30", "gene_name": "IGKV2D-30", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0C4DH25-1", "protein_name": "Immunoglobulin kappa variable 3D-20", "gene_name": "IGKV3D-20", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01593-1", "protein_name": "Immunoglobulin kappa variable 1D-33", "gene_name": "IGKV1D-33", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01599-1", "protein_name": "Immunoglobulin kappa variable 1-17", "gene_name": "IGKV1-17", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01601-1", "protein_name": "Immunoglobulin kappa variable 1D-16", "gene_name": "IGKV1D-16", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01611-1", "protein_name": "Immunoglobulin kappa variable 1D-12", "gene_name": "IGKV1D-12", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01615-1", "protein_name": "Immunoglobulin kappa variable 2D-28", "gene_name": "IGKV2D-28", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01619-1", "protein_name": "Immunoglobulin kappa variable 3-20", "gene_name": "IGKV3-20", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01624-1", "protein_name": "Immunoglobulin kappa variable 3-15", "gene_name": "IGKV3-15", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04433-1", "protein_name": "Immunoglobulin kappa variable 3-11", "gene_name": "IGKV3-11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01602-1", "protein_name": "Immunoglobulin kappa variable 1-5", "gene_name": "IGKV1-5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8WV28-1", "protein_name": "B-cell linker protein", "gene_name": "BLNK", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14643-1", "protein_name": "Inositol 1,4,5-trisphosphate-gated calcium channel ITPR1", "gene_name": "ITPR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UN19-1", "protein_name": "Dual adapter for phosphotyrosine and 3-phosphotyrosine and 3-phosphoinositide", "gene_name": "DAPP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P43405-1", "protein_name": "Tyrosine-protein kinase SYK", "gene_name": "SYK", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96SN7-1", "protein_name": "Protein orai-2", "gene_name": "ORAI2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P15391-1", "protein_name": "B-lymphocyte antigen CD19", "gene_name": "CD19", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01871-2", "protein_name": "Immunoglobulin heavy constant mu", "gene_name": "IGHM", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13586-1", "protein_name": "Stromal interaction molecule 1", "gene_name": "STIM1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P24135-1", "protein_name": "1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-2", "gene_name": "Plcg2", "tax_name": "Rat" }, { "uniprot_canonical_ac": "P01767-1", "protein_name": "Immunoglobulin heavy variable 3-53", "gene_name": "IGHV3-53", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06331-1", "protein_name": "Immunoglobulin heavy variable 4-34", "gene_name": "IGHV4-34", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14571-1", "protein_name": "Inositol 1,4,5-trisphosphate-gated calcium channel ITPR2", "gene_name": "ITPR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01597-1", "protein_name": "Immunoglobulin kappa variable 1-39", "gene_name": "IGKV1-39", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06310-1", "protein_name": "Immunoglobulin kappa variable 2-30", "gene_name": "IGKV2-30", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06312-1", "protein_name": "Immunoglobulin kappa variable 4-1", "gene_name": "IGKV4-1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01614-1", "protein_name": "Immunoglobulin kappa variable 2D-40", "gene_name": "IGKV2D-40", "tax_name": "Human" }, { "uniprot_canonical_ac": "P48995-1", "protein_name": "Short transient receptor potential channel 1", "gene_name": "TRPC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DOY2-1", "protein_name": "Immunoglobulin lambda constant 2", "gene_name": "IGLC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6ZUJ8-1", "protein_name": "Phosphoinositide 3-kinase adapter protein 1", "gene_name": "PIK3AP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96D31-1", "protein_name": "Calcium release-activated calcium channel protein 1", "gene_name": "ORAI1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DP23-1", "protein_name": "Calmodulin-1", "gene_name": "CALM1; CALM2; CALM3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P29350-1", "protein_name": "Tyrosine-protein phosphatase non-receptor type 6", "gene_name": "PTPN6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P20273-1", "protein_name": "B-cell receptor CD22", "gene_name": "CD22", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04432-1", "protein_name": "Immunoglobulin kappa variable 1D-39", "gene_name": "IGKV1D-39", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06315-1", "protein_name": "Immunoglobulin kappa variable 5-2", "gene_name": "IGKV5-2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01699-1", "protein_name": "Immunoglobulin lambda variable 1-44", "gene_name": "IGLV1-44", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01701-1", "protein_name": "Immunoglobulin lambda variable 1-51", "gene_name": "IGLV1-51", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01704-1", "protein_name": "Immunoglobulin lambda variable 2-14", "gene_name": "IGLV2-14", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01706-1", "protein_name": "Immunoglobulin lambda variable 2-11", "gene_name": "IGLV2-11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01709-1", "protein_name": "Immunoglobulin lambda variable 2-8", "gene_name": "IGLV2-8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01717-1", "protein_name": "Immunoglobulin lambda variable 3-25", "gene_name": "IGLV3-25", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01721-1", "protein_name": "Immunoglobulin lambda variable 6-57", "gene_name": "IGLV6-57", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01703-1", "protein_name": "Immunoglobulin lambda variable 1-40", "gene_name": "IGLV1-40", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01705-1", "protein_name": "Immunoglobulin lambda variable 2-23", "gene_name": "IGLV2-23", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01715-1", "protein_name": "Immunoglobulin lambda variable 3-1", "gene_name": "IGLV3-1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01718-1", "protein_name": "Immunoglobulin lambda variable 3-27", "gene_name": "IGLV3-27", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04211-1", "protein_name": "Immunoglobulin lambda variable 7-43", "gene_name": "IGLV7-43", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q07889-1", "protein_name": "Son of sevenless homolog 1", "gene_name": "SOS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01880-2", "protein_name": "Immunoglobulin heavy constant delta", "gene_name": "IGHD", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CF74-1", "protein_name": "Immunoglobulin lambda constant 6", "gene_name": "IGLC6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q06187-1", "protein_name": "Tyrosine-protein kinase BTK", "gene_name": "BTK", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96B97-1", "protein_name": "SH3 domain-containing kinase-binding protein 1", "gene_name": "SH3KBP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P07948-1", "protein_name": "Tyrosine-protein kinase Lyn", "gene_name": "LYN", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51451-1", "protein_name": "Tyrosine-protein kinase Blk", "gene_name": "BLK", "tax_name": "Human" }, { "uniprot_canonical_ac": "P16885-1", "protein_name": "1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-2", "gene_name": "PLCG2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43865-1", "protein_name": "S-adenosylhomocysteine hydrolase-like protein 1", "gene_name": "AHCYL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01825-1", "protein_name": "Immunoglobulin heavy variable 4-59", "gene_name": "IGHV4-59", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01817-1", "protein_name": "Immunoglobulin heavy variable 2-5", "gene_name": "IGHV2-5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01824-1", "protein_name": "Immunoglobulin heavy variable 4-39", "gene_name": "IGHV4-39", "tax_name": "Human" }, { "uniprot_canonical_ac": "P23083-1", "protein_name": "Immunoglobulin heavy variable 1-2", "gene_name": "IGHV1-2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00329-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit delta isoform", "gene_name": "PIK3CD", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01742-1", "protein_name": "Immunoglobulin heavy variable 1-69", "gene_name": "IGHV1-69", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01768-1", "protein_name": "Immunoglobulin heavy variable 3-30", "gene_name": "IGHV3-30", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01814-1", "protein_name": "Immunoglobulin heavy variable 2-70", "gene_name": "IGHV2-70", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01772-1", "protein_name": "Immunoglobulin heavy variable 3-33", "gene_name": "IGHV3-33", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01762-1", "protein_name": "Immunoglobulin heavy variable 3-11", "gene_name": "IGHV3-11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01763-1", "protein_name": "Immunoglobulin heavy variable 3-48", "gene_name": "IGHV3-48", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01764-1", "protein_name": "Immunoglobulin heavy variable 3-23", "gene_name": "IGHV3-23", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01766-1", "protein_name": "Immunoglobulin heavy variable 3-13", "gene_name": "IGHV3-13", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01780-1", "protein_name": "Immunoglobulin heavy variable 3-7", "gene_name": "IGHV3-7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01782-1", "protein_name": "Immunoglobulin heavy variable 3-9", "gene_name": "IGHV3-9", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0M8Q6-1", "protein_name": "Immunoglobulin lambda constant 7", "gene_name": "IGLC7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01834-1", "protein_name": "Immunoglobulin kappa constant", "gene_name": "IGKC", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG04-1", "protein_name": "Immunoglobulin lambda constant 1", "gene_name": "IGLC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DOY3-1", "protein_name": "Immunoglobulin lambda constant 3", "gene_name": "IGLC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P11912-1", "protein_name": "B-cell antigen receptor complex-associated protein alpha chain", "gene_name": "CD79A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P40259-1", "protein_name": "B-cell antigen receptor complex-associated protein beta chain", "gene_name": "CD79B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01743-1", "protein_name": "Immunoglobulin heavy variable 1-46", "gene_name": "IGHV1-46", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14573-1", "protein_name": "Inositol 1,4,5-trisphosphate-gated calcium channel ITPR3", "gene_name": "ITPR3", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0C4DH73-1", "protein_name": "Immunoglobulin kappa variable 1-12", "gene_name": "IGKV1-12", "tax_name": "Human" }, { "uniprot_canonical_ac": "A2NJV5-1", "protein_name": "Immunoglobulin kappa variable 2-29", "gene_name": "IGKV2-29", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01594-1", "protein_name": "Immunoglobulin kappa variable 1-33", "gene_name": "IGKV1-33", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04430-1", "protein_name": "Immunoglobulin kappa variable 1-16", "gene_name": "IGKV1-16", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27986-1", "protein_name": "Phosphatidylinositol 3-kinase regulatory subunit alpha", "gene_name": "PIK3R1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06241-1", "protein_name": "Tyrosine-protein kinase Fyn", "gene_name": "FYN", "tax_name": "Human" }, { "uniprot_canonical_ac": "P16333-1", "protein_name": "SH2/SH3 adapter protein NCK1", "gene_name": "NCK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P15498-1", "protein_name": "Proto-oncogene vav", "gene_name": "VAV1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P01700", "url": "https://www.uniprot.org/uniprotkb/P01700" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 1197, "end_pos": 1197, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "Phosphotyrosine; by BTK", "evidence": [ { "database": "UniProtKB", "id": "P24135", "url": "https://www.uniprot.org/uniprotkb/P24135" }, { "database": "iPTMnet", "id": "P24135", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P24135" }, { "database": "PubMed", "id": "10498607", "url": "https://pubmed.ncbi.nlm.nih.gov/10498607" } ], "site_lbl": "Tyr1197", "uniprot_canonical_ac": "P24135-1" }, { "start_pos": 1197, "end_pos": 1197, "kinase_uniprot_canonical_ac": "Q06187-1", "kinase_gene_name": "BTK", "residue": "Tyr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P16885", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P16885" }, { "database": "PubMed", "id": "11507089", "url": "https://pubmed.ncbi.nlm.nih.gov/11507089" }, { "database": "PubMed", "id": "10498607", "url": "https://pubmed.ncbi.nlm.nih.gov/10498607" } ], "site_lbl": "Tyr1197", "uniprot_canonical_ac": "P16885-1" }, { "start_pos": 1217, "end_pos": 1217, "kinase_uniprot_canonical_ac": "Q06187-1", "kinase_gene_name": "BTK", "residue": "Tyr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P16885", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P16885" }, { "database": "PubMed", "id": "11507089", "url": "https://pubmed.ncbi.nlm.nih.gov/11507089" }, { "database": "PubMed", "id": "16497976", "url": "https://pubmed.ncbi.nlm.nih.gov/16497976" }, { "database": "PubMed", "id": "19901323", "url": "https://pubmed.ncbi.nlm.nih.gov/19901323" }, { "database": "PubMed", "id": "10498607", "url": "https://pubmed.ncbi.nlm.nih.gov/10498607" } ], "site_lbl": "Tyr1217", "uniprot_canonical_ac": "P16885-1" }, { "start_pos": 753, "end_pos": 753, "kinase_uniprot_canonical_ac": "Q06187-1", "kinase_gene_name": "BTK", "residue": "Tyr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P16885", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P16885" }, { "database": "PubMed", "id": "10498607", "url": "https://pubmed.ncbi.nlm.nih.gov/10498607" }, { "database": "PubMed", "id": "11507089", "url": "https://pubmed.ncbi.nlm.nih.gov/11507089" }, { "database": "PubMed", "id": "11606584", "url": "https://pubmed.ncbi.nlm.nih.gov/11606584" } ], "site_lbl": "Tyr753", "uniprot_canonical_ac": "P16885-1" }, { "start_pos": 759, "end_pos": 759, "kinase_uniprot_canonical_ac": "Q06187-1", "kinase_gene_name": "BTK", "residue": "Tyr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P16885", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P16885" }, { "database": "PubMed", "id": "12181444", "url": "https://pubmed.ncbi.nlm.nih.gov/12181444" }, { "database": "PubMed", "id": "16497976", "url": "https://pubmed.ncbi.nlm.nih.gov/16497976" }, { "database": "PubMed", "id": "19901323", "url": "https://pubmed.ncbi.nlm.nih.gov/19901323" }, { "database": "PubMed", "id": "7682059", "url": "https://pubmed.ncbi.nlm.nih.gov/7682059" }, { "database": "PubMed", "id": "10498607", "url": "https://pubmed.ncbi.nlm.nih.gov/10498607" }, { "database": "PubMed", "id": "11507089", "url": "https://pubmed.ncbi.nlm.nih.gov/11507089" }, { "database": "PubMed", "id": "11606584", "url": "https://pubmed.ncbi.nlm.nih.gov/11606584" } ], "site_lbl": "Tyr759", "uniprot_canonical_ac": "P16885-1" } ], "record_id": "pubmed.10498607", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 92 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 5 }, { "field": "total_sites", "count": 4 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Decay accelerating activity of complement receptor type 1 (CD35). Two active sites are required for dissociating C5 convertases.", "journal": "The Journal of biological chemistry", "date": "1999", "authors": "Krych-Goldberg M, Hauhart RE, Subramanian VB, Yurcisin BM 2nd, Crimmins DL, Hourcade DE, Atkinson JP", "reference": { "type": "PubMed", "id": "10531307", "url": "https://pubmed.ncbi.nlm.nih.gov/10531307" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P01700-1", "protein_name": "Immunoglobulin lambda variable 1-47", "gene_name": "IGLV1-47", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01714-1", "protein_name": "Immunoglobulin lambda variable 3-19", "gene_name": "IGLV3-19", "tax_name": "Human" }, { "uniprot_canonical_ac": "P80748-1", "protein_name": "Immunoglobulin lambda variable 3-21", "gene_name": "IGLV3-21", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A075B6P5-1", "protein_name": "Immunoglobulin kappa variable 2-28", "gene_name": "IGKV2-28", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A075B6S6-1", "protein_name": "Immunoglobulin kappa variable 2D-30", "gene_name": "IGKV2D-30", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0C4DH25-1", "protein_name": "Immunoglobulin kappa variable 3D-20", "gene_name": "IGKV3D-20", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01593-1", "protein_name": "Immunoglobulin kappa variable 1D-33", "gene_name": "IGKV1D-33", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01599-1", "protein_name": "Immunoglobulin kappa variable 1-17", "gene_name": "IGKV1-17", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01601-1", "protein_name": "Immunoglobulin kappa variable 1D-16", "gene_name": "IGKV1D-16", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01611-1", "protein_name": "Immunoglobulin kappa variable 1D-12", "gene_name": "IGKV1D-12", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01615-1", "protein_name": "Immunoglobulin kappa variable 2D-28", "gene_name": "IGKV2D-28", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01619-1", "protein_name": "Immunoglobulin kappa variable 3-20", "gene_name": "IGKV3-20", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01624-1", "protein_name": "Immunoglobulin kappa variable 3-15", "gene_name": "IGKV3-15", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04433-1", "protein_name": "Immunoglobulin kappa variable 3-11", "gene_name": "IGKV3-11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01602-1", "protein_name": "Immunoglobulin kappa variable 1-5", "gene_name": "IGKV1-5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P00734-1", "protein_name": "Prothrombin", "gene_name": "F2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P10909-1", "protein_name": "Clusterin", "gene_name": "CLU", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06681-1", "protein_name": "Complement C2", "gene_name": "C2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P15391-1", "protein_name": "B-lymphocyte antigen CD19", "gene_name": "CD19", "tax_name": "Human" }, { "uniprot_canonical_ac": "P08246-1", "protein_name": "Neutrophil elastase", "gene_name": "ELANE", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01767-1", "protein_name": "Immunoglobulin heavy variable 3-53", "gene_name": "IGHV3-53", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06331-1", "protein_name": "Immunoglobulin heavy variable 4-34", "gene_name": "IGHV4-34", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01597-1", "protein_name": "Immunoglobulin kappa variable 1-39", "gene_name": "IGKV1-39", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06310-1", "protein_name": "Immunoglobulin kappa variable 2-30", "gene_name": "IGKV2-30", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06312-1", "protein_name": "Immunoglobulin kappa variable 4-1", "gene_name": "IGKV4-1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01614-1", "protein_name": "Immunoglobulin kappa variable 2D-40", "gene_name": "IGKV2D-40", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DOY2-1", "protein_name": "Immunoglobulin lambda constant 2", "gene_name": "IGLC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P08603-1", "protein_name": "Complement factor H", "gene_name": "CFH", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05156-1", "protein_name": "Complement factor I", "gene_name": "CFI", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16581-1", "protein_name": "C3a anaphylatoxin chemotactic receptor", "gene_name": "C3AR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P00736-1", "protein_name": "Complement C1r subcomponent", "gene_name": "C1R", "tax_name": "Human" }, { "uniprot_canonical_ac": "P09871-1", "protein_name": "Complement C1s subcomponent", "gene_name": "C1S", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04003-1", "protein_name": "C4b-binding protein alpha chain", "gene_name": "C4BPA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P02747-1", "protein_name": "Complement C1q subcomponent subunit C", "gene_name": "C1QC", "tax_name": "Human" }, { "uniprot_canonical_ac": "P20851-1", "protein_name": "C4b-binding protein beta chain", "gene_name": "C4BPB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96IY4-1", "protein_name": "Carboxypeptidase B2", "gene_name": "CPB2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0C0L5-1", "protein_name": "Complement C4-B", "gene_name": "C4B_2; C4B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0C0L4-1", "protein_name": "Complement C4-A", "gene_name": "C4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P07360-1", "protein_name": "Complement component C8 gamma chain", "gene_name": "C8G", "tax_name": "Human" }, { "uniprot_canonical_ac": "P13671-1", "protein_name": "Complement component C6", "gene_name": "C6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01031-1", "protein_name": "Complement C5", "gene_name": "C5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P02748-1", "protein_name": "Complement component C9", "gene_name": "C9", "tax_name": "Human" }, { "uniprot_canonical_ac": "P07357-1", "protein_name": "Complement component C8 alpha chain", "gene_name": "C8A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P08174-1", "protein_name": "Complement decay-accelerating factor", "gene_name": "CD55", "tax_name": "Human" }, { "uniprot_canonical_ac": "P15529-1", "protein_name": "Membrane cofactor protein", "gene_name": "CD46", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04432-1", "protein_name": "Immunoglobulin kappa variable 1D-39", "gene_name": "IGKV1D-39", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06315-1", "protein_name": "Immunoglobulin kappa variable 5-2", "gene_name": "IGKV5-2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01699-1", "protein_name": "Immunoglobulin lambda variable 1-44", "gene_name": "IGLV1-44", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01701-1", "protein_name": "Immunoglobulin lambda variable 1-51", "gene_name": "IGLV1-51", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01704-1", "protein_name": "Immunoglobulin lambda variable 2-14", "gene_name": "IGLV2-14", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01706-1", "protein_name": "Immunoglobulin lambda variable 2-11", "gene_name": "IGLV2-11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01709-1", "protein_name": "Immunoglobulin lambda variable 2-8", "gene_name": "IGLV2-8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01717-1", "protein_name": "Immunoglobulin lambda variable 3-25", "gene_name": "IGLV3-25", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01721-1", "protein_name": "Immunoglobulin lambda variable 6-57", "gene_name": "IGLV6-57", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01703-1", "protein_name": "Immunoglobulin lambda variable 1-40", "gene_name": "IGLV1-40", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01705-1", "protein_name": "Immunoglobulin lambda variable 2-23", "gene_name": "IGLV2-23", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01715-1", "protein_name": "Immunoglobulin lambda variable 3-1", "gene_name": "IGLV3-1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01718-1", "protein_name": "Immunoglobulin lambda variable 3-27", "gene_name": "IGLV3-27", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04211-1", "protein_name": "Immunoglobulin lambda variable 7-43", "gene_name": "IGLV7-43", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05155-1", "protein_name": "Plasma protease C1 inhibitor", "gene_name": "SERPING1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P22792-1", "protein_name": "Carboxypeptidase N subunit 2", "gene_name": "CPN2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P20023-1", "protein_name": "Complement receptor type 2", "gene_name": "CR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01860-2", "protein_name": "Immunoglobulin heavy constant gamma 3", "gene_name": "IGHG3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01861-2", "protein_name": "Immunoglobulin heavy constant gamma 4", "gene_name": "IGHG4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CF74-1", "protein_name": "Immunoglobulin lambda constant 6", "gene_name": "IGLC6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P17927-1", "protein_name": "Complement receptor type 1", "gene_name": "CR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P10643-1", "protein_name": "Complement component C7", "gene_name": "C7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P07358-1", "protein_name": "Complement component C8 beta chain", "gene_name": "C8B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BXR6-1", "protein_name": "Complement factor H-related protein 5", "gene_name": "CFHR5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P36980-1", "protein_name": "Complement factor H-related protein 2", "gene_name": "CFHR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q02985-1", "protein_name": "Complement factor H-related protein 3", "gene_name": "CFHR3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P02746-1", "protein_name": "Complement C1q subcomponent subunit B", "gene_name": "C1QB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9P296-1", "protein_name": "C5a anaphylatoxin chemotactic receptor 2", "gene_name": "C5AR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P02745-1", "protein_name": "Complement C1q subcomponent subunit A", "gene_name": "C1QA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04004-1", "protein_name": "Vitronectin", "gene_name": "VTN", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01825-1", "protein_name": "Immunoglobulin heavy variable 4-59", "gene_name": "IGHV4-59", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01817-1", "protein_name": "Immunoglobulin heavy variable 2-5", "gene_name": "IGHV2-5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01824-1", "protein_name": "Immunoglobulin heavy variable 4-39", "gene_name": "IGHV4-39", "tax_name": "Human" }, { "uniprot_canonical_ac": "P23083-1", "protein_name": "Immunoglobulin heavy variable 1-2", "gene_name": "IGHV1-2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P07225-1", "protein_name": "Vitamin K-dependent protein S", "gene_name": "PROS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01742-1", "protein_name": "Immunoglobulin heavy variable 1-69", "gene_name": "IGHV1-69", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01768-1", "protein_name": "Immunoglobulin heavy variable 3-30", "gene_name": "IGHV3-30", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01814-1", "protein_name": "Immunoglobulin heavy variable 2-70", "gene_name": "IGHV2-70", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92496-1", "protein_name": "Complement factor H-related protein 4", "gene_name": "CFHR4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01772-1", "protein_name": "Immunoglobulin heavy variable 3-33", "gene_name": "IGHV3-33", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01762-1", "protein_name": "Immunoglobulin heavy variable 3-11", "gene_name": "IGHV3-11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01763-1", "protein_name": "Immunoglobulin heavy variable 3-48", "gene_name": "IGHV3-48", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01764-1", "protein_name": "Immunoglobulin heavy variable 3-23", "gene_name": "IGHV3-23", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01766-1", "protein_name": "Immunoglobulin heavy variable 3-13", "gene_name": "IGHV3-13", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01780-1", "protein_name": "Immunoglobulin heavy variable 3-7", "gene_name": "IGHV3-7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01782-1", "protein_name": "Immunoglobulin heavy variable 3-9", "gene_name": "IGHV3-9", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0M8Q6-1", "protein_name": "Immunoglobulin lambda constant 7", "gene_name": "IGLC7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01834-1", "protein_name": "Immunoglobulin kappa constant", "gene_name": "IGKC", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01859-2", "protein_name": "Immunoglobulin heavy constant gamma 2", "gene_name": "IGHG2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG04-1", "protein_name": "Immunoglobulin lambda constant 1", "gene_name": "IGLC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DOY3-1", "protein_name": "Immunoglobulin lambda constant 3", "gene_name": "IGLC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P13987-1", "protein_name": "CD59 glycoprotein", "gene_name": "CD59", "tax_name": "Human" }, { "uniprot_canonical_ac": "P60033-1", "protein_name": "CD81 antigen", "gene_name": "CD81", "tax_name": "Human" }, { "uniprot_canonical_ac": "P21730-1", "protein_name": "C5a anaphylatoxin chemotactic receptor 1", "gene_name": "C5AR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P15169-1", "protein_name": "Carboxypeptidase N catalytic chain", "gene_name": "CPN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01024-1", "protein_name": "Complement C3", "gene_name": "C3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P00751-1", "protein_name": "Complement factor B", "gene_name": "CFB", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01743-1", "protein_name": "Immunoglobulin heavy variable 1-46", "gene_name": "IGHV1-46", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27918-1", "protein_name": "Properdin", "gene_name": "CFP", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0C4DH73-1", "protein_name": "Immunoglobulin kappa variable 1-12", "gene_name": "IGKV1-12", "tax_name": "Human" }, { "uniprot_canonical_ac": "A2NJV5-1", "protein_name": "Immunoglobulin kappa variable 2-29", "gene_name": "IGKV2-29", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01594-1", "protein_name": "Immunoglobulin kappa variable 1-33", "gene_name": "IGKV1-33", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04430-1", "protein_name": "Immunoglobulin kappa variable 1-16", "gene_name": "IGKV1-16", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01857-2", "protein_name": "Immunoglobulin heavy constant gamma 1", "gene_name": "IGHG1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q03591-1", "protein_name": "Complement factor H-related protein 1", "gene_name": "CFHR1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P01700", "url": "https://www.uniprot.org/uniprotkb/P01700" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.10531307", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 110 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Interaction of SLP adaptors with the SH2 domain of Tec family kinases.", "journal": "European journal of immunology", "date": "1999", "authors": "Su YW, Zhang Y, Schweikert J, Koretzky GA, Reth M, Wienands J", "reference": { "type": "PubMed", "id": "10556826", "url": "https://pubmed.ncbi.nlm.nih.gov/10556826" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P01700-1", "protein_name": "Immunoglobulin lambda variable 1-47", "gene_name": "IGLV1-47", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01714-1", "protein_name": "Immunoglobulin lambda variable 3-19", "gene_name": "IGLV3-19", "tax_name": "Human" }, { "uniprot_canonical_ac": "P80748-1", "protein_name": "Immunoglobulin lambda variable 3-21", "gene_name": "IGLV3-21", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A075B6P5-1", "protein_name": "Immunoglobulin kappa variable 2-28", "gene_name": "IGKV2-28", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A075B6S6-1", "protein_name": "Immunoglobulin kappa variable 2D-30", "gene_name": "IGKV2D-30", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0C4DH25-1", "protein_name": "Immunoglobulin kappa variable 3D-20", "gene_name": "IGKV3D-20", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01593-1", "protein_name": "Immunoglobulin kappa variable 1D-33", "gene_name": "IGKV1D-33", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01599-1", "protein_name": "Immunoglobulin kappa variable 1-17", "gene_name": "IGKV1-17", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01601-1", "protein_name": "Immunoglobulin kappa variable 1D-16", "gene_name": "IGKV1D-16", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01611-1", "protein_name": "Immunoglobulin kappa variable 1D-12", "gene_name": "IGKV1D-12", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01615-1", "protein_name": "Immunoglobulin kappa variable 2D-28", "gene_name": "IGKV2D-28", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01619-1", "protein_name": "Immunoglobulin kappa variable 3-20", "gene_name": "IGKV3-20", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01624-1", "protein_name": "Immunoglobulin kappa variable 3-15", "gene_name": "IGKV3-15", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04433-1", "protein_name": "Immunoglobulin kappa variable 3-11", "gene_name": "IGKV3-11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01602-1", "protein_name": "Immunoglobulin kappa variable 1-5", "gene_name": "IGKV1-5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8WV28-1", "protein_name": "B-cell linker protein", "gene_name": "BLNK", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14643-1", "protein_name": "Inositol 1,4,5-trisphosphate-gated calcium channel ITPR1", "gene_name": "ITPR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UN19-1", "protein_name": "Dual adapter for phosphotyrosine and 3-phosphotyrosine and 3-phosphoinositide", "gene_name": "DAPP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P43405-1", "protein_name": "Tyrosine-protein kinase SYK", "gene_name": "SYK", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96SN7-1", "protein_name": "Protein orai-2", "gene_name": "ORAI2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P15391-1", "protein_name": "B-lymphocyte antigen CD19", "gene_name": "CD19", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01871-2", "protein_name": "Immunoglobulin heavy constant mu", "gene_name": "IGHM", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13586-1", "protein_name": "Stromal interaction molecule 1", "gene_name": "STIM1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01767-1", "protein_name": "Immunoglobulin heavy variable 3-53", "gene_name": "IGHV3-53", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06331-1", "protein_name": "Immunoglobulin heavy variable 4-34", "gene_name": "IGHV4-34", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14571-1", "protein_name": "Inositol 1,4,5-trisphosphate-gated calcium channel ITPR2", "gene_name": "ITPR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01597-1", "protein_name": "Immunoglobulin kappa variable 1-39", "gene_name": "IGKV1-39", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06310-1", "protein_name": "Immunoglobulin kappa variable 2-30", "gene_name": "IGKV2-30", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06312-1", "protein_name": "Immunoglobulin kappa variable 4-1", "gene_name": "IGKV4-1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01614-1", "protein_name": "Immunoglobulin kappa variable 2D-40", "gene_name": "IGKV2D-40", "tax_name": "Human" }, { "uniprot_canonical_ac": "P48995-1", "protein_name": "Short transient receptor potential channel 1", "gene_name": "TRPC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DOY2-1", "protein_name": "Immunoglobulin lambda constant 2", "gene_name": "IGLC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6ZUJ8-1", "protein_name": "Phosphoinositide 3-kinase adapter protein 1", "gene_name": "PIK3AP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96D31-1", "protein_name": "Calcium release-activated calcium channel protein 1", "gene_name": "ORAI1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DP23-1", "protein_name": "Calmodulin-1", "gene_name": "CALM1; CALM2; CALM3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P29350-1", "protein_name": "Tyrosine-protein phosphatase non-receptor type 6", "gene_name": "PTPN6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P20273-1", "protein_name": "B-cell receptor CD22", "gene_name": "CD22", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04432-1", "protein_name": "Immunoglobulin kappa variable 1D-39", "gene_name": "IGKV1D-39", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06315-1", "protein_name": "Immunoglobulin kappa variable 5-2", "gene_name": "IGKV5-2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01699-1", "protein_name": "Immunoglobulin lambda variable 1-44", "gene_name": "IGLV1-44", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01701-1", "protein_name": "Immunoglobulin lambda variable 1-51", "gene_name": "IGLV1-51", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01704-1", "protein_name": "Immunoglobulin lambda variable 2-14", "gene_name": "IGLV2-14", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01706-1", "protein_name": "Immunoglobulin lambda variable 2-11", "gene_name": "IGLV2-11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01709-1", "protein_name": "Immunoglobulin lambda variable 2-8", "gene_name": "IGLV2-8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01717-1", "protein_name": "Immunoglobulin lambda variable 3-25", "gene_name": "IGLV3-25", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01721-1", "protein_name": "Immunoglobulin lambda variable 6-57", "gene_name": "IGLV6-57", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01703-1", "protein_name": "Immunoglobulin lambda variable 1-40", "gene_name": "IGLV1-40", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01705-1", "protein_name": "Immunoglobulin lambda variable 2-23", "gene_name": "IGLV2-23", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01715-1", "protein_name": "Immunoglobulin lambda variable 3-1", "gene_name": "IGLV3-1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01718-1", "protein_name": "Immunoglobulin lambda variable 3-27", "gene_name": "IGLV3-27", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04211-1", "protein_name": "Immunoglobulin lambda variable 7-43", "gene_name": "IGLV7-43", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q07889-1", "protein_name": "Son of sevenless homolog 1", "gene_name": "SOS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01880-2", "protein_name": "Immunoglobulin heavy constant delta", "gene_name": "IGHD", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CF74-1", "protein_name": "Immunoglobulin lambda constant 6", "gene_name": "IGLC6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q06187-1", "protein_name": "Tyrosine-protein kinase BTK", "gene_name": "BTK", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96B97-1", "protein_name": "SH3 domain-containing kinase-binding protein 1", "gene_name": "SH3KBP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P07948-1", "protein_name": "Tyrosine-protein kinase Lyn", "gene_name": "LYN", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51451-1", "protein_name": "Tyrosine-protein kinase Blk", "gene_name": "BLK", "tax_name": "Human" }, { "uniprot_canonical_ac": "P16885-1", "protein_name": "1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-2", "gene_name": "PLCG2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43865-1", "protein_name": "S-adenosylhomocysteine hydrolase-like protein 1", "gene_name": "AHCYL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01825-1", "protein_name": "Immunoglobulin heavy variable 4-59", "gene_name": "IGHV4-59", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01817-1", "protein_name": "Immunoglobulin heavy variable 2-5", "gene_name": "IGHV2-5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01824-1", "protein_name": "Immunoglobulin heavy variable 4-39", "gene_name": "IGHV4-39", "tax_name": "Human" }, { "uniprot_canonical_ac": "P23083-1", "protein_name": "Immunoglobulin heavy variable 1-2", "gene_name": "IGHV1-2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00329-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit delta isoform", "gene_name": "PIK3CD", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01742-1", "protein_name": "Immunoglobulin heavy variable 1-69", "gene_name": "IGHV1-69", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01768-1", "protein_name": "Immunoglobulin heavy variable 3-30", "gene_name": "IGHV3-30", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01814-1", "protein_name": "Immunoglobulin heavy variable 2-70", "gene_name": "IGHV2-70", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01772-1", "protein_name": "Immunoglobulin heavy variable 3-33", "gene_name": "IGHV3-33", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01762-1", "protein_name": "Immunoglobulin heavy variable 3-11", "gene_name": "IGHV3-11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01763-1", "protein_name": "Immunoglobulin heavy variable 3-48", "gene_name": "IGHV3-48", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01764-1", "protein_name": "Immunoglobulin heavy variable 3-23", "gene_name": "IGHV3-23", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01766-1", "protein_name": "Immunoglobulin heavy variable 3-13", "gene_name": "IGHV3-13", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01780-1", "protein_name": "Immunoglobulin heavy variable 3-7", "gene_name": "IGHV3-7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01782-1", "protein_name": "Immunoglobulin heavy variable 3-9", "gene_name": "IGHV3-9", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0M8Q6-1", "protein_name": "Immunoglobulin lambda constant 7", "gene_name": "IGLC7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01834-1", "protein_name": "Immunoglobulin kappa constant", "gene_name": "IGKC", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG04-1", "protein_name": "Immunoglobulin lambda constant 1", "gene_name": "IGLC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DOY3-1", "protein_name": "Immunoglobulin lambda constant 3", "gene_name": "IGLC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P11912-1", "protein_name": "B-cell antigen receptor complex-associated protein alpha chain", "gene_name": "CD79A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P40259-1", "protein_name": "B-cell antigen receptor complex-associated protein beta chain", "gene_name": "CD79B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01743-1", "protein_name": "Immunoglobulin heavy variable 1-46", "gene_name": "IGHV1-46", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14573-1", "protein_name": "Inositol 1,4,5-trisphosphate-gated calcium channel ITPR3", "gene_name": "ITPR3", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0C4DH73-1", "protein_name": "Immunoglobulin kappa variable 1-12", "gene_name": "IGKV1-12", "tax_name": "Human" }, { "uniprot_canonical_ac": "A2NJV5-1", "protein_name": "Immunoglobulin kappa variable 2-29", "gene_name": "IGKV2-29", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01594-1", "protein_name": "Immunoglobulin kappa variable 1-33", "gene_name": "IGKV1-33", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04430-1", "protein_name": "Immunoglobulin kappa variable 1-16", "gene_name": "IGKV1-16", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27986-1", "protein_name": "Phosphatidylinositol 3-kinase regulatory subunit alpha", "gene_name": "PIK3R1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06241-1", "protein_name": "Tyrosine-protein kinase Fyn", "gene_name": "FYN", "tax_name": "Human" }, { "uniprot_canonical_ac": "P16333-1", "protein_name": "SH2/SH3 adapter protein NCK1", "gene_name": "NCK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P15498-1", "protein_name": "Proto-oncogene vav", "gene_name": "VAV1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P01700", "url": "https://www.uniprot.org/uniprotkb/P01700" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.10556826", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 91 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The biology of the 17-1A antigen (Ep-CAM).", "journal": "Journal of molecular medicine (Berlin, Germany)", "date": "1999", "authors": "Balzar M, Winter MJ, de Boer CJ, Litvinov SV", "reference": { "type": "PubMed", "id": "10606205", "url": "https://pubmed.ncbi.nlm.nih.gov/10606205" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P01700-1", "protein_name": "Immunoglobulin lambda variable 1-47", "gene_name": "IGLV1-47", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01714-1", "protein_name": "Immunoglobulin lambda variable 3-19", "gene_name": "IGLV3-19", "tax_name": "Human" }, { "uniprot_canonical_ac": "P80748-1", "protein_name": "Immunoglobulin lambda variable 3-21", "gene_name": "IGLV3-21", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A075B6P5-1", "protein_name": "Immunoglobulin kappa variable 2-28", "gene_name": "IGKV2-28", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A075B6S6-1", "protein_name": "Immunoglobulin kappa variable 2D-30", "gene_name": "IGKV2D-30", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0C4DH25-1", "protein_name": "Immunoglobulin kappa variable 3D-20", "gene_name": "IGKV3D-20", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01593-1", "protein_name": "Immunoglobulin kappa variable 1D-33", "gene_name": "IGKV1D-33", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01599-1", "protein_name": "Immunoglobulin kappa variable 1-17", "gene_name": "IGKV1-17", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01601-1", "protein_name": "Immunoglobulin kappa variable 1D-16", "gene_name": "IGKV1D-16", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01611-1", "protein_name": "Immunoglobulin kappa variable 1D-12", "gene_name": "IGKV1D-12", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01615-1", "protein_name": "Immunoglobulin kappa variable 2D-28", "gene_name": "IGKV2D-28", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01619-1", "protein_name": "Immunoglobulin kappa variable 3-20", "gene_name": "IGKV3-20", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01624-1", "protein_name": "Immunoglobulin kappa variable 3-15", "gene_name": "IGKV3-15", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04433-1", "protein_name": "Immunoglobulin kappa variable 3-11", "gene_name": "IGKV3-11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01602-1", "protein_name": "Immunoglobulin kappa variable 1-5", "gene_name": "IGKV1-5", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75056-1", "protein_name": "Syndecan-3", "gene_name": "SDC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P07204-1", "protein_name": "Thrombomodulin", "gene_name": "THBD", "tax_name": "Human" }, { "uniprot_canonical_ac": "P00734-1", "protein_name": "Prothrombin", "gene_name": "F2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P02452-1", "protein_name": "Collagen alpha-1(I) chain", "gene_name": "COL1A1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04114-1", "protein_name": "Apolipoprotein B-100", "gene_name": "APOB", "tax_name": "Human" }, { "uniprot_canonical_ac": "P02751-15", "protein_name": "Fibronectin", "gene_name": "FN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00220-1", "protein_name": "Tumor necrosis factor receptor superfamily member 10A", "gene_name": "TNFRSF10A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P14209-1", "protein_name": "CD99 antigen", "gene_name": "CD99", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9P1W8-1", "protein_name": "Signal-regulatory protein gamma", "gene_name": "SIRPG", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q08722-1", "protein_name": "Leukocyte surface antigen CD47", "gene_name": "CD47", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01871-2", "protein_name": "Immunoglobulin heavy constant mu", "gene_name": "IGHM", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UNN8-1", "protein_name": "Endothelial protein C receptor", "gene_name": "PROCR", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8WWV6-1", "protein_name": "High affinity immunoglobulin alpha and immunoglobulin mu Fc receptor", "gene_name": "FCAMR", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96AP7-1", "protein_name": "Endothelial cell-selective adhesion molecule", "gene_name": "ESAM", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14393-2", "protein_name": "Growth arrest-specific protein 6", "gene_name": "GAS6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P30273-1", "protein_name": "High affinity immunoglobulin epsilon receptor subunit gamma", "gene_name": "FCER1G", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92896-1", "protein_name": "Golgi apparatus protein 1", "gene_name": "GLG1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P20701-1", "protein_name": "Integrin alpha-L", "gene_name": "ITGAL", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01767-1", "protein_name": "Immunoglobulin heavy variable 3-53", "gene_name": "IGHV3-53", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06331-1", "protein_name": "Immunoglobulin heavy variable 4-34", "gene_name": "IGHV4-34", "tax_name": "Human" }, { "uniprot_canonical_ac": "P19256-1", "protein_name": "Lymphocyte function-associated antigen 3", "gene_name": "CD58", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y624-1", "protein_name": "Junctional adhesion molecule A", "gene_name": "F11R", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01597-1", "protein_name": "Immunoglobulin kappa variable 1-39", "gene_name": "IGKV1-39", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06310-1", "protein_name": "Immunoglobulin kappa variable 2-30", "gene_name": "IGKV2-30", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06312-1", "protein_name": "Immunoglobulin kappa variable 4-1", "gene_name": "IGKV4-1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01614-1", "protein_name": "Immunoglobulin kappa variable 2D-40", "gene_name": "IGKV2D-40", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DOY2-1", "protein_name": "Immunoglobulin lambda constant 2", "gene_name": "IGLC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P78380-1", "protein_name": "Oxidized low-density lipoprotein receptor 1", "gene_name": "OLR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P11464-1", "protein_name": "Pregnancy-specific beta-1-glycoprotein 1", "gene_name": "PSG1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q00887-1", "protein_name": "Pregnancy-specific beta-1-glycoprotein 9", "gene_name": "PSG9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UQ72-1", "protein_name": "Pregnancy-specific beta-1-glycoprotein 11", "gene_name": "PSG11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06731-1", "protein_name": "Cell adhesion molecule CEACAM5", "gene_name": "CEACAM5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P18827-1", "protein_name": "Syndecan-1", "gene_name": "SDC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UIB8-1", "protein_name": "SLAM family member 5", "gene_name": "CD84", "tax_name": "Human" }, { "uniprot_canonical_ac": "P09326-1", "protein_name": "CD48 antigen", "gene_name": "CD48", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TCZ2-1", "protein_name": "CD99 antigen-like protein 2", "gene_name": "CD99L2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P02724-1", "protein_name": "Glycophorin-A", "gene_name": "GYPA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P14174-1", "protein_name": "Macrophage migration inhibitory factor", "gene_name": "MIF", "tax_name": "Human" }, { "uniprot_canonical_ac": "P13688-1", "protein_name": "Cell adhesion molecule CEACAM1", "gene_name": "CEACAM1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06729-1", "protein_name": "T-cell surface antigen CD2", "gene_name": "CD2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P40199-1", "protein_name": "Cell adhesion molecule CEACAM6", "gene_name": "CEACAM6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BZW8-1", "protein_name": "Natural killer cell receptor 2B4", "gene_name": "CD244", "tax_name": "Human" }, { "uniprot_canonical_ac": "P16070-1", "protein_name": "CD44 antigen", "gene_name": "CD44", "tax_name": "Human" }, { "uniprot_canonical_ac": "P31997-1", "protein_name": "Cell adhesion molecule CEACAM8", "gene_name": "CEACAM8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P40198-1", "protein_name": "Cell adhesion molecule CEACAM3", "gene_name": "CEACAM3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N6Q3-1", "protein_name": "CD177 antigen", "gene_name": "CD177", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04233-1", "protein_name": "HLA class II histocompatibility antigen gamma chain", "gene_name": "CD74", "tax_name": "Human" }, { "uniprot_canonical_ac": "P16284-1", "protein_name": "Platelet endothelial cell adhesion molecule", "gene_name": "PECAM1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P31431-1", "protein_name": "Syndecan-4", "gene_name": "SDC4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04432-1", "protein_name": "Immunoglobulin kappa variable 1D-39", "gene_name": "IGKV1D-39", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06315-1", "protein_name": "Immunoglobulin kappa variable 5-2", "gene_name": "IGKV5-2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01699-1", "protein_name": "Immunoglobulin lambda variable 1-44", "gene_name": "IGLV1-44", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01701-1", "protein_name": "Immunoglobulin lambda variable 1-51", "gene_name": "IGLV1-51", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01704-1", "protein_name": "Immunoglobulin lambda variable 2-14", "gene_name": "IGLV2-14", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01706-1", "protein_name": "Immunoglobulin lambda variable 2-11", "gene_name": "IGLV2-11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01709-1", "protein_name": "Immunoglobulin lambda variable 2-8", "gene_name": "IGLV2-8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01717-1", "protein_name": "Immunoglobulin lambda variable 3-25", "gene_name": "IGLV3-25", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01721-1", "protein_name": "Immunoglobulin lambda variable 6-57", "gene_name": "IGLV6-57", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01703-1", "protein_name": "Immunoglobulin lambda variable 1-40", "gene_name": "IGLV1-40", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01705-1", "protein_name": "Immunoglobulin lambda variable 2-23", "gene_name": "IGLV2-23", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01715-1", "protein_name": "Immunoglobulin lambda variable 3-1", "gene_name": "IGLV3-1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01718-1", "protein_name": "Immunoglobulin lambda variable 3-27", "gene_name": "IGLV3-27", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04211-1", "protein_name": "Immunoglobulin lambda variable 7-43", "gene_name": "IGLV7-43", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06028-1", "protein_name": "Glycophorin-B", "gene_name": "GYPB", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04921-1", "protein_name": "Glycophorin-C", "gene_name": "GYPC", "tax_name": "Human" }, { "uniprot_canonical_ac": "P15814-1", "protein_name": "Immunoglobulin lambda-like polypeptide 1", "gene_name": "IGLL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P11215-1", "protein_name": "Integrin alpha-M", "gene_name": "ITGAM", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01876-2", "protein_name": "Immunoglobulin heavy constant alpha 1", "gene_name": "IGHA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CF74-1", "protein_name": "Immunoglobulin lambda constant 6", "gene_name": "IGLC6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P08648-1", "protein_name": "Integrin alpha-5", "gene_name": "ITGA5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P13612-1", "protein_name": "Integrin alpha-4", "gene_name": "ITGA4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P02776-1", "protein_name": "Platelet factor 4", "gene_name": "PF4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P07948-1", "protein_name": "Tyrosine-protein kinase Lyn", "gene_name": "LYN", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05556-1", "protein_name": "Integrin beta-1", "gene_name": "ITGB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NRD5-1", "protein_name": "PRKCA-binding protein", "gene_name": "PICK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P08123-1", "protein_name": "Collagen alpha-2(I) chain", "gene_name": "COL1A2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04070-1", "protein_name": "Vitamin K-dependent protein C", "gene_name": "PROC", "tax_name": "Human" }, { "uniprot_canonical_ac": "P34741-1", "protein_name": "Syndecan-2", "gene_name": "SDC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P78310-1", "protein_name": "Coxsackievirus and adenovirus receptor", "gene_name": "CXADR", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HCN6-1", "protein_name": "Platelet glycoprotein VI", "gene_name": "GP6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35052-1", "protein_name": "Glypican-1", "gene_name": "GPC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NP99-1", "protein_name": "Triggering receptor expressed on myeloid cells 1", "gene_name": "TREM1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01825-1", "protein_name": "Immunoglobulin heavy variable 4-59", "gene_name": "IGHV4-59", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01817-1", "protein_name": "Immunoglobulin heavy variable 2-5", "gene_name": "IGHV2-5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01824-1", "protein_name": "Immunoglobulin heavy variable 4-39", "gene_name": "IGHV4-39", "tax_name": "Human" }, { "uniprot_canonical_ac": "P23083-1", "protein_name": "Immunoglobulin heavy variable 1-2", "gene_name": "IGHV1-2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P10720-1", "protein_name": "Platelet factor 4 variant", "gene_name": "PF4V1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q00888-1", "protein_name": "Pregnancy-specific beta-1-glycoprotein 4", "gene_name": "PSG4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13046-1", "protein_name": "Pregnancy-specific beta-1-glycoprotein 7", "gene_name": "PSG7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q00889-1", "protein_name": "Pregnancy-specific beta-1-glycoprotein 6", "gene_name": "PSG6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P07225-1", "protein_name": "Vitamin K-dependent protein S", "gene_name": "PROS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P11465-1", "protein_name": "Pregnancy-specific beta-1-glycoprotein 2", "gene_name": "PSG2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01742-1", "protein_name": "Immunoglobulin heavy variable 1-69", "gene_name": "IGHV1-69", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01768-1", "protein_name": "Immunoglobulin heavy variable 3-30", "gene_name": "IGHV3-30", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01814-1", "protein_name": "Immunoglobulin heavy variable 2-70", "gene_name": "IGHV2-70", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01772-1", "protein_name": "Immunoglobulin heavy variable 3-33", "gene_name": "IGHV3-33", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01762-1", "protein_name": "Immunoglobulin heavy variable 3-11", "gene_name": "IGHV3-11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01763-1", "protein_name": "Immunoglobulin heavy variable 3-48", "gene_name": "IGHV3-48", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01764-1", "protein_name": "Immunoglobulin heavy variable 3-23", "gene_name": "IGHV3-23", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01766-1", "protein_name": "Immunoglobulin heavy variable 3-13", "gene_name": "IGHV3-13", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01780-1", "protein_name": "Immunoglobulin heavy variable 3-7", "gene_name": "IGHV3-7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01782-1", "protein_name": "Immunoglobulin heavy variable 3-9", "gene_name": "IGHV3-9", "tax_name": "Human" }, { "uniprot_canonical_ac": "P20702-1", "protein_name": "Integrin alpha-X", "gene_name": "ITGAX", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86YT9-1", "protein_name": "Junctional adhesion molecule-like", "gene_name": "JAML", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01877-2", "protein_name": "Immunoglobulin heavy constant alpha 2", "gene_name": "IGHA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BX67-1", "protein_name": "Junctional adhesion molecule C", "gene_name": "JAM3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01591-1", "protein_name": "Immunoglobulin J chain", "gene_name": "JCHAIN", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UQ74-1", "protein_name": "Pregnancy-specific beta-1-glycoprotein 8", "gene_name": "PSG8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16557-1", "protein_name": "Pregnancy-specific beta-1-glycoprotein 3", "gene_name": "PSG3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15238-1", "protein_name": "Pregnancy-specific beta-1-glycoprotein 5", "gene_name": "PSG5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P57087-1", "protein_name": "Junctional adhesion molecule B", "gene_name": "JAM2", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0M8Q6-1", "protein_name": "Immunoglobulin lambda constant 7", "gene_name": "IGLC7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01834-1", "protein_name": "Immunoglobulin kappa constant", "gene_name": "IGKC", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG04-1", "protein_name": "Immunoglobulin lambda constant 1", "gene_name": "IGLC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DOY3-1", "protein_name": "Immunoglobulin lambda constant 3", "gene_name": "IGLC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P78324-1", "protein_name": "Tyrosine-protein phosphatase non-receptor type substrate 1", "gene_name": "SIRPA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UKI3-1", "protein_name": "Pre-B lymphocyte protein 3", "gene_name": "VPREB3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P12018-1", "protein_name": "Immunoglobulin iota chain", "gene_name": "VPREB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01743-1", "protein_name": "Immunoglobulin heavy variable 1-46", "gene_name": "IGHV1-46", "tax_name": "Human" }, { "uniprot_canonical_ac": "P16109-1", "protein_name": "P-selectin", "gene_name": "SELP", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14242-1", "protein_name": "P-selectin glycoprotein ligand 1", "gene_name": "SELPLG", "tax_name": "Human" }, { "uniprot_canonical_ac": "P16581-1", "protein_name": "E-selectin", "gene_name": "SELE", "tax_name": "Human" }, { "uniprot_canonical_ac": "P16150-1", "protein_name": "Leukosialin", "gene_name": "SPN", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0C4DH73-1", "protein_name": "Immunoglobulin kappa variable 1-12", "gene_name": "IGKV1-12", "tax_name": "Human" }, { "uniprot_canonical_ac": "A2NJV5-1", "protein_name": "Immunoglobulin kappa variable 2-29", "gene_name": "IGKV2-29", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01594-1", "protein_name": "Immunoglobulin kappa variable 1-33", "gene_name": "IGKV1-33", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04430-1", "protein_name": "Immunoglobulin kappa variable 1-16", "gene_name": "IGKV1-16", "tax_name": "Human" }, { "uniprot_canonical_ac": "P14151-1", "protein_name": "L-selectin", "gene_name": "SELL", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12866-1", "protein_name": "Tyrosine-protein kinase Mer", "gene_name": "MERTK", "tax_name": "Human" }, { "uniprot_canonical_ac": "P16422-1", "protein_name": "Epithelial cell adhesion molecule", "gene_name": "EPCAM", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UBN6-1", "protein_name": "Tumor necrosis factor receptor superfamily member 10D", "gene_name": "TNFRSF10D", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14763-1", "protein_name": "Tumor necrosis factor receptor superfamily member 10B", "gene_name": "TNFRSF10B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P41732-1", "protein_name": "Tetraspanin-7", "gene_name": "TSPAN7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01137-1", "protein_name": "Transforming growth factor beta-1 proprotein", "gene_name": "TGFB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06241-1", "protein_name": "Tyrosine-protein kinase Fyn", "gene_name": "FYN", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05107-1", "protein_name": "Integrin beta-2", "gene_name": "ITGB2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P01700", "url": "https://www.uniprot.org/uniprotkb/P01700" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.10606205", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 151 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Purification and characterization of human Syk produced using a baculovirus expression system.", "journal": "Protein expression and purification", "date": "2000", "authors": "Baldock D, Graham B, Akhlaq M, Graff P, Jones CE, Menear K", "reference": { "type": "PubMed", "id": "10648173", "url": "https://pubmed.ncbi.nlm.nih.gov/10648173" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P01700-1", "protein_name": "Immunoglobulin lambda variable 1-47", "gene_name": "IGLV1-47", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01714-1", "protein_name": "Immunoglobulin lambda variable 3-19", "gene_name": "IGLV3-19", "tax_name": "Human" }, { "uniprot_canonical_ac": "P80748-1", "protein_name": "Immunoglobulin lambda variable 3-21", "gene_name": "IGLV3-21", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A075B6P5-1", "protein_name": "Immunoglobulin kappa variable 2-28", "gene_name": "IGKV2-28", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A075B6S6-1", "protein_name": "Immunoglobulin kappa variable 2D-30", "gene_name": "IGKV2D-30", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0C4DH25-1", "protein_name": "Immunoglobulin kappa variable 3D-20", "gene_name": "IGKV3D-20", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01593-1", "protein_name": "Immunoglobulin kappa variable 1D-33", "gene_name": "IGKV1D-33", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01599-1", "protein_name": "Immunoglobulin kappa variable 1-17", "gene_name": "IGKV1-17", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01601-1", "protein_name": "Immunoglobulin kappa variable 1D-16", "gene_name": "IGKV1D-16", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01611-1", "protein_name": "Immunoglobulin kappa variable 1D-12", "gene_name": "IGKV1D-12", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01615-1", "protein_name": "Immunoglobulin kappa variable 2D-28", "gene_name": "IGKV2D-28", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01619-1", "protein_name": "Immunoglobulin kappa variable 3-20", "gene_name": "IGKV3-20", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01624-1", "protein_name": "Immunoglobulin kappa variable 3-15", "gene_name": "IGKV3-15", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04433-1", "protein_name": "Immunoglobulin kappa variable 3-11", "gene_name": "IGKV3-11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01602-1", "protein_name": "Immunoglobulin kappa variable 1-5", "gene_name": "IGKV1-5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8WV28-1", "protein_name": "B-cell linker protein", "gene_name": "BLNK", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14643-1", "protein_name": "Inositol 1,4,5-trisphosphate-gated calcium channel ITPR1", "gene_name": "ITPR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UN19-1", "protein_name": "Dual adapter for phosphotyrosine and 3-phosphotyrosine and 3-phosphoinositide", "gene_name": "DAPP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P43405-1", "protein_name": "Tyrosine-protein kinase SYK", "gene_name": "SYK", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96SN7-1", "protein_name": "Protein orai-2", "gene_name": "ORAI2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P15391-1", "protein_name": "B-lymphocyte antigen CD19", "gene_name": "CD19", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01871-2", "protein_name": "Immunoglobulin heavy constant mu", "gene_name": "IGHM", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13586-1", "protein_name": "Stromal interaction molecule 1", "gene_name": "STIM1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01767-1", "protein_name": "Immunoglobulin heavy variable 3-53", "gene_name": "IGHV3-53", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06331-1", "protein_name": "Immunoglobulin heavy variable 4-34", "gene_name": "IGHV4-34", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14571-1", "protein_name": "Inositol 1,4,5-trisphosphate-gated calcium channel ITPR2", "gene_name": "ITPR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01597-1", "protein_name": "Immunoglobulin kappa variable 1-39", "gene_name": "IGKV1-39", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06310-1", "protein_name": "Immunoglobulin kappa variable 2-30", "gene_name": "IGKV2-30", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06312-1", "protein_name": "Immunoglobulin kappa variable 4-1", "gene_name": "IGKV4-1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01614-1", "protein_name": "Immunoglobulin kappa variable 2D-40", "gene_name": "IGKV2D-40", "tax_name": "Human" }, { "uniprot_canonical_ac": "P48995-1", "protein_name": "Short transient receptor potential channel 1", "gene_name": "TRPC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DOY2-1", "protein_name": "Immunoglobulin lambda constant 2", "gene_name": "IGLC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6ZUJ8-1", "protein_name": "Phosphoinositide 3-kinase adapter protein 1", "gene_name": "PIK3AP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96D31-1", "protein_name": "Calcium release-activated calcium channel protein 1", "gene_name": "ORAI1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DP23-1", "protein_name": "Calmodulin-1", "gene_name": "CALM1; CALM2; CALM3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P29350-1", "protein_name": "Tyrosine-protein phosphatase non-receptor type 6", "gene_name": "PTPN6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P20273-1", "protein_name": "B-cell receptor CD22", "gene_name": "CD22", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04432-1", "protein_name": "Immunoglobulin kappa variable 1D-39", "gene_name": "IGKV1D-39", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06315-1", "protein_name": "Immunoglobulin kappa variable 5-2", "gene_name": "IGKV5-2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01699-1", "protein_name": "Immunoglobulin lambda variable 1-44", "gene_name": "IGLV1-44", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01701-1", "protein_name": "Immunoglobulin lambda variable 1-51", "gene_name": "IGLV1-51", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01704-1", "protein_name": "Immunoglobulin lambda variable 2-14", "gene_name": "IGLV2-14", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01706-1", "protein_name": "Immunoglobulin lambda variable 2-11", "gene_name": "IGLV2-11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01709-1", "protein_name": "Immunoglobulin lambda variable 2-8", "gene_name": "IGLV2-8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01717-1", "protein_name": "Immunoglobulin lambda variable 3-25", "gene_name": "IGLV3-25", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01721-1", "protein_name": "Immunoglobulin lambda variable 6-57", "gene_name": "IGLV6-57", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01703-1", "protein_name": "Immunoglobulin lambda variable 1-40", "gene_name": "IGLV1-40", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01705-1", "protein_name": "Immunoglobulin lambda variable 2-23", "gene_name": "IGLV2-23", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01715-1", "protein_name": "Immunoglobulin lambda variable 3-1", "gene_name": "IGLV3-1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01718-1", "protein_name": "Immunoglobulin lambda variable 3-27", "gene_name": "IGLV3-27", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04211-1", "protein_name": "Immunoglobulin lambda variable 7-43", "gene_name": "IGLV7-43", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q07889-1", "protein_name": "Son of sevenless homolog 1", "gene_name": "SOS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01880-2", "protein_name": "Immunoglobulin heavy constant delta", "gene_name": "IGHD", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CF74-1", "protein_name": "Immunoglobulin lambda constant 6", "gene_name": "IGLC6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q06187-1", "protein_name": "Tyrosine-protein kinase BTK", "gene_name": "BTK", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96B97-1", "protein_name": "SH3 domain-containing kinase-binding protein 1", "gene_name": "SH3KBP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P07948-1", "protein_name": "Tyrosine-protein kinase Lyn", "gene_name": "LYN", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51451-1", "protein_name": "Tyrosine-protein kinase Blk", "gene_name": "BLK", "tax_name": "Human" }, { "uniprot_canonical_ac": "P16885-1", "protein_name": "1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-2", "gene_name": "PLCG2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43865-1", "protein_name": "S-adenosylhomocysteine hydrolase-like protein 1", "gene_name": "AHCYL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01825-1", "protein_name": "Immunoglobulin heavy variable 4-59", "gene_name": "IGHV4-59", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01817-1", "protein_name": "Immunoglobulin heavy variable 2-5", "gene_name": "IGHV2-5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01824-1", "protein_name": "Immunoglobulin heavy variable 4-39", "gene_name": "IGHV4-39", "tax_name": "Human" }, { "uniprot_canonical_ac": "P23083-1", "protein_name": "Immunoglobulin heavy variable 1-2", "gene_name": "IGHV1-2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00329-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit delta isoform", "gene_name": "PIK3CD", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01742-1", "protein_name": "Immunoglobulin heavy variable 1-69", "gene_name": "IGHV1-69", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01768-1", "protein_name": "Immunoglobulin heavy variable 3-30", "gene_name": "IGHV3-30", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01814-1", "protein_name": "Immunoglobulin heavy variable 2-70", "gene_name": "IGHV2-70", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01772-1", "protein_name": "Immunoglobulin heavy variable 3-33", "gene_name": "IGHV3-33", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01762-1", "protein_name": "Immunoglobulin heavy variable 3-11", "gene_name": "IGHV3-11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01763-1", "protein_name": "Immunoglobulin heavy variable 3-48", "gene_name": "IGHV3-48", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01764-1", "protein_name": "Immunoglobulin heavy variable 3-23", "gene_name": "IGHV3-23", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01766-1", "protein_name": "Immunoglobulin heavy variable 3-13", "gene_name": "IGHV3-13", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01780-1", "protein_name": "Immunoglobulin heavy variable 3-7", "gene_name": "IGHV3-7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01782-1", "protein_name": "Immunoglobulin heavy variable 3-9", "gene_name": "IGHV3-9", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0M8Q6-1", "protein_name": "Immunoglobulin lambda constant 7", "gene_name": "IGLC7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01834-1", "protein_name": "Immunoglobulin kappa constant", "gene_name": "IGKC", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG04-1", "protein_name": "Immunoglobulin lambda constant 1", "gene_name": "IGLC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DOY3-1", "protein_name": "Immunoglobulin lambda constant 3", "gene_name": "IGLC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P11912-1", "protein_name": "B-cell antigen receptor complex-associated protein alpha chain", "gene_name": "CD79A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P40259-1", "protein_name": "B-cell antigen receptor complex-associated protein beta chain", "gene_name": "CD79B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01743-1", "protein_name": "Immunoglobulin heavy variable 1-46", "gene_name": "IGHV1-46", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14573-1", "protein_name": "Inositol 1,4,5-trisphosphate-gated calcium channel ITPR3", "gene_name": "ITPR3", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0C4DH73-1", "protein_name": "Immunoglobulin kappa variable 1-12", "gene_name": "IGKV1-12", "tax_name": "Human" }, { "uniprot_canonical_ac": "A2NJV5-1", "protein_name": "Immunoglobulin kappa variable 2-29", "gene_name": "IGKV2-29", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01594-1", "protein_name": "Immunoglobulin kappa variable 1-33", "gene_name": "IGKV1-33", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04430-1", "protein_name": "Immunoglobulin kappa variable 1-16", "gene_name": "IGKV1-16", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27986-1", "protein_name": "Phosphatidylinositol 3-kinase regulatory subunit alpha", "gene_name": "PIK3R1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06241-1", "protein_name": "Tyrosine-protein kinase Fyn", "gene_name": "FYN", "tax_name": "Human" }, { "uniprot_canonical_ac": "P16333-1", "protein_name": "SH2/SH3 adapter protein NCK1", "gene_name": "NCK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P15498-1", "protein_name": "Proto-oncogene vav", "gene_name": "VAV1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P01700", "url": "https://www.uniprot.org/uniprotkb/P01700" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.10648173", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 91 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Control of the amplification convertase of complement by the plasma protein beta1H.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1976", "authors": "Weiler JM, Daha MR, Austen KF, Fearon DT", "reference": { "type": "PubMed", "id": "1067618", "url": "https://pubmed.ncbi.nlm.nih.gov/1067618" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P01700-1", "protein_name": "Immunoglobulin lambda variable 1-47", "gene_name": "IGLV1-47", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01714-1", "protein_name": "Immunoglobulin lambda variable 3-19", "gene_name": "IGLV3-19", "tax_name": "Human" }, { "uniprot_canonical_ac": "P80748-1", "protein_name": "Immunoglobulin lambda variable 3-21", "gene_name": "IGLV3-21", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A075B6P5-1", "protein_name": "Immunoglobulin kappa variable 2-28", "gene_name": "IGKV2-28", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A075B6S6-1", "protein_name": "Immunoglobulin kappa variable 2D-30", "gene_name": "IGKV2D-30", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0C4DH25-1", "protein_name": "Immunoglobulin kappa variable 3D-20", "gene_name": "IGKV3D-20", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01593-1", "protein_name": "Immunoglobulin kappa variable 1D-33", "gene_name": "IGKV1D-33", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01599-1", "protein_name": "Immunoglobulin kappa variable 1-17", "gene_name": "IGKV1-17", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01601-1", "protein_name": "Immunoglobulin kappa variable 1D-16", "gene_name": "IGKV1D-16", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01611-1", "protein_name": "Immunoglobulin kappa variable 1D-12", "gene_name": "IGKV1D-12", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01615-1", "protein_name": "Immunoglobulin kappa variable 2D-28", "gene_name": "IGKV2D-28", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01619-1", "protein_name": "Immunoglobulin kappa variable 3-20", "gene_name": "IGKV3-20", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01624-1", "protein_name": "Immunoglobulin kappa variable 3-15", "gene_name": "IGKV3-15", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04433-1", "protein_name": "Immunoglobulin kappa variable 3-11", "gene_name": "IGKV3-11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01602-1", "protein_name": "Immunoglobulin kappa variable 1-5", "gene_name": "IGKV1-5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P00734-1", "protein_name": "Prothrombin", "gene_name": "F2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P10909-1", "protein_name": "Clusterin", "gene_name": "CLU", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06681-1", "protein_name": "Complement C2", "gene_name": "C2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P15391-1", "protein_name": "B-lymphocyte antigen CD19", "gene_name": "CD19", "tax_name": "Human" }, { "uniprot_canonical_ac": "P08246-1", "protein_name": "Neutrophil elastase", "gene_name": "ELANE", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01767-1", "protein_name": "Immunoglobulin heavy variable 3-53", "gene_name": "IGHV3-53", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06331-1", "protein_name": "Immunoglobulin heavy variable 4-34", "gene_name": "IGHV4-34", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01597-1", "protein_name": "Immunoglobulin kappa variable 1-39", "gene_name": "IGKV1-39", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06310-1", "protein_name": "Immunoglobulin kappa variable 2-30", "gene_name": "IGKV2-30", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06312-1", "protein_name": "Immunoglobulin kappa variable 4-1", "gene_name": "IGKV4-1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01614-1", "protein_name": "Immunoglobulin kappa variable 2D-40", "gene_name": "IGKV2D-40", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DOY2-1", "protein_name": "Immunoglobulin lambda constant 2", "gene_name": "IGLC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P08603-1", "protein_name": "Complement factor H", "gene_name": "CFH", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05156-1", "protein_name": "Complement factor I", "gene_name": "CFI", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16581-1", "protein_name": "C3a anaphylatoxin chemotactic receptor", "gene_name": "C3AR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P00736-1", "protein_name": "Complement C1r subcomponent", "gene_name": "C1R", "tax_name": "Human" }, { "uniprot_canonical_ac": "P09871-1", "protein_name": "Complement C1s subcomponent", "gene_name": "C1S", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04003-1", "protein_name": "C4b-binding protein alpha chain", "gene_name": "C4BPA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P02747-1", "protein_name": "Complement C1q subcomponent subunit C", "gene_name": "C1QC", "tax_name": "Human" }, { "uniprot_canonical_ac": "P20851-1", "protein_name": "C4b-binding protein beta chain", "gene_name": "C4BPB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96IY4-1", "protein_name": "Carboxypeptidase B2", "gene_name": "CPB2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0C0L5-1", "protein_name": "Complement C4-B", "gene_name": "C4B_2; C4B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0C0L4-1", "protein_name": "Complement C4-A", "gene_name": "C4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P07360-1", "protein_name": "Complement component C8 gamma chain", "gene_name": "C8G", "tax_name": "Human" }, { "uniprot_canonical_ac": "P13671-1", "protein_name": "Complement component C6", "gene_name": "C6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01031-1", "protein_name": "Complement C5", "gene_name": "C5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P02748-1", "protein_name": "Complement component C9", "gene_name": "C9", "tax_name": "Human" }, { "uniprot_canonical_ac": "P07357-1", "protein_name": "Complement component C8 alpha chain", "gene_name": "C8A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P08174-1", "protein_name": "Complement decay-accelerating factor", "gene_name": "CD55", "tax_name": "Human" }, { "uniprot_canonical_ac": "P15529-1", "protein_name": "Membrane cofactor protein", "gene_name": "CD46", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04432-1", "protein_name": "Immunoglobulin kappa variable 1D-39", "gene_name": "IGKV1D-39", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06315-1", "protein_name": "Immunoglobulin kappa variable 5-2", "gene_name": "IGKV5-2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01699-1", "protein_name": "Immunoglobulin lambda variable 1-44", "gene_name": "IGLV1-44", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01701-1", "protein_name": "Immunoglobulin lambda variable 1-51", "gene_name": "IGLV1-51", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01704-1", "protein_name": "Immunoglobulin lambda variable 2-14", "gene_name": "IGLV2-14", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01706-1", "protein_name": "Immunoglobulin lambda variable 2-11", "gene_name": "IGLV2-11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01709-1", "protein_name": "Immunoglobulin lambda variable 2-8", "gene_name": "IGLV2-8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01717-1", "protein_name": "Immunoglobulin lambda variable 3-25", "gene_name": "IGLV3-25", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01721-1", "protein_name": "Immunoglobulin lambda variable 6-57", "gene_name": "IGLV6-57", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01703-1", "protein_name": "Immunoglobulin lambda variable 1-40", "gene_name": "IGLV1-40", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01705-1", "protein_name": "Immunoglobulin lambda variable 2-23", "gene_name": "IGLV2-23", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01715-1", "protein_name": "Immunoglobulin lambda variable 3-1", "gene_name": "IGLV3-1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01718-1", "protein_name": "Immunoglobulin lambda variable 3-27", "gene_name": "IGLV3-27", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04211-1", "protein_name": "Immunoglobulin lambda variable 7-43", "gene_name": "IGLV7-43", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05155-1", "protein_name": "Plasma protease C1 inhibitor", "gene_name": "SERPING1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P22792-1", "protein_name": "Carboxypeptidase N subunit 2", "gene_name": "CPN2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P20023-1", "protein_name": "Complement receptor type 2", "gene_name": "CR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01860-2", "protein_name": "Immunoglobulin heavy constant gamma 3", "gene_name": "IGHG3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01861-2", "protein_name": "Immunoglobulin heavy constant gamma 4", "gene_name": "IGHG4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CF74-1", "protein_name": "Immunoglobulin lambda constant 6", "gene_name": "IGLC6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P17927-1", "protein_name": "Complement receptor type 1", "gene_name": "CR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P10643-1", "protein_name": "Complement component C7", "gene_name": "C7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P07358-1", "protein_name": "Complement component C8 beta chain", "gene_name": "C8B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BXR6-1", "protein_name": "Complement factor H-related protein 5", "gene_name": "CFHR5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P36980-1", "protein_name": "Complement factor H-related protein 2", "gene_name": "CFHR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q02985-1", "protein_name": "Complement factor H-related protein 3", "gene_name": "CFHR3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P02746-1", "protein_name": "Complement C1q subcomponent subunit B", "gene_name": "C1QB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9P296-1", "protein_name": "C5a anaphylatoxin chemotactic receptor 2", "gene_name": "C5AR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P02745-1", "protein_name": "Complement C1q subcomponent subunit A", "gene_name": "C1QA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04004-1", "protein_name": "Vitronectin", "gene_name": "VTN", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01825-1", "protein_name": "Immunoglobulin heavy variable 4-59", "gene_name": "IGHV4-59", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01817-1", "protein_name": "Immunoglobulin heavy variable 2-5", "gene_name": "IGHV2-5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01824-1", "protein_name": "Immunoglobulin heavy variable 4-39", "gene_name": "IGHV4-39", "tax_name": "Human" }, { "uniprot_canonical_ac": "P23083-1", "protein_name": "Immunoglobulin heavy variable 1-2", "gene_name": "IGHV1-2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P07225-1", "protein_name": "Vitamin K-dependent protein S", "gene_name": "PROS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01742-1", "protein_name": "Immunoglobulin heavy variable 1-69", "gene_name": "IGHV1-69", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01768-1", "protein_name": "Immunoglobulin heavy variable 3-30", "gene_name": "IGHV3-30", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01814-1", "protein_name": "Immunoglobulin heavy variable 2-70", "gene_name": "IGHV2-70", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92496-1", "protein_name": "Complement factor H-related protein 4", "gene_name": "CFHR4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01772-1", "protein_name": "Immunoglobulin heavy variable 3-33", "gene_name": "IGHV3-33", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01762-1", "protein_name": "Immunoglobulin heavy variable 3-11", "gene_name": "IGHV3-11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01763-1", "protein_name": "Immunoglobulin heavy variable 3-48", "gene_name": "IGHV3-48", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01764-1", "protein_name": "Immunoglobulin heavy variable 3-23", "gene_name": "IGHV3-23", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01766-1", "protein_name": "Immunoglobulin heavy variable 3-13", "gene_name": "IGHV3-13", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01780-1", "protein_name": "Immunoglobulin heavy variable 3-7", "gene_name": "IGHV3-7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01782-1", "protein_name": "Immunoglobulin heavy variable 3-9", "gene_name": "IGHV3-9", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0M8Q6-1", "protein_name": "Immunoglobulin lambda constant 7", "gene_name": "IGLC7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01834-1", "protein_name": "Immunoglobulin kappa constant", "gene_name": "IGKC", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01859-2", "protein_name": "Immunoglobulin heavy constant gamma 2", "gene_name": "IGHG2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG04-1", "protein_name": "Immunoglobulin lambda constant 1", "gene_name": "IGLC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DOY3-1", "protein_name": "Immunoglobulin lambda constant 3", "gene_name": "IGLC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P13987-1", "protein_name": "CD59 glycoprotein", "gene_name": "CD59", "tax_name": "Human" }, { "uniprot_canonical_ac": "P60033-1", "protein_name": "CD81 antigen", "gene_name": "CD81", "tax_name": "Human" }, { "uniprot_canonical_ac": "P21730-1", "protein_name": "C5a anaphylatoxin chemotactic receptor 1", "gene_name": "C5AR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P15169-1", "protein_name": "Carboxypeptidase N catalytic chain", "gene_name": "CPN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01024-1", "protein_name": "Complement C3", "gene_name": "C3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P00751-1", "protein_name": "Complement factor B", "gene_name": "CFB", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01743-1", "protein_name": "Immunoglobulin heavy variable 1-46", "gene_name": "IGHV1-46", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27918-1", "protein_name": "Properdin", "gene_name": "CFP", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0C4DH73-1", "protein_name": "Immunoglobulin kappa variable 1-12", "gene_name": "IGKV1-12", "tax_name": "Human" }, { "uniprot_canonical_ac": "A2NJV5-1", "protein_name": "Immunoglobulin kappa variable 2-29", "gene_name": "IGKV2-29", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01594-1", "protein_name": "Immunoglobulin kappa variable 1-33", "gene_name": "IGKV1-33", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04430-1", "protein_name": "Immunoglobulin kappa variable 1-16", "gene_name": "IGKV1-16", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01857-2", "protein_name": "Immunoglobulin heavy constant gamma 1", "gene_name": "IGHG1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q03591-1", "protein_name": "Complement factor H-related protein 1", "gene_name": "CFHR1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P01700", "url": "https://www.uniprot.org/uniprotkb/P01700" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.1067618", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 110 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Systematic analysis of the role of CD19 cytoplasmic tyrosines in enhancement of activation in Daudi human B cells: clustering of phospholipase C and Vav and of Grb2 and Sos with different CD19 tyrosines.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "2000", "authors": "Brooks SR, Li X, Volanakis EJ, Carter RH", "reference": { "type": "PubMed", "id": "10706702", "url": "https://pubmed.ncbi.nlm.nih.gov/10706702" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P01700-1", "protein_name": "Immunoglobulin lambda variable 1-47", "gene_name": "IGLV1-47", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01714-1", "protein_name": "Immunoglobulin lambda variable 3-19", "gene_name": "IGLV3-19", "tax_name": "Human" }, { "uniprot_canonical_ac": "P80748-1", "protein_name": "Immunoglobulin lambda variable 3-21", "gene_name": "IGLV3-21", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A075B6P5-1", "protein_name": "Immunoglobulin kappa variable 2-28", "gene_name": "IGKV2-28", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A075B6S6-1", "protein_name": "Immunoglobulin kappa variable 2D-30", "gene_name": "IGKV2D-30", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0C4DH25-1", "protein_name": "Immunoglobulin kappa variable 3D-20", "gene_name": "IGKV3D-20", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01593-1", "protein_name": "Immunoglobulin kappa variable 1D-33", "gene_name": "IGKV1D-33", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01599-1", "protein_name": "Immunoglobulin kappa variable 1-17", "gene_name": "IGKV1-17", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01601-1", "protein_name": "Immunoglobulin kappa variable 1D-16", "gene_name": "IGKV1D-16", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01611-1", "protein_name": "Immunoglobulin kappa variable 1D-12", "gene_name": "IGKV1D-12", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01615-1", "protein_name": "Immunoglobulin kappa variable 2D-28", "gene_name": "IGKV2D-28", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01619-1", "protein_name": "Immunoglobulin kappa variable 3-20", "gene_name": "IGKV3-20", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01624-1", "protein_name": "Immunoglobulin kappa variable 3-15", "gene_name": "IGKV3-15", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04433-1", "protein_name": "Immunoglobulin kappa variable 3-11", "gene_name": "IGKV3-11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01602-1", "protein_name": "Immunoglobulin kappa variable 1-5", "gene_name": "IGKV1-5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8WV28-1", "protein_name": "B-cell linker protein", "gene_name": "BLNK", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14643-1", "protein_name": "Inositol 1,4,5-trisphosphate-gated calcium channel ITPR1", "gene_name": "ITPR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UN19-1", "protein_name": "Dual adapter for phosphotyrosine and 3-phosphotyrosine and 3-phosphoinositide", "gene_name": "DAPP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P43405-1", "protein_name": "Tyrosine-protein kinase SYK", "gene_name": "SYK", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96SN7-1", "protein_name": "Protein orai-2", "gene_name": "ORAI2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P15391-1", "protein_name": "B-lymphocyte antigen CD19", "gene_name": "CD19", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01871-2", "protein_name": "Immunoglobulin heavy constant mu", "gene_name": "IGHM", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13586-1", "protein_name": "Stromal interaction molecule 1", "gene_name": "STIM1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01767-1", "protein_name": "Immunoglobulin heavy variable 3-53", "gene_name": "IGHV3-53", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06331-1", "protein_name": "Immunoglobulin heavy variable 4-34", "gene_name": "IGHV4-34", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14571-1", "protein_name": "Inositol 1,4,5-trisphosphate-gated calcium channel ITPR2", "gene_name": "ITPR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01597-1", "protein_name": "Immunoglobulin kappa variable 1-39", "gene_name": "IGKV1-39", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06310-1", "protein_name": "Immunoglobulin kappa variable 2-30", "gene_name": "IGKV2-30", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06312-1", "protein_name": "Immunoglobulin kappa variable 4-1", "gene_name": "IGKV4-1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01614-1", "protein_name": "Immunoglobulin kappa variable 2D-40", "gene_name": "IGKV2D-40", "tax_name": "Human" }, { "uniprot_canonical_ac": "P48995-1", "protein_name": "Short transient receptor potential channel 1", "gene_name": "TRPC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DOY2-1", "protein_name": "Immunoglobulin lambda constant 2", "gene_name": "IGLC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6ZUJ8-1", "protein_name": "Phosphoinositide 3-kinase adapter protein 1", "gene_name": "PIK3AP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96D31-1", "protein_name": "Calcium release-activated calcium channel protein 1", "gene_name": "ORAI1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DP23-1", "protein_name": "Calmodulin-1", "gene_name": "CALM1; CALM2; CALM3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P29350-1", "protein_name": "Tyrosine-protein phosphatase non-receptor type 6", "gene_name": "PTPN6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P20273-1", "protein_name": "B-cell receptor CD22", "gene_name": "CD22", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04432-1", "protein_name": "Immunoglobulin kappa variable 1D-39", "gene_name": "IGKV1D-39", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06315-1", "protein_name": "Immunoglobulin kappa variable 5-2", "gene_name": "IGKV5-2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01699-1", "protein_name": "Immunoglobulin lambda variable 1-44", "gene_name": "IGLV1-44", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01701-1", "protein_name": "Immunoglobulin lambda variable 1-51", "gene_name": "IGLV1-51", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01704-1", "protein_name": "Immunoglobulin lambda variable 2-14", "gene_name": "IGLV2-14", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01706-1", "protein_name": "Immunoglobulin lambda variable 2-11", "gene_name": "IGLV2-11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01709-1", "protein_name": "Immunoglobulin lambda variable 2-8", "gene_name": "IGLV2-8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01717-1", "protein_name": "Immunoglobulin lambda variable 3-25", "gene_name": "IGLV3-25", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01721-1", "protein_name": "Immunoglobulin lambda variable 6-57", "gene_name": "IGLV6-57", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01703-1", "protein_name": "Immunoglobulin lambda variable 1-40", "gene_name": "IGLV1-40", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01705-1", "protein_name": "Immunoglobulin lambda variable 2-23", "gene_name": "IGLV2-23", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01715-1", "protein_name": "Immunoglobulin lambda variable 3-1", "gene_name": "IGLV3-1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01718-1", "protein_name": "Immunoglobulin lambda variable 3-27", "gene_name": "IGLV3-27", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04211-1", "protein_name": "Immunoglobulin lambda variable 7-43", "gene_name": "IGLV7-43", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q07889-1", "protein_name": "Son of sevenless homolog 1", "gene_name": "SOS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01880-2", "protein_name": "Immunoglobulin heavy constant delta", "gene_name": "IGHD", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CF74-1", "protein_name": "Immunoglobulin lambda constant 6", "gene_name": "IGLC6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q06187-1", "protein_name": "Tyrosine-protein kinase BTK", "gene_name": "BTK", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96B97-1", "protein_name": "SH3 domain-containing kinase-binding protein 1", "gene_name": "SH3KBP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P07948-1", "protein_name": "Tyrosine-protein kinase Lyn", "gene_name": "LYN", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51451-1", "protein_name": "Tyrosine-protein kinase Blk", "gene_name": "BLK", "tax_name": "Human" }, { "uniprot_canonical_ac": "P16885-1", "protein_name": "1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-2", "gene_name": "PLCG2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43865-1", "protein_name": "S-adenosylhomocysteine hydrolase-like protein 1", "gene_name": "AHCYL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01825-1", "protein_name": "Immunoglobulin heavy variable 4-59", "gene_name": "IGHV4-59", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01817-1", "protein_name": "Immunoglobulin heavy variable 2-5", "gene_name": "IGHV2-5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01824-1", "protein_name": "Immunoglobulin heavy variable 4-39", "gene_name": "IGHV4-39", "tax_name": "Human" }, { "uniprot_canonical_ac": "P23083-1", "protein_name": "Immunoglobulin heavy variable 1-2", "gene_name": "IGHV1-2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00329-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit delta isoform", "gene_name": "PIK3CD", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01742-1", "protein_name": "Immunoglobulin heavy variable 1-69", "gene_name": "IGHV1-69", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01768-1", "protein_name": "Immunoglobulin heavy variable 3-30", "gene_name": "IGHV3-30", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01814-1", "protein_name": "Immunoglobulin heavy variable 2-70", "gene_name": "IGHV2-70", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01772-1", "protein_name": "Immunoglobulin heavy variable 3-33", "gene_name": "IGHV3-33", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01762-1", "protein_name": "Immunoglobulin heavy variable 3-11", "gene_name": "IGHV3-11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01763-1", "protein_name": "Immunoglobulin heavy variable 3-48", "gene_name": "IGHV3-48", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01764-1", "protein_name": "Immunoglobulin heavy variable 3-23", "gene_name": "IGHV3-23", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01766-1", "protein_name": "Immunoglobulin heavy variable 3-13", "gene_name": "IGHV3-13", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01780-1", "protein_name": "Immunoglobulin heavy variable 3-7", "gene_name": "IGHV3-7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01782-1", "protein_name": "Immunoglobulin heavy variable 3-9", "gene_name": "IGHV3-9", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0M8Q6-1", "protein_name": "Immunoglobulin lambda constant 7", "gene_name": "IGLC7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01834-1", "protein_name": "Immunoglobulin kappa constant", "gene_name": "IGKC", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG04-1", "protein_name": "Immunoglobulin lambda constant 1", "gene_name": "IGLC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DOY3-1", "protein_name": "Immunoglobulin lambda constant 3", "gene_name": "IGLC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P11912-1", "protein_name": "B-cell antigen receptor complex-associated protein alpha chain", "gene_name": "CD79A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P40259-1", "protein_name": "B-cell antigen receptor complex-associated protein beta chain", "gene_name": "CD79B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01743-1", "protein_name": "Immunoglobulin heavy variable 1-46", "gene_name": "IGHV1-46", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14573-1", "protein_name": "Inositol 1,4,5-trisphosphate-gated calcium channel ITPR3", "gene_name": "ITPR3", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0C4DH73-1", "protein_name": "Immunoglobulin kappa variable 1-12", "gene_name": "IGKV1-12", "tax_name": "Human" }, { "uniprot_canonical_ac": "A2NJV5-1", "protein_name": "Immunoglobulin kappa variable 2-29", "gene_name": "IGKV2-29", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01594-1", "protein_name": "Immunoglobulin kappa variable 1-33", "gene_name": "IGKV1-33", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04430-1", "protein_name": "Immunoglobulin kappa variable 1-16", "gene_name": "IGKV1-16", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27986-1", "protein_name": "Phosphatidylinositol 3-kinase regulatory subunit alpha", "gene_name": "PIK3R1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06241-1", "protein_name": "Tyrosine-protein kinase Fyn", "gene_name": "FYN", "tax_name": "Human" }, { "uniprot_canonical_ac": "P16333-1", "protein_name": "SH2/SH3 adapter protein NCK1", "gene_name": "NCK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P15498-1", "protein_name": "Proto-oncogene vav", "gene_name": "VAV1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P01700", "url": "https://www.uniprot.org/uniprotkb/P01700" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 348, "end_pos": 348, "kinase_uniprot_canonical_ac": "P28482-1", "kinase_gene_name": "MAPK1", "residue": "Tyr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P15391", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P15391" }, { "database": "PubMed", "id": "10706702", "url": "https://pubmed.ncbi.nlm.nih.gov/10706702" }, { "database": "PubMed", "id": "16497976", "url": "https://pubmed.ncbi.nlm.nih.gov/16497976" } ], "site_lbl": "Tyr348", "uniprot_canonical_ac": "P15391-1" }, { "start_pos": 348, "end_pos": 348, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "Phosphotyrosine", "evidence": [ { "database": "UniProtKB", "id": "P15391", "url": "https://www.uniprot.org/uniprotkb/P15391" }, { "database": "PubMed", "id": "10706702", "url": "https://pubmed.ncbi.nlm.nih.gov/10706702" }, { "database": "PRO", "id": "P15391", "url": "https://proconsortium.org/cgi-bin/entry_pro?id=P15391" }, { "database": "iPTMnet", "id": "P15391", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P15391" } ], "site_lbl": "Tyr348", "uniprot_canonical_ac": "P15391-1" }, { "start_pos": 378, "end_pos": 378, "kinase_uniprot_canonical_ac": "P28482-1", "kinase_gene_name": "MAPK1", "residue": "Tyr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P15391", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P15391" }, { "database": "PubMed", "id": "10706702", "url": "https://pubmed.ncbi.nlm.nih.gov/10706702" } ], "site_lbl": "Tyr378", "uniprot_canonical_ac": "P15391-1" }, { "start_pos": 378, "end_pos": 378, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "Phosphotyrosine", "evidence": [ { "database": "UniProtKB", "id": "P15391", "url": "https://www.uniprot.org/uniprotkb/P15391" }, { "database": "PubMed", "id": "10706702", "url": "https://pubmed.ncbi.nlm.nih.gov/10706702" }, { "database": "PRO", "id": "P15391", "url": "https://proconsortium.org/cgi-bin/entry_pro?id=P15391" }, { "database": "iPTMnet", "id": "P15391", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P15391" } ], "site_lbl": "Tyr378", "uniprot_canonical_ac": "P15391-1" }, { "start_pos": 409, "end_pos": 409, "kinase_uniprot_canonical_ac": "P28482-1", "kinase_gene_name": "MAPK1", "residue": "Tyr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P15391", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P15391" }, { "database": "PubMed", "id": "10706702", "url": "https://pubmed.ncbi.nlm.nih.gov/10706702" } ], "site_lbl": "Tyr409", "uniprot_canonical_ac": "P15391-1" }, { "start_pos": 409, "end_pos": 409, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "Phosphotyrosine", "evidence": [ { "database": "UniProtKB", "id": "P15391", "url": "https://www.uniprot.org/uniprotkb/P15391" }, { "database": "PubMed", "id": "10706702", "url": "https://pubmed.ncbi.nlm.nih.gov/10706702" }, { "database": "PRO", "id": "P15391", "url": "https://proconsortium.org/cgi-bin/entry_pro?id=P15391" }, { "database": "iPTMnet", "id": "P15391", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P15391" } ], "site_lbl": "Tyr409", "uniprot_canonical_ac": "P15391-1" }, { "start_pos": 439, "end_pos": 439, "kinase_uniprot_canonical_ac": "P28482-1", "kinase_gene_name": "MAPK1", "residue": "Tyr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P15391", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P15391" }, { "database": "PubMed", "id": "10706702", "url": "https://pubmed.ncbi.nlm.nih.gov/10706702" } ], "site_lbl": "Tyr439", "uniprot_canonical_ac": "P15391-1" }, { "start_pos": 439, "end_pos": 439, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "Phosphotyrosine", "evidence": [ { "database": "UniProtKB", "id": "P15391", "url": "https://www.uniprot.org/uniprotkb/P15391" }, { "database": "PubMed", "id": "10706702", "url": "https://pubmed.ncbi.nlm.nih.gov/10706702" }, { "database": "PRO", "id": "P15391", "url": "https://proconsortium.org/cgi-bin/entry_pro?id=P15391" }, { "database": "iPTMnet", "id": "P15391", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P15391" } ], "site_lbl": "Tyr439", "uniprot_canonical_ac": "P15391-1" } ], "record_id": "pubmed.10706702", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 91 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 8 }, { "field": "total_sites", "count": 4 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The CD2-subset of the Ig superfamily of cell surface molecules: receptor-ligand pairs expressed by NK cells and other immune cells.", "journal": "Seminars in immunology", "date": "2000", "authors": "Tangye SG, Phillips JH, Lanier LL", "reference": { "type": "PubMed", "id": "10764623", "url": "https://pubmed.ncbi.nlm.nih.gov/10764623" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P01700-1", "protein_name": "Immunoglobulin lambda variable 1-47", "gene_name": "IGLV1-47", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01714-1", "protein_name": "Immunoglobulin lambda variable 3-19", "gene_name": "IGLV3-19", "tax_name": "Human" }, { "uniprot_canonical_ac": "P80748-1", "protein_name": "Immunoglobulin lambda variable 3-21", "gene_name": "IGLV3-21", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A075B6P5-1", "protein_name": "Immunoglobulin kappa variable 2-28", "gene_name": "IGKV2-28", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A075B6S6-1", "protein_name": "Immunoglobulin kappa variable 2D-30", "gene_name": "IGKV2D-30", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0C4DH25-1", "protein_name": "Immunoglobulin kappa variable 3D-20", "gene_name": "IGKV3D-20", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01593-1", "protein_name": "Immunoglobulin kappa variable 1D-33", "gene_name": "IGKV1D-33", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01599-1", "protein_name": "Immunoglobulin kappa variable 1-17", "gene_name": "IGKV1-17", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01601-1", "protein_name": "Immunoglobulin kappa variable 1D-16", "gene_name": "IGKV1D-16", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01611-1", "protein_name": "Immunoglobulin kappa variable 1D-12", "gene_name": "IGKV1D-12", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01615-1", "protein_name": "Immunoglobulin kappa variable 2D-28", "gene_name": "IGKV2D-28", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01619-1", "protein_name": "Immunoglobulin kappa variable 3-20", "gene_name": "IGKV3-20", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01624-1", "protein_name": "Immunoglobulin kappa variable 3-15", "gene_name": "IGKV3-15", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04433-1", "protein_name": "Immunoglobulin kappa variable 3-11", "gene_name": "IGKV3-11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01602-1", "protein_name": "Immunoglobulin kappa variable 1-5", "gene_name": "IGKV1-5", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75056-1", "protein_name": "Syndecan-3", "gene_name": "SDC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P07204-1", "protein_name": "Thrombomodulin", "gene_name": "THBD", "tax_name": "Human" }, { "uniprot_canonical_ac": "P00734-1", "protein_name": "Prothrombin", "gene_name": "F2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P02452-1", "protein_name": "Collagen alpha-1(I) chain", "gene_name": "COL1A1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04114-1", "protein_name": "Apolipoprotein B-100", "gene_name": "APOB", "tax_name": "Human" }, { "uniprot_canonical_ac": "P02751-15", "protein_name": "Fibronectin", "gene_name": "FN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00220-1", "protein_name": "Tumor necrosis factor receptor superfamily member 10A", "gene_name": "TNFRSF10A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P14209-1", "protein_name": "CD99 antigen", "gene_name": "CD99", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9P1W8-1", "protein_name": "Signal-regulatory protein gamma", "gene_name": "SIRPG", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q08722-1", "protein_name": "Leukocyte surface antigen CD47", "gene_name": "CD47", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01871-2", "protein_name": "Immunoglobulin heavy constant mu", "gene_name": "IGHM", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UNN8-1", "protein_name": "Endothelial protein C receptor", "gene_name": "PROCR", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8WWV6-1", "protein_name": "High affinity immunoglobulin alpha and immunoglobulin mu Fc receptor", "gene_name": "FCAMR", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96AP7-1", "protein_name": "Endothelial cell-selective adhesion molecule", "gene_name": "ESAM", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14393-2", "protein_name": "Growth arrest-specific protein 6", "gene_name": "GAS6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P30273-1", "protein_name": "High affinity immunoglobulin epsilon receptor subunit gamma", "gene_name": "FCER1G", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92896-1", "protein_name": "Golgi apparatus protein 1", "gene_name": "GLG1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P20701-1", "protein_name": "Integrin alpha-L", "gene_name": "ITGAL", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01767-1", "protein_name": "Immunoglobulin heavy variable 3-53", "gene_name": "IGHV3-53", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06331-1", "protein_name": "Immunoglobulin heavy variable 4-34", "gene_name": "IGHV4-34", "tax_name": "Human" }, { "uniprot_canonical_ac": "P19256-1", "protein_name": "Lymphocyte function-associated antigen 3", "gene_name": "CD58", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y624-1", "protein_name": "Junctional adhesion molecule A", "gene_name": "F11R", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01597-1", "protein_name": "Immunoglobulin kappa variable 1-39", "gene_name": "IGKV1-39", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06310-1", "protein_name": "Immunoglobulin kappa variable 2-30", "gene_name": "IGKV2-30", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06312-1", "protein_name": "Immunoglobulin kappa variable 4-1", "gene_name": "IGKV4-1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01614-1", "protein_name": "Immunoglobulin kappa variable 2D-40", "gene_name": "IGKV2D-40", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DOY2-1", "protein_name": "Immunoglobulin lambda constant 2", "gene_name": "IGLC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P78380-1", "protein_name": "Oxidized low-density lipoprotein receptor 1", "gene_name": "OLR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P11464-1", "protein_name": "Pregnancy-specific beta-1-glycoprotein 1", "gene_name": "PSG1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q00887-1", "protein_name": "Pregnancy-specific beta-1-glycoprotein 9", "gene_name": "PSG9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UQ72-1", "protein_name": "Pregnancy-specific beta-1-glycoprotein 11", "gene_name": "PSG11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06731-1", "protein_name": "Cell adhesion molecule CEACAM5", "gene_name": "CEACAM5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P18827-1", "protein_name": "Syndecan-1", "gene_name": "SDC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UIB8-1", "protein_name": "SLAM family member 5", "gene_name": "CD84", "tax_name": "Human" }, { "uniprot_canonical_ac": "P09326-1", "protein_name": "CD48 antigen", "gene_name": "CD48", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TCZ2-1", "protein_name": "CD99 antigen-like protein 2", "gene_name": "CD99L2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P02724-1", "protein_name": "Glycophorin-A", "gene_name": "GYPA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P14174-1", "protein_name": "Macrophage migration inhibitory factor", "gene_name": "MIF", "tax_name": "Human" }, { "uniprot_canonical_ac": "P13688-1", "protein_name": "Cell adhesion molecule CEACAM1", "gene_name": "CEACAM1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06729-1", "protein_name": "T-cell surface antigen CD2", "gene_name": "CD2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P40199-1", "protein_name": "Cell adhesion molecule CEACAM6", "gene_name": "CEACAM6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BZW8-1", "protein_name": "Natural killer cell receptor 2B4", "gene_name": "CD244", "tax_name": "Human" }, { "uniprot_canonical_ac": "P16070-1", "protein_name": "CD44 antigen", "gene_name": "CD44", "tax_name": "Human" }, { "uniprot_canonical_ac": "P31997-1", "protein_name": "Cell adhesion molecule CEACAM8", "gene_name": "CEACAM8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P40198-1", "protein_name": "Cell adhesion molecule CEACAM3", "gene_name": "CEACAM3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N6Q3-1", "protein_name": "CD177 antigen", "gene_name": "CD177", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04233-1", "protein_name": "HLA class II histocompatibility antigen gamma chain", "gene_name": "CD74", "tax_name": "Human" }, { "uniprot_canonical_ac": "P16284-1", "protein_name": "Platelet endothelial cell adhesion molecule", "gene_name": "PECAM1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P31431-1", "protein_name": "Syndecan-4", "gene_name": "SDC4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04432-1", "protein_name": "Immunoglobulin kappa variable 1D-39", "gene_name": "IGKV1D-39", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06315-1", "protein_name": "Immunoglobulin kappa variable 5-2", "gene_name": "IGKV5-2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01699-1", "protein_name": "Immunoglobulin lambda variable 1-44", "gene_name": "IGLV1-44", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01701-1", "protein_name": "Immunoglobulin lambda variable 1-51", "gene_name": "IGLV1-51", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01704-1", "protein_name": "Immunoglobulin lambda variable 2-14", "gene_name": "IGLV2-14", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01706-1", "protein_name": "Immunoglobulin lambda variable 2-11", "gene_name": "IGLV2-11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01709-1", "protein_name": "Immunoglobulin lambda variable 2-8", "gene_name": "IGLV2-8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01717-1", "protein_name": "Immunoglobulin lambda variable 3-25", "gene_name": "IGLV3-25", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01721-1", "protein_name": "Immunoglobulin lambda variable 6-57", "gene_name": "IGLV6-57", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01703-1", "protein_name": "Immunoglobulin lambda variable 1-40", "gene_name": "IGLV1-40", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01705-1", "protein_name": "Immunoglobulin lambda variable 2-23", "gene_name": "IGLV2-23", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01715-1", "protein_name": "Immunoglobulin lambda variable 3-1", "gene_name": "IGLV3-1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01718-1", "protein_name": "Immunoglobulin lambda variable 3-27", "gene_name": "IGLV3-27", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04211-1", "protein_name": "Immunoglobulin lambda variable 7-43", "gene_name": "IGLV7-43", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06028-1", "protein_name": "Glycophorin-B", "gene_name": "GYPB", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04921-1", "protein_name": "Glycophorin-C", "gene_name": "GYPC", "tax_name": "Human" }, { "uniprot_canonical_ac": "P15814-1", "protein_name": "Immunoglobulin lambda-like polypeptide 1", "gene_name": "IGLL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P11215-1", "protein_name": "Integrin alpha-M", "gene_name": "ITGAM", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01876-2", "protein_name": "Immunoglobulin heavy constant alpha 1", "gene_name": "IGHA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CF74-1", "protein_name": "Immunoglobulin lambda constant 6", "gene_name": "IGLC6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P08648-1", "protein_name": "Integrin alpha-5", "gene_name": "ITGA5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P13612-1", "protein_name": "Integrin alpha-4", "gene_name": "ITGA4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P02776-1", "protein_name": "Platelet factor 4", "gene_name": "PF4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P07948-1", "protein_name": "Tyrosine-protein kinase Lyn", "gene_name": "LYN", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05556-1", "protein_name": "Integrin beta-1", "gene_name": "ITGB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NRD5-1", "protein_name": "PRKCA-binding protein", "gene_name": "PICK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P08123-1", "protein_name": "Collagen alpha-2(I) chain", "gene_name": "COL1A2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04070-1", "protein_name": "Vitamin K-dependent protein C", "gene_name": "PROC", "tax_name": "Human" }, { "uniprot_canonical_ac": "P34741-1", "protein_name": "Syndecan-2", "gene_name": "SDC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P78310-1", "protein_name": "Coxsackievirus and adenovirus receptor", "gene_name": "CXADR", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HCN6-1", "protein_name": "Platelet glycoprotein VI", "gene_name": "GP6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35052-1", "protein_name": "Glypican-1", "gene_name": "GPC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NP99-1", "protein_name": "Triggering receptor expressed on myeloid cells 1", "gene_name": "TREM1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01825-1", "protein_name": "Immunoglobulin heavy variable 4-59", "gene_name": "IGHV4-59", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01817-1", "protein_name": "Immunoglobulin heavy variable 2-5", "gene_name": "IGHV2-5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01824-1", "protein_name": "Immunoglobulin heavy variable 4-39", "gene_name": "IGHV4-39", "tax_name": "Human" }, { "uniprot_canonical_ac": "P23083-1", "protein_name": "Immunoglobulin heavy variable 1-2", "gene_name": "IGHV1-2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P10720-1", "protein_name": "Platelet factor 4 variant", "gene_name": "PF4V1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q00888-1", "protein_name": "Pregnancy-specific beta-1-glycoprotein 4", "gene_name": "PSG4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13046-1", "protein_name": "Pregnancy-specific beta-1-glycoprotein 7", "gene_name": "PSG7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q00889-1", "protein_name": "Pregnancy-specific beta-1-glycoprotein 6", "gene_name": "PSG6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P07225-1", "protein_name": "Vitamin K-dependent protein S", "gene_name": "PROS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P11465-1", "protein_name": "Pregnancy-specific beta-1-glycoprotein 2", "gene_name": "PSG2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01742-1", "protein_name": "Immunoglobulin heavy variable 1-69", "gene_name": "IGHV1-69", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01768-1", "protein_name": "Immunoglobulin heavy variable 3-30", "gene_name": "IGHV3-30", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01814-1", "protein_name": "Immunoglobulin heavy variable 2-70", "gene_name": "IGHV2-70", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01772-1", "protein_name": "Immunoglobulin heavy variable 3-33", "gene_name": "IGHV3-33", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01762-1", "protein_name": "Immunoglobulin heavy variable 3-11", "gene_name": "IGHV3-11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01763-1", "protein_name": "Immunoglobulin heavy variable 3-48", "gene_name": "IGHV3-48", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01764-1", "protein_name": "Immunoglobulin heavy variable 3-23", "gene_name": "IGHV3-23", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01766-1", "protein_name": "Immunoglobulin heavy variable 3-13", "gene_name": "IGHV3-13", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01780-1", "protein_name": "Immunoglobulin heavy variable 3-7", "gene_name": "IGHV3-7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01782-1", "protein_name": "Immunoglobulin heavy variable 3-9", "gene_name": "IGHV3-9", "tax_name": "Human" }, { "uniprot_canonical_ac": "P20702-1", "protein_name": "Integrin alpha-X", "gene_name": "ITGAX", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86YT9-1", "protein_name": "Junctional adhesion molecule-like", "gene_name": "JAML", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01877-2", "protein_name": "Immunoglobulin heavy constant alpha 2", "gene_name": "IGHA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BX67-1", "protein_name": "Junctional adhesion molecule C", "gene_name": "JAM3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01591-1", "protein_name": "Immunoglobulin J chain", "gene_name": "JCHAIN", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UQ74-1", "protein_name": "Pregnancy-specific beta-1-glycoprotein 8", "gene_name": "PSG8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16557-1", "protein_name": "Pregnancy-specific beta-1-glycoprotein 3", "gene_name": "PSG3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15238-1", "protein_name": "Pregnancy-specific beta-1-glycoprotein 5", "gene_name": "PSG5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P57087-1", "protein_name": "Junctional adhesion molecule B", "gene_name": "JAM2", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0M8Q6-1", "protein_name": "Immunoglobulin lambda constant 7", "gene_name": "IGLC7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01834-1", "protein_name": "Immunoglobulin kappa constant", "gene_name": "IGKC", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG04-1", "protein_name": "Immunoglobulin lambda constant 1", "gene_name": "IGLC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DOY3-1", "protein_name": "Immunoglobulin lambda constant 3", "gene_name": "IGLC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P78324-1", "protein_name": "Tyrosine-protein phosphatase non-receptor type substrate 1", "gene_name": "SIRPA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UKI3-1", "protein_name": "Pre-B lymphocyte protein 3", "gene_name": "VPREB3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P12018-1", "protein_name": "Immunoglobulin iota chain", "gene_name": "VPREB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01743-1", "protein_name": "Immunoglobulin heavy variable 1-46", "gene_name": "IGHV1-46", "tax_name": "Human" }, { "uniprot_canonical_ac": "P16109-1", "protein_name": "P-selectin", "gene_name": "SELP", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14242-1", "protein_name": "P-selectin glycoprotein ligand 1", "gene_name": "SELPLG", "tax_name": "Human" }, { "uniprot_canonical_ac": "P16581-1", "protein_name": "E-selectin", "gene_name": "SELE", "tax_name": "Human" }, { "uniprot_canonical_ac": "P16150-1", "protein_name": "Leukosialin", "gene_name": "SPN", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0C4DH73-1", "protein_name": "Immunoglobulin kappa variable 1-12", "gene_name": "IGKV1-12", "tax_name": "Human" }, { "uniprot_canonical_ac": "A2NJV5-1", "protein_name": "Immunoglobulin kappa variable 2-29", "gene_name": "IGKV2-29", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01594-1", "protein_name": "Immunoglobulin kappa variable 1-33", "gene_name": "IGKV1-33", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04430-1", "protein_name": "Immunoglobulin kappa variable 1-16", "gene_name": "IGKV1-16", "tax_name": "Human" }, { "uniprot_canonical_ac": "P14151-1", "protein_name": "L-selectin", "gene_name": "SELL", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12866-1", "protein_name": "Tyrosine-protein kinase Mer", "gene_name": "MERTK", "tax_name": "Human" }, { "uniprot_canonical_ac": "P16422-1", "protein_name": "Epithelial cell adhesion molecule", "gene_name": "EPCAM", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UBN6-1", "protein_name": "Tumor necrosis factor receptor superfamily member 10D", "gene_name": "TNFRSF10D", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14763-1", "protein_name": "Tumor necrosis factor receptor superfamily member 10B", "gene_name": "TNFRSF10B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P41732-1", "protein_name": "Tetraspanin-7", "gene_name": "TSPAN7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01137-1", "protein_name": "Transforming growth factor beta-1 proprotein", "gene_name": "TGFB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06241-1", "protein_name": "Tyrosine-protein kinase Fyn", "gene_name": "FYN", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05107-1", "protein_name": "Integrin beta-2", "gene_name": "ITGB2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P01700", "url": "https://www.uniprot.org/uniprotkb/P01700" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.10764623", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 151 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "A novel B lymphocyte-associated adaptor protein, Bam32, regulates antigen receptor signaling downstream of phosphatidylinositol 3-kinase.", "journal": "The Journal of experimental medicine", "date": "2000", "authors": "Marshall AJ, Niiro H, Lerner CG, Yun TJ, Thomas S, Disteche CM, Clark EA", "reference": { "type": "PubMed", "id": "10770799", "url": "https://pubmed.ncbi.nlm.nih.gov/10770799" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P01700-1", "protein_name": "Immunoglobulin lambda variable 1-47", "gene_name": "IGLV1-47", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01714-1", "protein_name": "Immunoglobulin lambda variable 3-19", "gene_name": "IGLV3-19", "tax_name": "Human" }, { "uniprot_canonical_ac": "P80748-1", "protein_name": "Immunoglobulin lambda variable 3-21", "gene_name": "IGLV3-21", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A075B6P5-1", "protein_name": "Immunoglobulin kappa variable 2-28", "gene_name": "IGKV2-28", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A075B6S6-1", "protein_name": "Immunoglobulin kappa variable 2D-30", "gene_name": "IGKV2D-30", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0C4DH25-1", "protein_name": "Immunoglobulin kappa variable 3D-20", "gene_name": "IGKV3D-20", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01593-1", "protein_name": "Immunoglobulin kappa variable 1D-33", "gene_name": "IGKV1D-33", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01599-1", "protein_name": "Immunoglobulin kappa variable 1-17", "gene_name": "IGKV1-17", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01601-1", "protein_name": "Immunoglobulin kappa variable 1D-16", "gene_name": "IGKV1D-16", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01611-1", "protein_name": "Immunoglobulin kappa variable 1D-12", "gene_name": "IGKV1D-12", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01615-1", "protein_name": "Immunoglobulin kappa variable 2D-28", "gene_name": "IGKV2D-28", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01619-1", "protein_name": "Immunoglobulin kappa variable 3-20", "gene_name": "IGKV3-20", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01624-1", "protein_name": "Immunoglobulin kappa variable 3-15", "gene_name": "IGKV3-15", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04433-1", "protein_name": "Immunoglobulin kappa variable 3-11", "gene_name": "IGKV3-11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01602-1", "protein_name": "Immunoglobulin kappa variable 1-5", "gene_name": "IGKV1-5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8WV28-1", "protein_name": "B-cell linker protein", "gene_name": "BLNK", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14643-1", "protein_name": "Inositol 1,4,5-trisphosphate-gated calcium channel ITPR1", "gene_name": "ITPR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UN19-1", "protein_name": "Dual adapter for phosphotyrosine and 3-phosphotyrosine and 3-phosphoinositide", "gene_name": "DAPP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P43405-1", "protein_name": "Tyrosine-protein kinase SYK", "gene_name": "SYK", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96SN7-1", "protein_name": "Protein orai-2", "gene_name": "ORAI2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P15391-1", "protein_name": "B-lymphocyte antigen CD19", "gene_name": "CD19", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01871-2", "protein_name": "Immunoglobulin heavy constant mu", "gene_name": "IGHM", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13586-1", "protein_name": "Stromal interaction molecule 1", "gene_name": "STIM1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01767-1", "protein_name": "Immunoglobulin heavy variable 3-53", "gene_name": "IGHV3-53", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06331-1", "protein_name": "Immunoglobulin heavy variable 4-34", "gene_name": "IGHV4-34", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14571-1", "protein_name": "Inositol 1,4,5-trisphosphate-gated calcium channel ITPR2", "gene_name": "ITPR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01597-1", "protein_name": "Immunoglobulin kappa variable 1-39", "gene_name": "IGKV1-39", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06310-1", "protein_name": "Immunoglobulin kappa variable 2-30", "gene_name": "IGKV2-30", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06312-1", "protein_name": "Immunoglobulin kappa variable 4-1", "gene_name": "IGKV4-1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01614-1", "protein_name": "Immunoglobulin kappa variable 2D-40", "gene_name": "IGKV2D-40", "tax_name": "Human" }, { "uniprot_canonical_ac": "P48995-1", "protein_name": "Short transient receptor potential channel 1", "gene_name": "TRPC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DOY2-1", "protein_name": "Immunoglobulin lambda constant 2", "gene_name": "IGLC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6ZUJ8-1", "protein_name": "Phosphoinositide 3-kinase adapter protein 1", "gene_name": "PIK3AP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96D31-1", "protein_name": "Calcium release-activated calcium channel protein 1", "gene_name": "ORAI1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DP23-1", "protein_name": "Calmodulin-1", "gene_name": "CALM1; CALM2; CALM3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P29350-1", "protein_name": "Tyrosine-protein phosphatase non-receptor type 6", "gene_name": "PTPN6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P20273-1", "protein_name": "B-cell receptor CD22", "gene_name": "CD22", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04432-1", "protein_name": "Immunoglobulin kappa variable 1D-39", "gene_name": "IGKV1D-39", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06315-1", "protein_name": "Immunoglobulin kappa variable 5-2", "gene_name": "IGKV5-2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01699-1", "protein_name": "Immunoglobulin lambda variable 1-44", "gene_name": "IGLV1-44", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01701-1", "protein_name": "Immunoglobulin lambda variable 1-51", "gene_name": "IGLV1-51", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01704-1", "protein_name": "Immunoglobulin lambda variable 2-14", "gene_name": "IGLV2-14", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01706-1", "protein_name": "Immunoglobulin lambda variable 2-11", "gene_name": "IGLV2-11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01709-1", "protein_name": "Immunoglobulin lambda variable 2-8", "gene_name": "IGLV2-8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01717-1", "protein_name": "Immunoglobulin lambda variable 3-25", "gene_name": "IGLV3-25", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01721-1", "protein_name": "Immunoglobulin lambda variable 6-57", "gene_name": "IGLV6-57", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01703-1", "protein_name": "Immunoglobulin lambda variable 1-40", "gene_name": "IGLV1-40", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01705-1", "protein_name": "Immunoglobulin lambda variable 2-23", "gene_name": "IGLV2-23", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01715-1", "protein_name": "Immunoglobulin lambda variable 3-1", "gene_name": "IGLV3-1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01718-1", "protein_name": "Immunoglobulin lambda variable 3-27", "gene_name": "IGLV3-27", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04211-1", "protein_name": "Immunoglobulin lambda variable 7-43", "gene_name": "IGLV7-43", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q07889-1", "protein_name": "Son of sevenless homolog 1", "gene_name": "SOS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9QXT1-1", "protein_name": "Dual adapter for phosphotyrosine and 3-phosphotyrosine and 3-phosphoinositide", "gene_name": "Dapp1", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "P01880-2", "protein_name": "Immunoglobulin heavy constant delta", "gene_name": "IGHD", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CF74-1", "protein_name": "Immunoglobulin lambda constant 6", "gene_name": "IGLC6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q06187-1", "protein_name": "Tyrosine-protein kinase BTK", "gene_name": "BTK", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96B97-1", "protein_name": "SH3 domain-containing kinase-binding protein 1", "gene_name": "SH3KBP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P07948-1", "protein_name": "Tyrosine-protein kinase Lyn", "gene_name": "LYN", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51451-1", "protein_name": "Tyrosine-protein kinase Blk", "gene_name": "BLK", "tax_name": "Human" }, { "uniprot_canonical_ac": "P16885-1", "protein_name": "1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-2", "gene_name": "PLCG2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43865-1", "protein_name": "S-adenosylhomocysteine hydrolase-like protein 1", "gene_name": "AHCYL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01825-1", "protein_name": "Immunoglobulin heavy variable 4-59", "gene_name": "IGHV4-59", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01817-1", "protein_name": "Immunoglobulin heavy variable 2-5", "gene_name": "IGHV2-5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01824-1", "protein_name": "Immunoglobulin heavy variable 4-39", "gene_name": "IGHV4-39", "tax_name": "Human" }, { "uniprot_canonical_ac": "P23083-1", "protein_name": "Immunoglobulin heavy variable 1-2", "gene_name": "IGHV1-2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00329-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit delta isoform", "gene_name": "PIK3CD", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01742-1", "protein_name": "Immunoglobulin heavy variable 1-69", "gene_name": "IGHV1-69", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01768-1", "protein_name": "Immunoglobulin heavy variable 3-30", "gene_name": "IGHV3-30", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01814-1", "protein_name": "Immunoglobulin heavy variable 2-70", "gene_name": "IGHV2-70", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01772-1", "protein_name": "Immunoglobulin heavy variable 3-33", "gene_name": "IGHV3-33", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01762-1", "protein_name": "Immunoglobulin heavy variable 3-11", "gene_name": "IGHV3-11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01763-1", "protein_name": "Immunoglobulin heavy variable 3-48", "gene_name": "IGHV3-48", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01764-1", "protein_name": "Immunoglobulin heavy variable 3-23", "gene_name": "IGHV3-23", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01766-1", "protein_name": "Immunoglobulin heavy variable 3-13", "gene_name": "IGHV3-13", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01780-1", "protein_name": "Immunoglobulin heavy variable 3-7", "gene_name": "IGHV3-7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01782-1", "protein_name": "Immunoglobulin heavy variable 3-9", "gene_name": "IGHV3-9", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0M8Q6-1", "protein_name": "Immunoglobulin lambda constant 7", "gene_name": "IGLC7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01834-1", "protein_name": "Immunoglobulin kappa constant", "gene_name": "IGKC", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG04-1", "protein_name": "Immunoglobulin lambda constant 1", "gene_name": "IGLC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DOY3-1", "protein_name": "Immunoglobulin lambda constant 3", "gene_name": "IGLC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P11912-1", "protein_name": "B-cell antigen receptor complex-associated protein alpha chain", "gene_name": "CD79A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P40259-1", "protein_name": "B-cell antigen receptor complex-associated protein beta chain", "gene_name": "CD79B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01743-1", "protein_name": "Immunoglobulin heavy variable 1-46", "gene_name": "IGHV1-46", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14573-1", "protein_name": "Inositol 1,4,5-trisphosphate-gated calcium channel ITPR3", "gene_name": "ITPR3", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0C4DH73-1", "protein_name": "Immunoglobulin kappa variable 1-12", "gene_name": "IGKV1-12", "tax_name": "Human" }, { "uniprot_canonical_ac": "A2NJV5-1", "protein_name": "Immunoglobulin kappa variable 2-29", "gene_name": "IGKV2-29", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01594-1", "protein_name": "Immunoglobulin kappa variable 1-33", "gene_name": "IGKV1-33", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04430-1", "protein_name": "Immunoglobulin kappa variable 1-16", "gene_name": "IGKV1-16", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27986-1", "protein_name": "Phosphatidylinositol 3-kinase regulatory subunit alpha", "gene_name": "PIK3R1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06241-1", "protein_name": "Tyrosine-protein kinase Fyn", "gene_name": "FYN", "tax_name": "Human" }, { "uniprot_canonical_ac": "P16333-1", "protein_name": "SH2/SH3 adapter protein NCK1", "gene_name": "NCK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P15498-1", "protein_name": "Proto-oncogene vav", "gene_name": "VAV1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P01700", "url": "https://www.uniprot.org/uniprotkb/P01700" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 184, "end_pos": 184, "sequence_org": "R", "sequence_mut": "C", "comment": "No membrane association.", "evidence": [ { "database": "UniProtKB", "id": "Q9UN19", "url": "https://www.uniprot.org/uniprotkb/Q9UN19" }, { "database": "PubMed", "id": "10770799", "url": "https://pubmed.ncbi.nlm.nih.gov/10770799" } ], "uniprot_canonical_ac": "Q9UN19-1" }, { "start_pos": 197, "end_pos": 197, "sequence_org": "K", "sequence_mut": "E", "comment": "No membrane association.", "evidence": [ { "database": "UniProtKB", "id": "Q9UN19", "url": "https://www.uniprot.org/uniprotkb/Q9UN19" }, { "database": "PubMed", "id": "10770799", "url": "https://pubmed.ncbi.nlm.nih.gov/10770799" } ], "uniprot_canonical_ac": "Q9UN19-1" }, { "start_pos": 61, "end_pos": 61, "sequence_org": "R", "sequence_mut": "K", "comment": "No change in BCR-induced NFAT activation.", "evidence": [ { "database": "UniProtKB", "id": "Q9UN19", "url": "https://www.uniprot.org/uniprotkb/Q9UN19" }, { "database": "PubMed", "id": "10770799", "url": "https://pubmed.ncbi.nlm.nih.gov/10770799" } ], "uniprot_canonical_ac": "Q9UN19-1" } ], "record_id": "pubmed.10770799", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 92 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Surface markers of human lymphocytes.", "journal": "The Johns Hopkins medical journal", "date": "1975", "authors": "Kunkel HG", "reference": { "type": "PubMed", "id": "1081164", "url": "https://pubmed.ncbi.nlm.nih.gov/1081164" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P01700-1", "protein_name": "Immunoglobulin lambda variable 1-47", "gene_name": "IGLV1-47", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01714-1", "protein_name": "Immunoglobulin lambda variable 3-19", "gene_name": "IGLV3-19", "tax_name": "Human" }, { "uniprot_canonical_ac": "P80748-1", "protein_name": "Immunoglobulin lambda variable 3-21", "gene_name": "IGLV3-21", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A075B6P5-1", "protein_name": "Immunoglobulin kappa variable 2-28", "gene_name": "IGKV2-28", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A075B6S6-1", "protein_name": "Immunoglobulin kappa variable 2D-30", "gene_name": "IGKV2D-30", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0C4DH25-1", "protein_name": "Immunoglobulin kappa variable 3D-20", "gene_name": "IGKV3D-20", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01593-1", "protein_name": "Immunoglobulin kappa variable 1D-33", "gene_name": "IGKV1D-33", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01599-1", "protein_name": "Immunoglobulin kappa variable 1-17", "gene_name": "IGKV1-17", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01601-1", "protein_name": "Immunoglobulin kappa variable 1D-16", "gene_name": "IGKV1D-16", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01611-1", "protein_name": "Immunoglobulin kappa variable 1D-12", "gene_name": "IGKV1D-12", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01615-1", "protein_name": "Immunoglobulin kappa variable 2D-28", "gene_name": "IGKV2D-28", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01619-1", "protein_name": "Immunoglobulin kappa variable 3-20", "gene_name": "IGKV3-20", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01624-1", "protein_name": "Immunoglobulin kappa variable 3-15", "gene_name": "IGKV3-15", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04433-1", "protein_name": "Immunoglobulin kappa variable 3-11", "gene_name": "IGKV3-11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01602-1", "protein_name": "Immunoglobulin kappa variable 1-5", "gene_name": "IGKV1-5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8WV28-1", "protein_name": "B-cell linker protein", "gene_name": "BLNK", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14643-1", "protein_name": "Inositol 1,4,5-trisphosphate-gated calcium channel ITPR1", "gene_name": "ITPR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UN19-1", "protein_name": "Dual adapter for phosphotyrosine and 3-phosphotyrosine and 3-phosphoinositide", "gene_name": "DAPP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P43405-1", "protein_name": "Tyrosine-protein kinase SYK", "gene_name": "SYK", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96SN7-1", "protein_name": "Protein orai-2", "gene_name": "ORAI2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P15391-1", "protein_name": "B-lymphocyte antigen CD19", "gene_name": "CD19", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01871-2", "protein_name": "Immunoglobulin heavy constant mu", "gene_name": "IGHM", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13586-1", "protein_name": "Stromal interaction molecule 1", "gene_name": "STIM1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01767-1", "protein_name": "Immunoglobulin heavy variable 3-53", "gene_name": "IGHV3-53", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06331-1", "protein_name": "Immunoglobulin heavy variable 4-34", "gene_name": "IGHV4-34", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14571-1", "protein_name": "Inositol 1,4,5-trisphosphate-gated calcium channel ITPR2", "gene_name": "ITPR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01597-1", "protein_name": "Immunoglobulin kappa variable 1-39", "gene_name": "IGKV1-39", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06310-1", "protein_name": "Immunoglobulin kappa variable 2-30", "gene_name": "IGKV2-30", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06312-1", "protein_name": "Immunoglobulin kappa variable 4-1", "gene_name": "IGKV4-1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01614-1", "protein_name": "Immunoglobulin kappa variable 2D-40", "gene_name": "IGKV2D-40", "tax_name": "Human" }, { "uniprot_canonical_ac": "P48995-1", "protein_name": "Short transient receptor potential channel 1", "gene_name": "TRPC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DOY2-1", "protein_name": "Immunoglobulin lambda constant 2", "gene_name": "IGLC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6ZUJ8-1", "protein_name": "Phosphoinositide 3-kinase adapter protein 1", "gene_name": "PIK3AP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96D31-1", "protein_name": "Calcium release-activated calcium channel protein 1", "gene_name": "ORAI1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DP23-1", "protein_name": "Calmodulin-1", "gene_name": "CALM1; CALM2; CALM3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P29350-1", "protein_name": "Tyrosine-protein phosphatase non-receptor type 6", "gene_name": "PTPN6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P20273-1", "protein_name": "B-cell receptor CD22", "gene_name": "CD22", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04432-1", "protein_name": "Immunoglobulin kappa variable 1D-39", "gene_name": "IGKV1D-39", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06315-1", "protein_name": "Immunoglobulin kappa variable 5-2", "gene_name": "IGKV5-2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01699-1", "protein_name": "Immunoglobulin lambda variable 1-44", "gene_name": "IGLV1-44", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01701-1", "protein_name": "Immunoglobulin lambda variable 1-51", "gene_name": "IGLV1-51", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01704-1", "protein_name": "Immunoglobulin lambda variable 2-14", "gene_name": "IGLV2-14", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01706-1", "protein_name": "Immunoglobulin lambda variable 2-11", "gene_name": "IGLV2-11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01709-1", "protein_name": "Immunoglobulin lambda variable 2-8", "gene_name": "IGLV2-8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01717-1", "protein_name": "Immunoglobulin lambda variable 3-25", "gene_name": "IGLV3-25", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01721-1", "protein_name": "Immunoglobulin lambda variable 6-57", "gene_name": "IGLV6-57", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01703-1", "protein_name": "Immunoglobulin lambda variable 1-40", "gene_name": "IGLV1-40", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01705-1", "protein_name": "Immunoglobulin lambda variable 2-23", "gene_name": "IGLV2-23", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01715-1", "protein_name": "Immunoglobulin lambda variable 3-1", "gene_name": "IGLV3-1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01718-1", "protein_name": "Immunoglobulin lambda variable 3-27", "gene_name": "IGLV3-27", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04211-1", "protein_name": "Immunoglobulin lambda variable 7-43", "gene_name": "IGLV7-43", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q07889-1", "protein_name": "Son of sevenless homolog 1", "gene_name": "SOS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01880-2", "protein_name": "Immunoglobulin heavy constant delta", "gene_name": "IGHD", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CF74-1", "protein_name": "Immunoglobulin lambda constant 6", "gene_name": "IGLC6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q06187-1", "protein_name": "Tyrosine-protein kinase BTK", "gene_name": "BTK", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96B97-1", "protein_name": "SH3 domain-containing kinase-binding protein 1", "gene_name": "SH3KBP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P07948-1", "protein_name": "Tyrosine-protein kinase Lyn", "gene_name": "LYN", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51451-1", "protein_name": "Tyrosine-protein kinase Blk", "gene_name": "BLK", "tax_name": "Human" }, { "uniprot_canonical_ac": "P16885-1", "protein_name": "1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-2", "gene_name": "PLCG2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43865-1", "protein_name": "S-adenosylhomocysteine hydrolase-like protein 1", "gene_name": "AHCYL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01825-1", "protein_name": "Immunoglobulin heavy variable 4-59", "gene_name": "IGHV4-59", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01817-1", "protein_name": "Immunoglobulin heavy variable 2-5", "gene_name": "IGHV2-5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01824-1", "protein_name": "Immunoglobulin heavy variable 4-39", "gene_name": "IGHV4-39", "tax_name": "Human" }, { "uniprot_canonical_ac": "P23083-1", "protein_name": "Immunoglobulin heavy variable 1-2", "gene_name": "IGHV1-2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00329-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit delta isoform", "gene_name": "PIK3CD", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01742-1", "protein_name": "Immunoglobulin heavy variable 1-69", "gene_name": "IGHV1-69", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01768-1", "protein_name": "Immunoglobulin heavy variable 3-30", "gene_name": "IGHV3-30", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01814-1", "protein_name": "Immunoglobulin heavy variable 2-70", "gene_name": "IGHV2-70", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01772-1", "protein_name": "Immunoglobulin heavy variable 3-33", "gene_name": "IGHV3-33", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01762-1", "protein_name": "Immunoglobulin heavy variable 3-11", "gene_name": "IGHV3-11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01763-1", "protein_name": "Immunoglobulin heavy variable 3-48", "gene_name": "IGHV3-48", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01764-1", "protein_name": "Immunoglobulin heavy variable 3-23", "gene_name": "IGHV3-23", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01766-1", "protein_name": "Immunoglobulin heavy variable 3-13", "gene_name": "IGHV3-13", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01780-1", "protein_name": "Immunoglobulin heavy variable 3-7", "gene_name": "IGHV3-7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01782-1", "protein_name": "Immunoglobulin heavy variable 3-9", "gene_name": "IGHV3-9", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0M8Q6-1", "protein_name": "Immunoglobulin lambda constant 7", "gene_name": "IGLC7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01834-1", "protein_name": "Immunoglobulin kappa constant", "gene_name": "IGKC", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG04-1", "protein_name": "Immunoglobulin lambda constant 1", "gene_name": "IGLC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DOY3-1", "protein_name": "Immunoglobulin lambda constant 3", "gene_name": "IGLC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P11912-1", "protein_name": "B-cell antigen receptor complex-associated protein alpha chain", "gene_name": "CD79A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P40259-1", "protein_name": "B-cell antigen receptor complex-associated protein beta chain", "gene_name": "CD79B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01743-1", "protein_name": "Immunoglobulin heavy variable 1-46", "gene_name": "IGHV1-46", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14573-1", "protein_name": "Inositol 1,4,5-trisphosphate-gated calcium channel ITPR3", "gene_name": "ITPR3", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0C4DH73-1", "protein_name": "Immunoglobulin kappa variable 1-12", "gene_name": "IGKV1-12", "tax_name": "Human" }, { "uniprot_canonical_ac": "A2NJV5-1", "protein_name": "Immunoglobulin kappa variable 2-29", "gene_name": "IGKV2-29", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01594-1", "protein_name": "Immunoglobulin kappa variable 1-33", "gene_name": "IGKV1-33", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04430-1", "protein_name": "Immunoglobulin kappa variable 1-16", "gene_name": "IGKV1-16", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27986-1", "protein_name": "Phosphatidylinositol 3-kinase regulatory subunit alpha", "gene_name": "PIK3R1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06241-1", "protein_name": "Tyrosine-protein kinase Fyn", "gene_name": "FYN", "tax_name": "Human" }, { "uniprot_canonical_ac": "P16333-1", "protein_name": "SH2/SH3 adapter protein NCK1", "gene_name": "NCK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P15498-1", "protein_name": "Proto-oncogene vav", "gene_name": "VAV1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P01700", "url": "https://www.uniprot.org/uniprotkb/P01700" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.1081164", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 91 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "A second calcineurin binding site on the NFAT regulatory domain.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2000", "authors": "Park S, Uesugi M, Verdine GL", "reference": { "type": "PubMed", "id": "10860980", "url": "https://pubmed.ncbi.nlm.nih.gov/10860980" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P01700-1", "protein_name": "Immunoglobulin lambda variable 1-47", "gene_name": "IGLV1-47", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01714-1", "protein_name": "Immunoglobulin lambda variable 3-19", "gene_name": "IGLV3-19", "tax_name": "Human" }, { "uniprot_canonical_ac": "P80748-1", "protein_name": "Immunoglobulin lambda variable 3-21", "gene_name": "IGLV3-21", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A075B6P5-1", "protein_name": "Immunoglobulin kappa variable 2-28", "gene_name": "IGKV2-28", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A075B6S6-1", "protein_name": "Immunoglobulin kappa variable 2D-30", "gene_name": "IGKV2D-30", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0C4DH25-1", "protein_name": "Immunoglobulin kappa variable 3D-20", "gene_name": "IGKV3D-20", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01593-1", "protein_name": "Immunoglobulin kappa variable 1D-33", "gene_name": "IGKV1D-33", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01599-1", "protein_name": "Immunoglobulin kappa variable 1-17", "gene_name": "IGKV1-17", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01601-1", "protein_name": "Immunoglobulin kappa variable 1D-16", "gene_name": "IGKV1D-16", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01611-1", "protein_name": "Immunoglobulin kappa variable 1D-12", "gene_name": "IGKV1D-12", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01615-1", "protein_name": "Immunoglobulin kappa variable 2D-28", "gene_name": "IGKV2D-28", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01619-1", "protein_name": "Immunoglobulin kappa variable 3-20", "gene_name": "IGKV3-20", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01624-1", "protein_name": "Immunoglobulin kappa variable 3-15", "gene_name": "IGKV3-15", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04433-1", "protein_name": "Immunoglobulin kappa variable 3-11", "gene_name": "IGKV3-11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01602-1", "protein_name": "Immunoglobulin kappa variable 1-5", "gene_name": "IGKV1-5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14643-1", "protein_name": "Inositol 1,4,5-trisphosphate-gated calcium channel ITPR1", "gene_name": "ITPR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95644-1", "protein_name": "Nuclear factor of activated T-cells, cytoplasmic 1", "gene_name": "NFATC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P43405-1", "protein_name": "Tyrosine-protein kinase SYK", "gene_name": "SYK", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12968-1", "protein_name": "Nuclear factor of activated T-cells, cytoplasmic 3", "gene_name": "NFATC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13469-1", "protein_name": "Nuclear factor of activated T-cells, cytoplasmic 2", "gene_name": "NFATC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01362-1", "protein_name": "High affinity immunoglobulin epsilon receptor subunit beta", "gene_name": "MS4A2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P30273-1", "protein_name": "High affinity immunoglobulin epsilon receptor subunit gamma", "gene_name": "FCER1G", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01767-1", "protein_name": "Immunoglobulin heavy variable 3-53", "gene_name": "IGHV3-53", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06331-1", "protein_name": "Immunoglobulin heavy variable 4-34", "gene_name": "IGHV4-34", "tax_name": "Human" }, { "uniprot_canonical_ac": "P16298-1", "protein_name": "Serine/threonine-protein phosphatase 2B catalytic subunit beta isoform", "gene_name": "PPP3CB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14571-1", "protein_name": "Inositol 1,4,5-trisphosphate-gated calcium channel ITPR2", "gene_name": "ITPR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01597-1", "protein_name": "Immunoglobulin kappa variable 1-39", "gene_name": "IGKV1-39", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06310-1", "protein_name": "Immunoglobulin kappa variable 2-30", "gene_name": "IGKV2-30", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06312-1", "protein_name": "Immunoglobulin kappa variable 4-1", "gene_name": "IGKV4-1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01614-1", "protein_name": "Immunoglobulin kappa variable 2D-40", "gene_name": "IGKV2D-40", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DOY2-1", "protein_name": "Immunoglobulin lambda constant 2", "gene_name": "IGLC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75791-1", "protein_name": "GRB2-related adapter protein 2", "gene_name": "GRAP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DP23-1", "protein_name": "Calmodulin-1", "gene_name": "CALM1; CALM2; CALM3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04432-1", "protein_name": "Immunoglobulin kappa variable 1D-39", "gene_name": "IGKV1D-39", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06315-1", "protein_name": "Immunoglobulin kappa variable 5-2", "gene_name": "IGKV5-2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01699-1", "protein_name": "Immunoglobulin lambda variable 1-44", "gene_name": "IGLV1-44", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01701-1", "protein_name": "Immunoglobulin lambda variable 1-51", "gene_name": "IGLV1-51", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01704-1", "protein_name": "Immunoglobulin lambda variable 2-14", "gene_name": "IGLV2-14", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01706-1", "protein_name": "Immunoglobulin lambda variable 2-11", "gene_name": "IGLV2-11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01709-1", "protein_name": "Immunoglobulin lambda variable 2-8", "gene_name": "IGLV2-8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01717-1", "protein_name": "Immunoglobulin lambda variable 3-25", "gene_name": "IGLV3-25", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01721-1", "protein_name": "Immunoglobulin lambda variable 6-57", "gene_name": "IGLV6-57", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01703-1", "protein_name": "Immunoglobulin lambda variable 1-40", "gene_name": "IGLV1-40", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01705-1", "protein_name": "Immunoglobulin lambda variable 2-23", "gene_name": "IGLV2-23", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01715-1", "protein_name": "Immunoglobulin lambda variable 3-1", "gene_name": "IGLV3-1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01718-1", "protein_name": "Immunoglobulin lambda variable 3-27", "gene_name": "IGLV3-27", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04211-1", "protein_name": "Immunoglobulin lambda variable 7-43", "gene_name": "IGLV7-43", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q07889-1", "protein_name": "Son of sevenless homolog 1", "gene_name": "SOS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62937-1", "protein_name": "Peptidyl-prolyl cis-trans isomerase A", "gene_name": "PPIA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CF74-1", "protein_name": "Immunoglobulin lambda constant 6", "gene_name": "IGLC6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q06187-1", "protein_name": "Tyrosine-protein kinase BTK", "gene_name": "BTK", "tax_name": "Human" }, { "uniprot_canonical_ac": "P52735-1", "protein_name": "Guanine nucleotide exchange factor VAV2", "gene_name": "VAV2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62942-1", "protein_name": "Peptidyl-prolyl cis-trans isomerase FKBP1A", "gene_name": "FKBP1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P07948-1", "protein_name": "Tyrosine-protein kinase Lyn", "gene_name": "LYN", "tax_name": "Human" }, { "uniprot_canonical_ac": "P16885-1", "protein_name": "1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-2", "gene_name": "PLCG2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UKW4-1", "protein_name": "Guanine nucleotide exchange factor VAV3", "gene_name": "VAV3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42680-1", "protein_name": "Tyrosine-protein kinase Tec", "gene_name": "TEC", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43865-1", "protein_name": "S-adenosylhomocysteine hydrolase-like protein 1", "gene_name": "AHCYL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P63098-1", "protein_name": "Calcineurin subunit B type 1", "gene_name": "PPP3R1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q08209-1", "protein_name": "Protein phosphatase 3 catalytic subunit alpha", "gene_name": "PPP3CA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42681-1", "protein_name": "Tyrosine-protein kinase TXK", "gene_name": "TXK", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01825-1", "protein_name": "Immunoglobulin heavy variable 4-59", "gene_name": "IGHV4-59", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01817-1", "protein_name": "Immunoglobulin heavy variable 2-5", "gene_name": "IGHV2-5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01824-1", "protein_name": "Immunoglobulin heavy variable 4-39", "gene_name": "IGHV4-39", "tax_name": "Human" }, { "uniprot_canonical_ac": "P23083-1", "protein_name": "Immunoglobulin heavy variable 1-2", "gene_name": "IGHV1-2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01742-1", "protein_name": "Immunoglobulin heavy variable 1-69", "gene_name": "IGHV1-69", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01768-1", "protein_name": "Immunoglobulin heavy variable 3-30", "gene_name": "IGHV3-30", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01814-1", "protein_name": "Immunoglobulin heavy variable 2-70", "gene_name": "IGHV2-70", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01772-1", "protein_name": "Immunoglobulin heavy variable 3-33", "gene_name": "IGHV3-33", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01762-1", "protein_name": "Immunoglobulin heavy variable 3-11", "gene_name": "IGHV3-11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01763-1", "protein_name": "Immunoglobulin heavy variable 3-48", "gene_name": "IGHV3-48", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01764-1", "protein_name": "Immunoglobulin heavy variable 3-23", "gene_name": "IGHV3-23", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01766-1", "protein_name": "Immunoglobulin heavy variable 3-13", "gene_name": "IGHV3-13", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01780-1", "protein_name": "Immunoglobulin heavy variable 3-7", "gene_name": "IGHV3-7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01782-1", "protein_name": "Immunoglobulin heavy variable 3-9", "gene_name": "IGHV3-9", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0M8Q6-1", "protein_name": "Immunoglobulin lambda constant 7", "gene_name": "IGLC7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01834-1", "protein_name": "Immunoglobulin kappa constant", "gene_name": "IGKC", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG04-1", "protein_name": "Immunoglobulin lambda constant 1", "gene_name": "IGLC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DOY3-1", "protein_name": "Immunoglobulin lambda constant 3", "gene_name": "IGLC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13094-1", "protein_name": "Lymphocyte cytosolic protein 2", "gene_name": "LCP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01743-1", "protein_name": "Immunoglobulin heavy variable 1-46", "gene_name": "IGHV1-46", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01854-2", "protein_name": "Immunoglobulin heavy constant epsilon", "gene_name": "IGHE", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14573-1", "protein_name": "Inositol 1,4,5-trisphosphate-gated calcium channel ITPR3", "gene_name": "ITPR3", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0C4DH73-1", "protein_name": "Immunoglobulin kappa variable 1-12", "gene_name": "IGKV1-12", "tax_name": "Human" }, { "uniprot_canonical_ac": "A2NJV5-1", "protein_name": "Immunoglobulin kappa variable 2-29", "gene_name": "IGKV2-29", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01594-1", "protein_name": "Immunoglobulin kappa variable 1-33", "gene_name": "IGKV1-33", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04430-1", "protein_name": "Immunoglobulin kappa variable 1-16", "gene_name": "IGKV1-16", "tax_name": "Human" }, { "uniprot_canonical_ac": "P12319-1", "protein_name": "High affinity immunoglobulin epsilon receptor subunit alpha", "gene_name": "FCER1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q08881-1", "protein_name": "Tyrosine-protein kinase ITK/TSK", "gene_name": "ITK", "tax_name": "Human" }, { "uniprot_canonical_ac": "P19174-1", "protein_name": "1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-1", "gene_name": "PLCG1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P15498-1", "protein_name": "Proto-oncogene vav", "gene_name": "VAV1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P01700", "url": "https://www.uniprot.org/uniprotkb/P01700" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.10860980", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 91 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Differential involvement of Src family kinases in Fc gamma receptor-mediated phagocytosis.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "2000", "authors": "Suzuki T, Kono H, Hirose N, Okada M, Yamamoto T, Yamamoto K, Honda Z", "reference": { "type": "PubMed", "id": "10861086", "url": "https://pubmed.ncbi.nlm.nih.gov/10861086" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P01700-1", "protein_name": "Immunoglobulin lambda variable 1-47", "gene_name": "IGLV1-47", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01714-1", "protein_name": "Immunoglobulin lambda variable 3-19", "gene_name": "IGLV3-19", "tax_name": "Human" }, { "uniprot_canonical_ac": "P80748-1", "protein_name": "Immunoglobulin lambda variable 3-21", "gene_name": "IGLV3-21", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A075B6P5-1", "protein_name": "Immunoglobulin kappa variable 2-28", "gene_name": "IGKV2-28", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A075B6S6-1", "protein_name": "Immunoglobulin kappa variable 2D-30", "gene_name": "IGKV2D-30", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0C4DH25-1", "protein_name": "Immunoglobulin kappa variable 3D-20", "gene_name": "IGKV3D-20", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01593-1", "protein_name": "Immunoglobulin kappa variable 1D-33", "gene_name": "IGKV1D-33", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01599-1", "protein_name": "Immunoglobulin kappa variable 1-17", "gene_name": "IGKV1-17", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01601-1", "protein_name": "Immunoglobulin kappa variable 1D-16", "gene_name": "IGKV1D-16", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01611-1", "protein_name": "Immunoglobulin kappa variable 1D-12", "gene_name": "IGKV1D-12", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01615-1", "protein_name": "Immunoglobulin kappa variable 2D-28", "gene_name": "IGKV2D-28", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01619-1", "protein_name": "Immunoglobulin kappa variable 3-20", "gene_name": "IGKV3-20", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01624-1", "protein_name": "Immunoglobulin kappa variable 3-15", "gene_name": "IGKV3-15", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04433-1", "protein_name": "Immunoglobulin kappa variable 3-11", "gene_name": "IGKV3-11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01602-1", "protein_name": "Immunoglobulin kappa variable 1-5", "gene_name": "IGKV1-5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P22694-1", "protein_name": "cAMP-dependent protein kinase catalytic subunit beta", "gene_name": "PRKACB", "tax_name": "Human" }, { "uniprot_canonical_ac": "P08631-1", "protein_name": "Tyrosine-protein kinase HCK", "gene_name": "HCK", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14643-1", "protein_name": "Inositol 1,4,5-trisphosphate-gated calcium channel ITPR1", "gene_name": "ITPR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P43405-1", "protein_name": "Tyrosine-protein kinase SYK", "gene_name": "SYK", "tax_name": "Human" }, { "uniprot_canonical_ac": "P08637-1", "protein_name": "Low affinity immunoglobulin gamma Fc region receptor III-A", "gene_name": "FCGR3A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01767-1", "protein_name": "Immunoglobulin heavy variable 3-53", "gene_name": "IGHV3-53", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06331-1", "protein_name": "Immunoglobulin heavy variable 4-34", "gene_name": "IGHV4-34", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14571-1", "protein_name": "Inositol 1,4,5-trisphosphate-gated calcium channel ITPR2", "gene_name": "ITPR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01597-1", "protein_name": "Immunoglobulin kappa variable 1-39", "gene_name": "IGKV1-39", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06310-1", "protein_name": "Immunoglobulin kappa variable 2-30", "gene_name": "IGKV2-30", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06312-1", "protein_name": "Immunoglobulin kappa variable 4-1", "gene_name": "IGKV4-1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01614-1", "protein_name": "Immunoglobulin kappa variable 2D-40", "gene_name": "IGKV2D-40", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DOY2-1", "protein_name": "Immunoglobulin lambda constant 2", "gene_name": "IGLC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DP23-1", "protein_name": "Calmodulin-1", "gene_name": "CALM1; CALM2; CALM3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P09693-1", "protein_name": "T-cell surface glycoprotein CD3 gamma chain", "gene_name": "CD3G", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04432-1", "protein_name": "Immunoglobulin kappa variable 1D-39", "gene_name": "IGKV1D-39", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06315-1", "protein_name": "Immunoglobulin kappa variable 5-2", "gene_name": "IGKV5-2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01699-1", "protein_name": "Immunoglobulin lambda variable 1-44", "gene_name": "IGLV1-44", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01701-1", "protein_name": "Immunoglobulin lambda variable 1-51", "gene_name": "IGLV1-51", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01704-1", "protein_name": "Immunoglobulin lambda variable 2-14", "gene_name": "IGLV2-14", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01706-1", "protein_name": "Immunoglobulin lambda variable 2-11", "gene_name": "IGLV2-11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01709-1", "protein_name": "Immunoglobulin lambda variable 2-8", "gene_name": "IGLV2-8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01717-1", "protein_name": "Immunoglobulin lambda variable 3-25", "gene_name": "IGLV3-25", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01721-1", "protein_name": "Immunoglobulin lambda variable 6-57", "gene_name": "IGLV6-57", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01703-1", "protein_name": "Immunoglobulin lambda variable 1-40", "gene_name": "IGLV1-40", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01705-1", "protein_name": "Immunoglobulin lambda variable 2-23", "gene_name": "IGLV2-23", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01715-1", "protein_name": "Immunoglobulin lambda variable 3-1", "gene_name": "IGLV3-1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01718-1", "protein_name": "Immunoglobulin lambda variable 3-27", "gene_name": "IGLV3-27", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04211-1", "protein_name": "Immunoglobulin lambda variable 7-43", "gene_name": "IGLV7-43", "tax_name": "Human" }, { "uniprot_canonical_ac": "P22612-1", "protein_name": "cAMP-dependent protein kinase catalytic subunit gamma", "gene_name": "PRKACG", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01860-2", "protein_name": "Immunoglobulin heavy constant gamma 3", "gene_name": "IGHG3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01861-2", "protein_name": "Immunoglobulin heavy constant gamma 4", "gene_name": "IGHG4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CF74-1", "protein_name": "Immunoglobulin lambda constant 6", "gene_name": "IGLC6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P13861-1", "protein_name": "cAMP-dependent protein kinase type II-alpha regulatory subunit", "gene_name": "PRKAR2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P17612-1", "protein_name": "cAMP-dependent protein kinase catalytic subunit alpha", "gene_name": "PRKACA", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95622-1", "protein_name": "Adenylate cyclase type 5", "gene_name": "ADCY5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q08828-1", "protein_name": "Adenylate cyclase type 1", "gene_name": "ADCY1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P40145-1", "protein_name": "Adenylate cyclase type 8", "gene_name": "ADCY8", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60266-1", "protein_name": "Adenylate cyclase type 3", "gene_name": "ADCY3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NFM4-1", "protein_name": "Adenylate cyclase type 4", "gene_name": "ADCY4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P10644-1", "protein_name": "cAMP-dependent protein kinase type I-alpha regulatory subunit", "gene_name": "PRKAR1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P07948-1", "protein_name": "Tyrosine-protein kinase Lyn", "gene_name": "LYN", "tax_name": "Human" }, { "uniprot_canonical_ac": "P07947-1", "protein_name": "Tyrosine-protein kinase Yes", "gene_name": "YES1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P31323-1", "protein_name": "cAMP-dependent protein kinase type II-beta regulatory subunit", "gene_name": "PRKAR2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P16885-1", "protein_name": "1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-2", "gene_name": "PLCG2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P09769-1", "protein_name": "Tyrosine-protein kinase Fgr", "gene_name": "FGR", "tax_name": "Human" }, { "uniprot_canonical_ac": "P12314-1", "protein_name": "High affinity immunoglobulin gamma Fc receptor I", "gene_name": "FCGR1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51817-1", "protein_name": "cAMP-dependent protein kinase catalytic subunit PRKX", "gene_name": "PRKX", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43865-1", "protein_name": "S-adenosylhomocysteine hydrolase-like protein 1", "gene_name": "AHCYL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P31321-1", "protein_name": "cAMP-dependent protein kinase type I-beta regulatory subunit", "gene_name": "PRKAR1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P22301-1", "protein_name": "Interleukin-10", "gene_name": "IL10", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01825-1", "protein_name": "Immunoglobulin heavy variable 4-59", "gene_name": "IGHV4-59", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01817-1", "protein_name": "Immunoglobulin heavy variable 2-5", "gene_name": "IGHV2-5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01824-1", "protein_name": "Immunoglobulin heavy variable 4-39", "gene_name": "IGHV4-39", "tax_name": "Human" }, { "uniprot_canonical_ac": "P23083-1", "protein_name": "Immunoglobulin heavy variable 1-2", "gene_name": "IGHV1-2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01742-1", "protein_name": "Immunoglobulin heavy variable 1-69", "gene_name": "IGHV1-69", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01768-1", "protein_name": "Immunoglobulin heavy variable 3-30", "gene_name": "IGHV3-30", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01814-1", "protein_name": "Immunoglobulin heavy variable 2-70", "gene_name": "IGHV2-70", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01772-1", "protein_name": "Immunoglobulin heavy variable 3-33", "gene_name": "IGHV3-33", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01762-1", "protein_name": "Immunoglobulin heavy variable 3-11", "gene_name": "IGHV3-11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01763-1", "protein_name": "Immunoglobulin heavy variable 3-48", "gene_name": "IGHV3-48", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01764-1", "protein_name": "Immunoglobulin heavy variable 3-23", "gene_name": "IGHV3-23", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01766-1", "protein_name": "Immunoglobulin heavy variable 3-13", "gene_name": "IGHV3-13", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01780-1", "protein_name": "Immunoglobulin heavy variable 3-7", "gene_name": "IGHV3-7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01782-1", "protein_name": "Immunoglobulin heavy variable 3-9", "gene_name": "IGHV3-9", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0M8Q6-1", "protein_name": "Immunoglobulin lambda constant 7", "gene_name": "IGLC7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01834-1", "protein_name": "Immunoglobulin kappa constant", "gene_name": "IGKC", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01859-2", "protein_name": "Immunoglobulin heavy constant gamma 2", "gene_name": "IGHG2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG04-1", "protein_name": "Immunoglobulin lambda constant 1", "gene_name": "IGLC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DOY3-1", "protein_name": "Immunoglobulin lambda constant 3", "gene_name": "IGLC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01743-1", "protein_name": "Immunoglobulin heavy variable 1-46", "gene_name": "IGHV1-46", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14573-1", "protein_name": "Inositol 1,4,5-trisphosphate-gated calcium channel ITPR3", "gene_name": "ITPR3", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0C4DH73-1", "protein_name": "Immunoglobulin kappa variable 1-12", "gene_name": "IGKV1-12", "tax_name": "Human" }, { "uniprot_canonical_ac": "A2NJV5-1", "protein_name": "Immunoglobulin kappa variable 2-29", "gene_name": "IGKV2-29", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01594-1", "protein_name": "Immunoglobulin kappa variable 1-33", "gene_name": "IGKV1-33", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04430-1", "protein_name": "Immunoglobulin kappa variable 1-16", "gene_name": "IGKV1-16", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01857-2", "protein_name": "Immunoglobulin heavy constant gamma 1", "gene_name": "IGHG1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P12318-1", "protein_name": "Low affinity immunoglobulin gamma Fc region receptor II-a", "gene_name": "FCGR2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P19174-1", "protein_name": "1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-1", "gene_name": "PLCG1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60503-1", "protein_name": "Adenylate cyclase type 9", "gene_name": "ADCY9", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06241-1", "protein_name": "Tyrosine-protein kinase Fyn", "gene_name": "FYN", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51828-1", "protein_name": "Adenylate cyclase type 7", "gene_name": "ADCY7", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43306-1", "protein_name": "Adenylate cyclase type 6", "gene_name": "ADCY6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q08462-1", "protein_name": "Adenylate cyclase type 2", "gene_name": "ADCY2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P01700", "url": "https://www.uniprot.org/uniprotkb/P01700" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.10861086", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 99 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Phosphoinositide 3-kinase-dependent phosphorylation of the dual adaptor for phosphotyrosine and 3-phosphoinositides by the Src family of tyrosine kinase.", "journal": "The Biochemical journal", "date": "2000", "authors": "Dowler S, Montalvo L, Cantrell D, Morrice N, Alessi DR", "reference": { "type": "PubMed", "id": "10880360", "url": "https://pubmed.ncbi.nlm.nih.gov/10880360" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P01700-1", "protein_name": "Immunoglobulin lambda variable 1-47", "gene_name": "IGLV1-47", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01714-1", "protein_name": "Immunoglobulin lambda variable 3-19", "gene_name": "IGLV3-19", "tax_name": "Human" }, { "uniprot_canonical_ac": "P80748-1", "protein_name": "Immunoglobulin lambda variable 3-21", "gene_name": "IGLV3-21", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A075B6P5-1", "protein_name": "Immunoglobulin kappa variable 2-28", "gene_name": "IGKV2-28", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A075B6S6-1", "protein_name": "Immunoglobulin kappa variable 2D-30", "gene_name": "IGKV2D-30", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0C4DH25-1", "protein_name": "Immunoglobulin kappa variable 3D-20", "gene_name": "IGKV3D-20", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01593-1", "protein_name": "Immunoglobulin kappa variable 1D-33", "gene_name": "IGKV1D-33", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01599-1", "protein_name": "Immunoglobulin kappa variable 1-17", "gene_name": "IGKV1-17", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01601-1", "protein_name": "Immunoglobulin kappa variable 1D-16", "gene_name": "IGKV1D-16", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01611-1", "protein_name": "Immunoglobulin kappa variable 1D-12", "gene_name": "IGKV1D-12", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01615-1", "protein_name": "Immunoglobulin kappa variable 2D-28", "gene_name": "IGKV2D-28", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01619-1", "protein_name": "Immunoglobulin kappa variable 3-20", "gene_name": "IGKV3-20", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01624-1", "protein_name": "Immunoglobulin kappa variable 3-15", "gene_name": "IGKV3-15", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04433-1", "protein_name": "Immunoglobulin kappa variable 3-11", "gene_name": "IGKV3-11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01602-1", "protein_name": "Immunoglobulin kappa variable 1-5", "gene_name": "IGKV1-5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8WV28-1", "protein_name": "B-cell linker protein", "gene_name": "BLNK", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14643-1", "protein_name": "Inositol 1,4,5-trisphosphate-gated calcium channel ITPR1", "gene_name": "ITPR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UN19-1", "protein_name": "Dual adapter for phosphotyrosine and 3-phosphotyrosine and 3-phosphoinositide", "gene_name": "DAPP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P43405-1", "protein_name": "Tyrosine-protein kinase SYK", "gene_name": "SYK", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96SN7-1", "protein_name": "Protein orai-2", "gene_name": "ORAI2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P15391-1", "protein_name": "B-lymphocyte antigen CD19", "gene_name": "CD19", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01871-2", "protein_name": "Immunoglobulin heavy constant mu", "gene_name": "IGHM", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13586-1", "protein_name": "Stromal interaction molecule 1", "gene_name": "STIM1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01767-1", "protein_name": "Immunoglobulin heavy variable 3-53", "gene_name": "IGHV3-53", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06331-1", "protein_name": "Immunoglobulin heavy variable 4-34", "gene_name": "IGHV4-34", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14571-1", "protein_name": "Inositol 1,4,5-trisphosphate-gated calcium channel ITPR2", "gene_name": "ITPR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01597-1", "protein_name": "Immunoglobulin kappa variable 1-39", "gene_name": "IGKV1-39", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06310-1", "protein_name": "Immunoglobulin kappa variable 2-30", "gene_name": "IGKV2-30", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06312-1", "protein_name": "Immunoglobulin kappa variable 4-1", "gene_name": "IGKV4-1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01614-1", "protein_name": "Immunoglobulin kappa variable 2D-40", "gene_name": "IGKV2D-40", "tax_name": "Human" }, { "uniprot_canonical_ac": "P48995-1", "protein_name": "Short transient receptor potential channel 1", "gene_name": "TRPC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DOY2-1", "protein_name": "Immunoglobulin lambda constant 2", "gene_name": "IGLC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6ZUJ8-1", "protein_name": "Phosphoinositide 3-kinase adapter protein 1", "gene_name": "PIK3AP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96D31-1", "protein_name": "Calcium release-activated calcium channel protein 1", "gene_name": "ORAI1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DP23-1", "protein_name": "Calmodulin-1", "gene_name": "CALM1; CALM2; CALM3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P29350-1", "protein_name": "Tyrosine-protein phosphatase non-receptor type 6", "gene_name": "PTPN6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P20273-1", "protein_name": "B-cell receptor CD22", "gene_name": "CD22", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04432-1", "protein_name": "Immunoglobulin kappa variable 1D-39", "gene_name": "IGKV1D-39", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06315-1", "protein_name": "Immunoglobulin kappa variable 5-2", "gene_name": "IGKV5-2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01699-1", "protein_name": "Immunoglobulin lambda variable 1-44", "gene_name": "IGLV1-44", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01701-1", "protein_name": "Immunoglobulin lambda variable 1-51", "gene_name": "IGLV1-51", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01704-1", "protein_name": "Immunoglobulin lambda variable 2-14", "gene_name": "IGLV2-14", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01706-1", "protein_name": "Immunoglobulin lambda variable 2-11", "gene_name": "IGLV2-11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01709-1", "protein_name": "Immunoglobulin lambda variable 2-8", "gene_name": "IGLV2-8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01717-1", "protein_name": "Immunoglobulin lambda variable 3-25", "gene_name": "IGLV3-25", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01721-1", "protein_name": "Immunoglobulin lambda variable 6-57", "gene_name": "IGLV6-57", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01703-1", "protein_name": "Immunoglobulin lambda variable 1-40", "gene_name": "IGLV1-40", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01705-1", "protein_name": "Immunoglobulin lambda variable 2-23", "gene_name": "IGLV2-23", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01715-1", "protein_name": "Immunoglobulin lambda variable 3-1", "gene_name": "IGLV3-1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01718-1", "protein_name": "Immunoglobulin lambda variable 3-27", "gene_name": "IGLV3-27", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04211-1", "protein_name": "Immunoglobulin lambda variable 7-43", "gene_name": "IGLV7-43", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q07889-1", "protein_name": "Son of sevenless homolog 1", "gene_name": "SOS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01880-2", "protein_name": "Immunoglobulin heavy constant delta", "gene_name": "IGHD", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CF74-1", "protein_name": "Immunoglobulin lambda constant 6", "gene_name": "IGLC6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q06187-1", "protein_name": "Tyrosine-protein kinase BTK", "gene_name": "BTK", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96B97-1", "protein_name": "SH3 domain-containing kinase-binding protein 1", "gene_name": "SH3KBP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P07948-1", "protein_name": "Tyrosine-protein kinase Lyn", "gene_name": "LYN", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51451-1", "protein_name": "Tyrosine-protein kinase Blk", "gene_name": "BLK", "tax_name": "Human" }, { "uniprot_canonical_ac": "P16885-1", "protein_name": "1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-2", "gene_name": "PLCG2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43865-1", "protein_name": "S-adenosylhomocysteine hydrolase-like protein 1", "gene_name": "AHCYL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01825-1", "protein_name": "Immunoglobulin heavy variable 4-59", "gene_name": "IGHV4-59", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01817-1", "protein_name": "Immunoglobulin heavy variable 2-5", "gene_name": "IGHV2-5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01824-1", "protein_name": "Immunoglobulin heavy variable 4-39", "gene_name": "IGHV4-39", "tax_name": "Human" }, { "uniprot_canonical_ac": "P23083-1", "protein_name": "Immunoglobulin heavy variable 1-2", "gene_name": "IGHV1-2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00329-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit delta isoform", "gene_name": "PIK3CD", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01742-1", "protein_name": "Immunoglobulin heavy variable 1-69", "gene_name": "IGHV1-69", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01768-1", "protein_name": "Immunoglobulin heavy variable 3-30", "gene_name": "IGHV3-30", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01814-1", "protein_name": "Immunoglobulin heavy variable 2-70", "gene_name": "IGHV2-70", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01772-1", "protein_name": "Immunoglobulin heavy variable 3-33", "gene_name": "IGHV3-33", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01762-1", "protein_name": "Immunoglobulin heavy variable 3-11", "gene_name": "IGHV3-11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01763-1", "protein_name": "Immunoglobulin heavy variable 3-48", "gene_name": "IGHV3-48", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01764-1", "protein_name": "Immunoglobulin heavy variable 3-23", "gene_name": "IGHV3-23", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01766-1", "protein_name": "Immunoglobulin heavy variable 3-13", "gene_name": "IGHV3-13", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01780-1", "protein_name": "Immunoglobulin heavy variable 3-7", "gene_name": "IGHV3-7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01782-1", "protein_name": "Immunoglobulin heavy variable 3-9", "gene_name": "IGHV3-9", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0M8Q6-1", "protein_name": "Immunoglobulin lambda constant 7", "gene_name": "IGLC7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01834-1", "protein_name": "Immunoglobulin kappa constant", "gene_name": "IGKC", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG04-1", "protein_name": "Immunoglobulin lambda constant 1", "gene_name": "IGLC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DOY3-1", "protein_name": "Immunoglobulin lambda constant 3", "gene_name": "IGLC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P11912-1", "protein_name": "B-cell antigen receptor complex-associated protein alpha chain", "gene_name": "CD79A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P40259-1", "protein_name": "B-cell antigen receptor complex-associated protein beta chain", "gene_name": "CD79B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01743-1", "protein_name": "Immunoglobulin heavy variable 1-46", "gene_name": "IGHV1-46", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14573-1", "protein_name": "Inositol 1,4,5-trisphosphate-gated calcium channel ITPR3", "gene_name": "ITPR3", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0C4DH73-1", "protein_name": "Immunoglobulin kappa variable 1-12", "gene_name": "IGKV1-12", "tax_name": "Human" }, { "uniprot_canonical_ac": "A2NJV5-1", "protein_name": "Immunoglobulin kappa variable 2-29", "gene_name": "IGKV2-29", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01594-1", "protein_name": "Immunoglobulin kappa variable 1-33", "gene_name": "IGKV1-33", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04430-1", "protein_name": "Immunoglobulin kappa variable 1-16", "gene_name": "IGKV1-16", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27986-1", "protein_name": "Phosphatidylinositol 3-kinase regulatory subunit alpha", "gene_name": "PIK3R1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06241-1", "protein_name": "Tyrosine-protein kinase Fyn", "gene_name": "FYN", "tax_name": "Human" }, { "uniprot_canonical_ac": "P16333-1", "protein_name": "SH2/SH3 adapter protein NCK1", "gene_name": "NCK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P15498-1", "protein_name": "Proto-oncogene vav", "gene_name": "VAV1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P01700", "url": "https://www.uniprot.org/uniprotkb/P01700" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 139, "end_pos": 139, "kinase_uniprot_canonical_ac": "P06239-1", "kinase_gene_name": "LCK", "residue": "Tyr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q9UN19", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9UN19" }, { "database": "PubMed", "id": "10880360", "url": "https://pubmed.ncbi.nlm.nih.gov/10880360" }, { "database": "PubMed", "id": "17389395", "url": "https://pubmed.ncbi.nlm.nih.gov/17389395" }, { "database": "PubMed", "id": "19901323", "url": "https://pubmed.ncbi.nlm.nih.gov/19901323" } ], "site_lbl": "Tyr139", "uniprot_canonical_ac": "Q9UN19-1" }, { "start_pos": 139, "end_pos": 139, "kinase_uniprot_canonical_ac": "P07948-1", "kinase_gene_name": "LYN", "residue": "Tyr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q9UN19", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9UN19" }, { "database": "PubMed", "id": "10880360", "url": "https://pubmed.ncbi.nlm.nih.gov/10880360" }, { "database": "PubMed", "id": "17389395", "url": "https://pubmed.ncbi.nlm.nih.gov/17389395" }, { "database": "PubMed", "id": "19901323", "url": "https://pubmed.ncbi.nlm.nih.gov/19901323" } ], "site_lbl": "Tyr139", "uniprot_canonical_ac": "Q9UN19-1" }, { "start_pos": 139, "end_pos": 139, "kinase_uniprot_canonical_ac": "P12931-1", "kinase_gene_name": "SRC", "residue": "Tyr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q9UN19", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9UN19" }, { "database": "PubMed", "id": "10880360", "url": "https://pubmed.ncbi.nlm.nih.gov/10880360" }, { "database": "PubMed", "id": "17389395", "url": "https://pubmed.ncbi.nlm.nih.gov/17389395" }, { "database": "PubMed", "id": "19901323", "url": "https://pubmed.ncbi.nlm.nih.gov/19901323" } ], "site_lbl": "Tyr139", "uniprot_canonical_ac": "Q9UN19-1" }, { "start_pos": 139, "end_pos": 139, "kinase_uniprot_canonical_ac": "Q06187-1", "kinase_gene_name": "BTK", "residue": "Tyr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q9UN19", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9UN19" }, { "database": "PubMed", "id": "10880360", "url": "https://pubmed.ncbi.nlm.nih.gov/10880360" }, { "database": "PubMed", "id": "17389395", "url": "https://pubmed.ncbi.nlm.nih.gov/17389395" }, { "database": "PubMed", "id": "19901323", "url": "https://pubmed.ncbi.nlm.nih.gov/19901323" } ], "site_lbl": "Tyr139", "uniprot_canonical_ac": "Q9UN19-1" }, { "start_pos": 139, "end_pos": 139, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "Phosphotyrosine", "evidence": [ { "database": "UniProtKB", "id": "Q9UN19", "url": "https://www.uniprot.org/uniprotkb/Q9UN19" }, { "database": "iPTMnet", "id": "Q9UN19", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9UN19" }, { "database": "PubMed", "id": "10880360", "url": "https://pubmed.ncbi.nlm.nih.gov/10880360" }, { "database": "PubMed", "id": "17389395", "url": "https://pubmed.ncbi.nlm.nih.gov/17389395" }, { "database": "PubMed", "id": "19901323", "url": "https://pubmed.ncbi.nlm.nih.gov/19901323" }, { "database": "PubMed", "id": "15247305", "url": "https://pubmed.ncbi.nlm.nih.gov/15247305" } ], "site_lbl": "Tyr139", "uniprot_canonical_ac": "Q9UN19-1" } ], "record_id": "pubmed.10880360", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 91 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 5 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Structure of the Fc fragment of human IgE bound to its high-affinity receptor Fc epsilonRI alpha.", "journal": "Nature", "date": "2000", "authors": "Garman SC, Wurzburg BA, Tarchevskaya SS, Kinet JP, Jardetzky TS", "reference": { "type": "PubMed", "id": "10917520", "url": "https://pubmed.ncbi.nlm.nih.gov/10917520" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P01700-1", "protein_name": "Immunoglobulin lambda variable 1-47", "gene_name": "IGLV1-47", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01714-1", "protein_name": "Immunoglobulin lambda variable 3-19", "gene_name": "IGLV3-19", "tax_name": "Human" }, { "uniprot_canonical_ac": "P80748-1", "protein_name": "Immunoglobulin lambda variable 3-21", "gene_name": "IGLV3-21", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A075B6P5-1", "protein_name": "Immunoglobulin kappa variable 2-28", "gene_name": "IGKV2-28", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A075B6S6-1", "protein_name": "Immunoglobulin kappa variable 2D-30", "gene_name": "IGKV2D-30", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0C4DH25-1", "protein_name": "Immunoglobulin kappa variable 3D-20", "gene_name": "IGKV3D-20", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01593-1", "protein_name": "Immunoglobulin kappa variable 1D-33", "gene_name": "IGKV1D-33", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01599-1", "protein_name": "Immunoglobulin kappa variable 1-17", "gene_name": "IGKV1-17", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01601-1", "protein_name": "Immunoglobulin kappa variable 1D-16", "gene_name": "IGKV1D-16", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01611-1", "protein_name": "Immunoglobulin kappa variable 1D-12", "gene_name": "IGKV1D-12", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01615-1", "protein_name": "Immunoglobulin kappa variable 2D-28", "gene_name": "IGKV2D-28", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01619-1", "protein_name": "Immunoglobulin kappa variable 3-20", "gene_name": "IGKV3-20", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01624-1", "protein_name": "Immunoglobulin kappa variable 3-15", "gene_name": "IGKV3-15", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04433-1", "protein_name": "Immunoglobulin kappa variable 3-11", "gene_name": "IGKV3-11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01602-1", "protein_name": "Immunoglobulin kappa variable 1-5", "gene_name": "IGKV1-5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P43405-1", "protein_name": "Tyrosine-protein kinase SYK", "gene_name": "SYK", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01362-1", "protein_name": "High affinity immunoglobulin epsilon receptor subunit beta", "gene_name": "MS4A2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P30273-1", "protein_name": "High affinity immunoglobulin epsilon receptor subunit gamma", "gene_name": "FCER1G", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01767-1", "protein_name": "Immunoglobulin heavy variable 3-53", "gene_name": "IGHV3-53", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06331-1", "protein_name": "Immunoglobulin heavy variable 4-34", "gene_name": "IGHV4-34", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01597-1", "protein_name": "Immunoglobulin kappa variable 1-39", "gene_name": "IGKV1-39", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06310-1", "protein_name": "Immunoglobulin kappa variable 2-30", "gene_name": "IGKV2-30", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06312-1", "protein_name": "Immunoglobulin kappa variable 4-1", "gene_name": "IGKV4-1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01614-1", "protein_name": "Immunoglobulin kappa variable 2D-40", "gene_name": "IGKV2D-40", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DOY2-1", "protein_name": "Immunoglobulin lambda constant 2", "gene_name": "IGLC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04432-1", "protein_name": "Immunoglobulin kappa variable 1D-39", "gene_name": "IGKV1D-39", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06315-1", "protein_name": "Immunoglobulin kappa variable 5-2", "gene_name": "IGKV5-2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01699-1", "protein_name": "Immunoglobulin lambda variable 1-44", "gene_name": "IGLV1-44", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01701-1", "protein_name": "Immunoglobulin lambda variable 1-51", "gene_name": "IGLV1-51", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01704-1", "protein_name": "Immunoglobulin lambda variable 2-14", "gene_name": "IGLV2-14", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01706-1", "protein_name": "Immunoglobulin lambda variable 2-11", "gene_name": "IGLV2-11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01709-1", "protein_name": "Immunoglobulin lambda variable 2-8", "gene_name": "IGLV2-8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01717-1", "protein_name": "Immunoglobulin lambda variable 3-25", "gene_name": "IGLV3-25", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01721-1", "protein_name": "Immunoglobulin lambda variable 6-57", "gene_name": "IGLV6-57", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01703-1", "protein_name": "Immunoglobulin lambda variable 1-40", "gene_name": "IGLV1-40", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01705-1", "protein_name": "Immunoglobulin lambda variable 2-23", "gene_name": "IGLV2-23", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01715-1", "protein_name": "Immunoglobulin lambda variable 3-1", "gene_name": "IGLV3-1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01718-1", "protein_name": "Immunoglobulin lambda variable 3-27", "gene_name": "IGLV3-27", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04211-1", "protein_name": "Immunoglobulin lambda variable 7-43", "gene_name": "IGLV7-43", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CF74-1", "protein_name": "Immunoglobulin lambda constant 6", "gene_name": "IGLC6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P07948-1", "protein_name": "Tyrosine-protein kinase Lyn", "gene_name": "LYN", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01825-1", "protein_name": "Immunoglobulin heavy variable 4-59", "gene_name": "IGHV4-59", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01817-1", "protein_name": "Immunoglobulin heavy variable 2-5", "gene_name": "IGHV2-5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01824-1", "protein_name": "Immunoglobulin heavy variable 4-39", "gene_name": "IGHV4-39", "tax_name": "Human" }, { "uniprot_canonical_ac": "P23083-1", "protein_name": "Immunoglobulin heavy variable 1-2", "gene_name": "IGHV1-2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01742-1", "protein_name": "Immunoglobulin heavy variable 1-69", "gene_name": "IGHV1-69", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01768-1", "protein_name": "Immunoglobulin heavy variable 3-30", "gene_name": "IGHV3-30", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01814-1", "protein_name": "Immunoglobulin heavy variable 2-70", "gene_name": "IGHV2-70", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01772-1", "protein_name": "Immunoglobulin heavy variable 3-33", "gene_name": "IGHV3-33", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01762-1", "protein_name": "Immunoglobulin heavy variable 3-11", "gene_name": "IGHV3-11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01763-1", "protein_name": "Immunoglobulin heavy variable 3-48", "gene_name": "IGHV3-48", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01764-1", "protein_name": "Immunoglobulin heavy variable 3-23", "gene_name": "IGHV3-23", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01766-1", "protein_name": "Immunoglobulin heavy variable 3-13", "gene_name": "IGHV3-13", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01780-1", "protein_name": "Immunoglobulin heavy variable 3-7", "gene_name": "IGHV3-7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01782-1", "protein_name": "Immunoglobulin heavy variable 3-9", "gene_name": "IGHV3-9", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0M8Q6-1", "protein_name": "Immunoglobulin lambda constant 7", "gene_name": "IGLC7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01834-1", "protein_name": "Immunoglobulin kappa constant", "gene_name": "IGKC", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG04-1", "protein_name": "Immunoglobulin lambda constant 1", "gene_name": "IGLC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DOY3-1", "protein_name": "Immunoglobulin lambda constant 3", "gene_name": "IGLC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01743-1", "protein_name": "Immunoglobulin heavy variable 1-46", "gene_name": "IGHV1-46", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01854-2", "protein_name": "Immunoglobulin heavy constant epsilon", "gene_name": "IGHE", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0C4DH73-1", "protein_name": "Immunoglobulin kappa variable 1-12", "gene_name": "IGKV1-12", "tax_name": "Human" }, { "uniprot_canonical_ac": "A2NJV5-1", "protein_name": "Immunoglobulin kappa variable 2-29", "gene_name": "IGKV2-29", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01594-1", "protein_name": "Immunoglobulin kappa variable 1-33", "gene_name": "IGKV1-33", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04430-1", "protein_name": "Immunoglobulin kappa variable 1-16", "gene_name": "IGKV1-16", "tax_name": "Human" }, { "uniprot_canonical_ac": "P12319-1", "protein_name": "High affinity immunoglobulin epsilon receptor subunit alpha", "gene_name": "FCER1A", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P01700", "url": "https://www.uniprot.org/uniprotkb/P01700" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "glycosylation": [ { "glytoucan_ac": "", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true, "automatic_literature_mining": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": { "label": "iCn3D", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?bcifid=7SHY&bu=0&command=select+.A:394;+center+selection;+zoom+selection" }, "start_pos": 275, "start_aa": "Asn", "end_pos": 275, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn275", "evidence": [ { "id": "24308486", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24308486" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "P01854", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P01854#ptm_processing" }, { "id": "10917520", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/10917520" }, { "id": "23090970", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23090970" }, { "id": "GLY_000143", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000143" }, { "id": "26687240", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/26687240" }, { "id": "GLY_000481", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000481" }, { "id": "7SHY", "database": "PDB", "url": "https://www.rcsb.org/structure/7SHY" }, { "id": "2Y7Q", "database": "PDB", "url": "https://www.rcsb.org/structure/2Y7Q" } ], "mining_tool": "GlycoSiteMiner_1.0", "mining_tool_list": [ { "label": "GlycoSiteMiner_1.0" } ], "filter_code": "001000000000000000000.00010000000000.00.01000", "uniprot_canonical_ac": "P01854-2" }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "icn3d_view": { "label": "iCn3D", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?bcifid=1J86&bu=0&command=select+.B:166;+center+selection;+zoom+selection" }, "start_pos": 191, "start_aa": "Asn", "end_pos": 191, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn191", "evidence": [ { "id": "P12319", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P12319#ptm_processing" }, { "id": "11531339", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/11531339" }, { "id": "10917520", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/10917520" }, { "id": "9875849", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/9875849" }, { "id": "1J86", "database": "PDB", "url": "https://www.rcsb.org/structure/1J86" }, { "id": "1J88", "database": "PDB", "url": "https://www.rcsb.org/structure/1J88" }, { "id": "8C1B", "database": "PDB", "url": "https://www.rcsb.org/structure/8C1B" }, { "id": "8K7R", "database": "PDB", "url": "https://www.rcsb.org/structure/8K7R" }, { "id": "8Z0T", "database": "PDB", "url": "https://www.rcsb.org/structure/8Z0T" } ], "filter_code": "001000000000000000000.00010000000000.00.01001", "uniprot_canonical_ac": "P12319-1" }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "icn3d_view": { "label": "iCn3D", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?bcifid=1F2Q&bu=0&command=select+.A:21;+center+selection;+zoom+selection" }, "start_pos": 46, "start_aa": "Asn", "end_pos": 46, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn46", "evidence": [ { "id": "P12319", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P12319#ptm_processing" }, { "id": "11531339", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/11531339" }, { "id": "10917520", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/10917520" }, { "id": "9875849", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/9875849" }, { "id": "1F2Q", "database": "PDB", "url": "https://www.rcsb.org/structure/1F2Q" }, { "id": "1J86", "database": "PDB", "url": "https://www.rcsb.org/structure/1J86" }, { "id": "1J88", "database": "PDB", "url": "https://www.rcsb.org/structure/1J88" }, { "id": "2Y7Q", "database": "PDB", "url": "https://www.rcsb.org/structure/2Y7Q" }, { "id": "8C1B", "database": "PDB", "url": "https://www.rcsb.org/structure/8C1B" }, { "id": "8Z0T", "database": "PDB", "url": "https://www.rcsb.org/structure/8Z0T" } ], "filter_code": "001000000000000000000.00010000000000.00.01000", "uniprot_canonical_ac": "P12319-1" }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "icn3d_view": { "label": "iCn3D", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?bcifid=7SHT&bu=0&command=select+.A:42;+center+selection;+zoom+selection" }, "start_pos": 67, "start_aa": "Asn", "end_pos": 67, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn67", "evidence": [ { "id": "P12319", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P12319#ptm_processing" }, { "id": "11531339", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/11531339" }, { "id": "10917520", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/10917520" }, { "id": "9875849", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/9875849" }, { "id": "7SHT", "database": "PDB", "url": "https://www.rcsb.org/structure/7SHT" } ], "filter_code": "001000000000000000000.00010000000000.00.01001", "uniprot_canonical_ac": "P12319-1" } ], "record_id": "pubmed.10917520", "abstract": "", "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 66 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 4 }, { "field": "total_sites", "count": 4 }, { "field": "n_linked_sites", "count": 4 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "exact_sites", "count": 4 }, { "field": "exact_n_linked_sites", "count": 4 }, { "field": "fuzzy_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "icn3d_view.label", "icn3d_view.url", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl", "mining_tool", "filter_code", "uniprot_canonical_ac" ] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 4 }, { "field": "total_sites", "count": 4 }, { "field": "n_linked_sites", "count": 4 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "exact_sites", "count": 4 }, { "field": "exact_n_linked_sites", "count": 4 }, { "field": "fuzzy_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "icn3d_view.label", "icn3d_view.url", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl", "mining_tool", "filter_code", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_sites", "count": 1 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "exact_sites", "count": 1 }, { "field": "exact_n_linked_sites", "count": 1 }, { "field": "fuzzy_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "icn3d_view.label", "icn3d_view.url", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl", "mining_tool", "filter_code", "uniprot_canonical_ac" ] } ] }, { "title": "Distinct pathways of mannan-binding lectin (MBL)- and C1-complex autoactivation revealed by reconstitution of MBL with recombinant MBL-associated serine protease-2.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "2000", "authors": "Vorup-Jensen T, Petersen SV, Hansen AG, Poulsen K, Schwaeble W, Sim RB, Reid KB, Davis SJ, Thiel S, Jensenius JC", "reference": { "type": "PubMed", "id": "10925294", "url": "https://pubmed.ncbi.nlm.nih.gov/10925294" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P01700-1", "protein_name": "Immunoglobulin lambda variable 1-47", "gene_name": "IGLV1-47", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01714-1", "protein_name": "Immunoglobulin lambda variable 3-19", "gene_name": "IGLV3-19", "tax_name": "Human" }, { "uniprot_canonical_ac": "P80748-1", "protein_name": "Immunoglobulin lambda variable 3-21", "gene_name": "IGLV3-21", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A075B6P5-1", "protein_name": "Immunoglobulin kappa variable 2-28", "gene_name": "IGKV2-28", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A075B6S6-1", "protein_name": "Immunoglobulin kappa variable 2D-30", "gene_name": "IGKV2D-30", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0C4DH25-1", "protein_name": "Immunoglobulin kappa variable 3D-20", "gene_name": "IGKV3D-20", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01593-1", "protein_name": "Immunoglobulin kappa variable 1D-33", "gene_name": "IGKV1D-33", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01599-1", "protein_name": "Immunoglobulin kappa variable 1-17", "gene_name": "IGKV1-17", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01601-1", "protein_name": "Immunoglobulin kappa variable 1D-16", "gene_name": "IGKV1D-16", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01611-1", "protein_name": "Immunoglobulin kappa variable 1D-12", "gene_name": "IGKV1D-12", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01615-1", "protein_name": "Immunoglobulin kappa variable 2D-28", "gene_name": "IGKV2D-28", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01619-1", "protein_name": "Immunoglobulin kappa variable 3-20", "gene_name": "IGKV3-20", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01624-1", "protein_name": "Immunoglobulin kappa variable 3-15", "gene_name": "IGKV3-15", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04433-1", "protein_name": "Immunoglobulin kappa variable 3-11", "gene_name": "IGKV3-11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01602-1", "protein_name": "Immunoglobulin kappa variable 1-5", "gene_name": "IGKV1-5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06681-1", "protein_name": "Complement C2", "gene_name": "C2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01767-1", "protein_name": "Immunoglobulin heavy variable 3-53", "gene_name": "IGHV3-53", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06331-1", "protein_name": "Immunoglobulin heavy variable 4-34", "gene_name": "IGHV4-34", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01597-1", "protein_name": "Immunoglobulin kappa variable 1-39", "gene_name": "IGKV1-39", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06310-1", "protein_name": "Immunoglobulin kappa variable 2-30", "gene_name": "IGKV2-30", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06312-1", "protein_name": "Immunoglobulin kappa variable 4-1", "gene_name": "IGKV4-1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01614-1", "protein_name": "Immunoglobulin kappa variable 2D-40", "gene_name": "IGKV2D-40", "tax_name": "Human" }, { "uniprot_canonical_ac": "P11226-1", "protein_name": "Mannose-binding protein C", "gene_name": "MBL2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y6Z7-1", "protein_name": "Collectin-10", "gene_name": "COLEC10", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DOY2-1", "protein_name": "Immunoglobulin lambda constant 2", "gene_name": "IGLC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P00736-1", "protein_name": "Complement C1r subcomponent", "gene_name": "C1R", "tax_name": "Human" }, { "uniprot_canonical_ac": "P09871-1", "protein_name": "Complement C1s subcomponent", "gene_name": "C1S", "tax_name": "Human" }, { "uniprot_canonical_ac": "P02747-1", "protein_name": "Complement C1q subcomponent subunit C", "gene_name": "C1QC", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0C0L5-1", "protein_name": "Complement C4-B", "gene_name": "C4B_2; C4B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0C0L4-1", "protein_name": "Complement C4-A", "gene_name": "C4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04432-1", "protein_name": "Immunoglobulin kappa variable 1D-39", "gene_name": "IGKV1D-39", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06315-1", "protein_name": "Immunoglobulin kappa variable 5-2", "gene_name": "IGKV5-2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01699-1", "protein_name": "Immunoglobulin lambda variable 1-44", "gene_name": "IGLV1-44", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01701-1", "protein_name": "Immunoglobulin lambda variable 1-51", "gene_name": "IGLV1-51", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01704-1", "protein_name": "Immunoglobulin lambda variable 2-14", "gene_name": "IGLV2-14", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01706-1", "protein_name": "Immunoglobulin lambda variable 2-11", "gene_name": "IGLV2-11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01709-1", "protein_name": "Immunoglobulin lambda variable 2-8", "gene_name": "IGLV2-8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01717-1", "protein_name": "Immunoglobulin lambda variable 3-25", "gene_name": "IGLV3-25", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01721-1", "protein_name": "Immunoglobulin lambda variable 6-57", "gene_name": "IGLV6-57", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01703-1", "protein_name": "Immunoglobulin lambda variable 1-40", "gene_name": "IGLV1-40", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01705-1", "protein_name": "Immunoglobulin lambda variable 2-23", "gene_name": "IGLV2-23", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01715-1", "protein_name": "Immunoglobulin lambda variable 3-1", "gene_name": "IGLV3-1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01718-1", "protein_name": "Immunoglobulin lambda variable 3-27", "gene_name": "IGLV3-27", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04211-1", "protein_name": "Immunoglobulin lambda variable 7-43", "gene_name": "IGLV7-43", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75636-1", "protein_name": "Ficolin-3", "gene_name": "FCN3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01860-2", "protein_name": "Immunoglobulin heavy constant gamma 3", "gene_name": "IGHG3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01861-2", "protein_name": "Immunoglobulin heavy constant gamma 4", "gene_name": "IGHG4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CF74-1", "protein_name": "Immunoglobulin lambda constant 6", "gene_name": "IGLC6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P48740-1", "protein_name": "Mannan-binding lectin serine protease 1", "gene_name": "MASP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BWP8-1", "protein_name": "Collectin-11", "gene_name": "COLEC11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P02746-1", "protein_name": "Complement C1q subcomponent subunit B", "gene_name": "C1QB", "tax_name": "Human" }, { "uniprot_canonical_ac": "P02745-1", "protein_name": "Complement C1q subcomponent subunit A", "gene_name": "C1QA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01825-1", "protein_name": "Immunoglobulin heavy variable 4-59", "gene_name": "IGHV4-59", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01817-1", "protein_name": "Immunoglobulin heavy variable 2-5", "gene_name": "IGHV2-5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01824-1", "protein_name": "Immunoglobulin heavy variable 4-39", "gene_name": "IGHV4-39", "tax_name": "Human" }, { "uniprot_canonical_ac": "P23083-1", "protein_name": "Immunoglobulin heavy variable 1-2", "gene_name": "IGHV1-2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01742-1", "protein_name": "Immunoglobulin heavy variable 1-69", "gene_name": "IGHV1-69", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01768-1", "protein_name": "Immunoglobulin heavy variable 3-30", "gene_name": "IGHV3-30", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01814-1", "protein_name": "Immunoglobulin heavy variable 2-70", "gene_name": "IGHV2-70", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01772-1", "protein_name": "Immunoglobulin heavy variable 3-33", "gene_name": "IGHV3-33", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01762-1", "protein_name": "Immunoglobulin heavy variable 3-11", "gene_name": "IGHV3-11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01763-1", "protein_name": "Immunoglobulin heavy variable 3-48", "gene_name": "IGHV3-48", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01764-1", "protein_name": "Immunoglobulin heavy variable 3-23", "gene_name": "IGHV3-23", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01766-1", "protein_name": "Immunoglobulin heavy variable 3-13", "gene_name": "IGHV3-13", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01780-1", "protein_name": "Immunoglobulin heavy variable 3-7", "gene_name": "IGHV3-7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01782-1", "protein_name": "Immunoglobulin heavy variable 3-9", "gene_name": "IGHV3-9", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0M8Q6-1", "protein_name": "Immunoglobulin lambda constant 7", "gene_name": "IGLC7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01834-1", "protein_name": "Immunoglobulin kappa constant", "gene_name": "IGKC", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01859-2", "protein_name": "Immunoglobulin heavy constant gamma 2", "gene_name": "IGHG2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG04-1", "protein_name": "Immunoglobulin lambda constant 1", "gene_name": "IGLC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DOY3-1", "protein_name": "Immunoglobulin lambda constant 3", "gene_name": "IGLC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01743-1", "protein_name": "Immunoglobulin heavy variable 1-46", "gene_name": "IGHV1-46", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0C4DH73-1", "protein_name": "Immunoglobulin kappa variable 1-12", "gene_name": "IGKV1-12", "tax_name": "Human" }, { "uniprot_canonical_ac": "A2NJV5-1", "protein_name": "Immunoglobulin kappa variable 2-29", "gene_name": "IGKV2-29", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01594-1", "protein_name": "Immunoglobulin kappa variable 1-33", "gene_name": "IGKV1-33", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04430-1", "protein_name": "Immunoglobulin kappa variable 1-16", "gene_name": "IGKV1-16", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01857-2", "protein_name": "Immunoglobulin heavy constant gamma 1", "gene_name": "IGHG1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00602-1", "protein_name": "Ficolin-1", "gene_name": "FCN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15485-1", "protein_name": "Ficolin-2", "gene_name": "FCN2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P01700", "url": "https://www.uniprot.org/uniprotkb/P01700" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.10925294", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 79 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Structural basis for discrimination of 3-phosphoinositides by pleckstrin homology domains.", "journal": "Molecular cell", "date": "2000", "authors": "Ferguson KM, Kavran JM, Sankaran VG, Fournier E, Isakoff SJ, Skolnik EY, Lemmon MA", "reference": { "type": "PubMed", "id": "10983984", "url": "https://pubmed.ncbi.nlm.nih.gov/10983984" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P01700-1", "protein_name": "Immunoglobulin lambda variable 1-47", "gene_name": "IGLV1-47", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01714-1", "protein_name": "Immunoglobulin lambda variable 3-19", "gene_name": "IGLV3-19", "tax_name": "Human" }, { "uniprot_canonical_ac": "P80748-1", "protein_name": "Immunoglobulin lambda variable 3-21", "gene_name": "IGLV3-21", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A075B6P5-1", "protein_name": "Immunoglobulin kappa variable 2-28", "gene_name": "IGKV2-28", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A075B6S6-1", "protein_name": "Immunoglobulin kappa variable 2D-30", "gene_name": "IGKV2D-30", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0C4DH25-1", "protein_name": "Immunoglobulin kappa variable 3D-20", "gene_name": "IGKV3D-20", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01593-1", "protein_name": "Immunoglobulin kappa variable 1D-33", "gene_name": "IGKV1D-33", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01599-1", "protein_name": "Immunoglobulin kappa variable 1-17", "gene_name": "IGKV1-17", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01601-1", "protein_name": "Immunoglobulin kappa variable 1D-16", "gene_name": "IGKV1D-16", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01611-1", "protein_name": "Immunoglobulin kappa variable 1D-12", "gene_name": "IGKV1D-12", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01615-1", "protein_name": "Immunoglobulin kappa variable 2D-28", "gene_name": "IGKV2D-28", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01619-1", "protein_name": "Immunoglobulin kappa variable 3-20", "gene_name": "IGKV3-20", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01624-1", "protein_name": "Immunoglobulin kappa variable 3-15", "gene_name": "IGKV3-15", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04433-1", "protein_name": "Immunoglobulin kappa variable 3-11", "gene_name": "IGKV3-11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01602-1", "protein_name": "Immunoglobulin kappa variable 1-5", "gene_name": "IGKV1-5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8WV28-1", "protein_name": "B-cell linker protein", "gene_name": "BLNK", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14643-1", "protein_name": "Inositol 1,4,5-trisphosphate-gated calcium channel ITPR1", "gene_name": "ITPR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UN19-1", "protein_name": "Dual adapter for phosphotyrosine and 3-phosphotyrosine and 3-phosphoinositide", "gene_name": "DAPP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P43405-1", "protein_name": "Tyrosine-protein kinase SYK", "gene_name": "SYK", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96SN7-1", "protein_name": "Protein orai-2", "gene_name": "ORAI2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P15391-1", "protein_name": "B-lymphocyte antigen CD19", "gene_name": "CD19", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01871-2", "protein_name": "Immunoglobulin heavy constant mu", "gene_name": "IGHM", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13586-1", "protein_name": "Stromal interaction molecule 1", "gene_name": "STIM1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01767-1", "protein_name": "Immunoglobulin heavy variable 3-53", "gene_name": "IGHV3-53", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06331-1", "protein_name": "Immunoglobulin heavy variable 4-34", "gene_name": "IGHV4-34", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14571-1", "protein_name": "Inositol 1,4,5-trisphosphate-gated calcium channel ITPR2", "gene_name": "ITPR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01597-1", "protein_name": "Immunoglobulin kappa variable 1-39", "gene_name": "IGKV1-39", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06310-1", "protein_name": "Immunoglobulin kappa variable 2-30", "gene_name": "IGKV2-30", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06312-1", "protein_name": "Immunoglobulin kappa variable 4-1", "gene_name": "IGKV4-1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01614-1", "protein_name": "Immunoglobulin kappa variable 2D-40", "gene_name": "IGKV2D-40", "tax_name": "Human" }, { "uniprot_canonical_ac": "P48995-1", "protein_name": "Short transient receptor potential channel 1", "gene_name": "TRPC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DOY2-1", "protein_name": "Immunoglobulin lambda constant 2", "gene_name": "IGLC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6ZUJ8-1", "protein_name": "Phosphoinositide 3-kinase adapter protein 1", "gene_name": "PIK3AP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96D31-1", "protein_name": "Calcium release-activated calcium channel protein 1", "gene_name": "ORAI1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DP23-1", "protein_name": "Calmodulin-1", "gene_name": "CALM1; CALM2; CALM3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P29350-1", "protein_name": "Tyrosine-protein phosphatase non-receptor type 6", "gene_name": "PTPN6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P20273-1", "protein_name": "B-cell receptor CD22", "gene_name": "CD22", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04432-1", "protein_name": "Immunoglobulin kappa variable 1D-39", "gene_name": "IGKV1D-39", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06315-1", "protein_name": "Immunoglobulin kappa variable 5-2", "gene_name": "IGKV5-2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01699-1", "protein_name": "Immunoglobulin lambda variable 1-44", "gene_name": "IGLV1-44", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01701-1", "protein_name": "Immunoglobulin lambda variable 1-51", "gene_name": "IGLV1-51", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01704-1", "protein_name": "Immunoglobulin lambda variable 2-14", "gene_name": "IGLV2-14", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01706-1", "protein_name": "Immunoglobulin lambda variable 2-11", "gene_name": "IGLV2-11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01709-1", "protein_name": "Immunoglobulin lambda variable 2-8", "gene_name": "IGLV2-8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01717-1", "protein_name": "Immunoglobulin lambda variable 3-25", "gene_name": "IGLV3-25", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01721-1", "protein_name": "Immunoglobulin lambda variable 6-57", "gene_name": "IGLV6-57", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01703-1", "protein_name": "Immunoglobulin lambda variable 1-40", "gene_name": "IGLV1-40", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01705-1", "protein_name": "Immunoglobulin lambda variable 2-23", "gene_name": "IGLV2-23", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01715-1", "protein_name": "Immunoglobulin lambda variable 3-1", "gene_name": "IGLV3-1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01718-1", "protein_name": "Immunoglobulin lambda variable 3-27", "gene_name": "IGLV3-27", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04211-1", "protein_name": "Immunoglobulin lambda variable 7-43", "gene_name": "IGLV7-43", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q07889-1", "protein_name": "Son of sevenless homolog 1", "gene_name": "SOS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O08967-1", "protein_name": "Cytohesin-3", "gene_name": "Cyth3", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "P01880-2", "protein_name": "Immunoglobulin heavy constant delta", "gene_name": "IGHD", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CF74-1", "protein_name": "Immunoglobulin lambda constant 6", "gene_name": "IGLC6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q06187-1", "protein_name": "Tyrosine-protein kinase BTK", "gene_name": "BTK", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96B97-1", "protein_name": "SH3 domain-containing kinase-binding protein 1", "gene_name": "SH3KBP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P07948-1", "protein_name": "Tyrosine-protein kinase Lyn", "gene_name": "LYN", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51451-1", "protein_name": "Tyrosine-protein kinase Blk", "gene_name": "BLK", "tax_name": "Human" }, { "uniprot_canonical_ac": "P16885-1", "protein_name": "1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-2", "gene_name": "PLCG2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43865-1", "protein_name": "S-adenosylhomocysteine hydrolase-like protein 1", "gene_name": "AHCYL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01825-1", "protein_name": "Immunoglobulin heavy variable 4-59", "gene_name": "IGHV4-59", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01817-1", "protein_name": "Immunoglobulin heavy variable 2-5", "gene_name": "IGHV2-5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01824-1", "protein_name": "Immunoglobulin heavy variable 4-39", "gene_name": "IGHV4-39", "tax_name": "Human" }, { "uniprot_canonical_ac": "P23083-1", "protein_name": "Immunoglobulin heavy variable 1-2", "gene_name": "IGHV1-2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00329-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit delta isoform", "gene_name": "PIK3CD", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01742-1", "protein_name": "Immunoglobulin heavy variable 1-69", "gene_name": "IGHV1-69", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01768-1", "protein_name": "Immunoglobulin heavy variable 3-30", "gene_name": "IGHV3-30", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01814-1", "protein_name": "Immunoglobulin heavy variable 2-70", "gene_name": "IGHV2-70", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01772-1", "protein_name": "Immunoglobulin heavy variable 3-33", "gene_name": "IGHV3-33", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01762-1", "protein_name": "Immunoglobulin heavy variable 3-11", "gene_name": "IGHV3-11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01763-1", "protein_name": "Immunoglobulin heavy variable 3-48", "gene_name": "IGHV3-48", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01764-1", "protein_name": "Immunoglobulin heavy variable 3-23", "gene_name": "IGHV3-23", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01766-1", "protein_name": "Immunoglobulin heavy variable 3-13", "gene_name": "IGHV3-13", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01780-1", "protein_name": "Immunoglobulin heavy variable 3-7", "gene_name": "IGHV3-7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01782-1", "protein_name": "Immunoglobulin heavy variable 3-9", "gene_name": "IGHV3-9", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0M8Q6-1", "protein_name": "Immunoglobulin lambda constant 7", "gene_name": "IGLC7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01834-1", "protein_name": "Immunoglobulin kappa constant", "gene_name": "IGKC", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG04-1", "protein_name": "Immunoglobulin lambda constant 1", "gene_name": "IGLC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DOY3-1", "protein_name": "Immunoglobulin lambda constant 3", "gene_name": "IGLC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P11912-1", "protein_name": "B-cell antigen receptor complex-associated protein alpha chain", "gene_name": "CD79A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P40259-1", "protein_name": "B-cell antigen receptor complex-associated protein beta chain", "gene_name": "CD79B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01743-1", "protein_name": "Immunoglobulin heavy variable 1-46", "gene_name": "IGHV1-46", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14573-1", "protein_name": "Inositol 1,4,5-trisphosphate-gated calcium channel ITPR3", "gene_name": "ITPR3", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0C4DH73-1", "protein_name": "Immunoglobulin kappa variable 1-12", "gene_name": "IGKV1-12", "tax_name": "Human" }, { "uniprot_canonical_ac": "A2NJV5-1", "protein_name": "Immunoglobulin kappa variable 2-29", "gene_name": "IGKV2-29", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01594-1", "protein_name": "Immunoglobulin kappa variable 1-33", "gene_name": "IGKV1-33", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04430-1", "protein_name": "Immunoglobulin kappa variable 1-16", "gene_name": "IGKV1-16", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27986-1", "protein_name": "Phosphatidylinositol 3-kinase regulatory subunit alpha", "gene_name": "PIK3R1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06241-1", "protein_name": "Tyrosine-protein kinase Fyn", "gene_name": "FYN", "tax_name": "Human" }, { "uniprot_canonical_ac": "P16333-1", "protein_name": "SH2/SH3 adapter protein NCK1", "gene_name": "NCK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P15498-1", "protein_name": "Proto-oncogene vav", "gene_name": "VAV1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P01700", "url": "https://www.uniprot.org/uniprotkb/P01700" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.10983984", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 92 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Calcineurin: form and function.", "journal": "Physiological reviews", "date": "2000", "authors": "Rusnak F, Mertz P", "reference": { "type": "PubMed", "id": "11015619", "url": "https://pubmed.ncbi.nlm.nih.gov/11015619" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P01700-1", "protein_name": "Immunoglobulin lambda variable 1-47", "gene_name": "IGLV1-47", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01714-1", "protein_name": "Immunoglobulin lambda variable 3-19", "gene_name": "IGLV3-19", "tax_name": "Human" }, { "uniprot_canonical_ac": "P80748-1", "protein_name": "Immunoglobulin lambda variable 3-21", "gene_name": "IGLV3-21", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A075B6P5-1", "protein_name": "Immunoglobulin kappa variable 2-28", "gene_name": "IGKV2-28", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A075B6S6-1", "protein_name": "Immunoglobulin kappa variable 2D-30", "gene_name": "IGKV2D-30", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0C4DH25-1", "protein_name": "Immunoglobulin kappa variable 3D-20", "gene_name": "IGKV3D-20", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01593-1", "protein_name": "Immunoglobulin kappa variable 1D-33", "gene_name": "IGKV1D-33", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01599-1", "protein_name": "Immunoglobulin kappa variable 1-17", "gene_name": "IGKV1-17", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01601-1", "protein_name": "Immunoglobulin kappa variable 1D-16", "gene_name": "IGKV1D-16", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01611-1", "protein_name": "Immunoglobulin kappa variable 1D-12", "gene_name": "IGKV1D-12", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01615-1", "protein_name": "Immunoglobulin kappa variable 2D-28", "gene_name": "IGKV2D-28", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01619-1", "protein_name": "Immunoglobulin kappa variable 3-20", "gene_name": "IGKV3-20", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01624-1", "protein_name": "Immunoglobulin kappa variable 3-15", "gene_name": "IGKV3-15", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04433-1", "protein_name": "Immunoglobulin kappa variable 3-11", "gene_name": "IGKV3-11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01602-1", "protein_name": "Immunoglobulin kappa variable 1-5", "gene_name": "IGKV1-5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14643-1", "protein_name": "Inositol 1,4,5-trisphosphate-gated calcium channel ITPR1", "gene_name": "ITPR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95644-1", "protein_name": "Nuclear factor of activated T-cells, cytoplasmic 1", "gene_name": "NFATC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P43405-1", "protein_name": "Tyrosine-protein kinase SYK", "gene_name": "SYK", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12968-1", "protein_name": "Nuclear factor of activated T-cells, cytoplasmic 3", "gene_name": "NFATC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13469-1", "protein_name": "Nuclear factor of activated T-cells, cytoplasmic 2", "gene_name": "NFATC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01362-1", "protein_name": "High affinity immunoglobulin epsilon receptor subunit beta", "gene_name": "MS4A2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P30273-1", "protein_name": "High affinity immunoglobulin epsilon receptor subunit gamma", "gene_name": "FCER1G", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01767-1", "protein_name": "Immunoglobulin heavy variable 3-53", "gene_name": "IGHV3-53", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06331-1", "protein_name": "Immunoglobulin heavy variable 4-34", "gene_name": "IGHV4-34", "tax_name": "Human" }, { "uniprot_canonical_ac": "P16298-1", "protein_name": "Serine/threonine-protein phosphatase 2B catalytic subunit beta isoform", "gene_name": "PPP3CB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14571-1", "protein_name": "Inositol 1,4,5-trisphosphate-gated calcium channel ITPR2", "gene_name": "ITPR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01597-1", "protein_name": "Immunoglobulin kappa variable 1-39", "gene_name": "IGKV1-39", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06310-1", "protein_name": "Immunoglobulin kappa variable 2-30", "gene_name": "IGKV2-30", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06312-1", "protein_name": "Immunoglobulin kappa variable 4-1", "gene_name": "IGKV4-1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01614-1", "protein_name": "Immunoglobulin kappa variable 2D-40", "gene_name": "IGKV2D-40", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DOY2-1", "protein_name": "Immunoglobulin lambda constant 2", "gene_name": "IGLC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75791-1", "protein_name": "GRB2-related adapter protein 2", "gene_name": "GRAP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DP23-1", "protein_name": "Calmodulin-1", "gene_name": "CALM1; CALM2; CALM3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04432-1", "protein_name": "Immunoglobulin kappa variable 1D-39", "gene_name": "IGKV1D-39", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06315-1", "protein_name": "Immunoglobulin kappa variable 5-2", "gene_name": "IGKV5-2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01699-1", "protein_name": "Immunoglobulin lambda variable 1-44", "gene_name": "IGLV1-44", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01701-1", "protein_name": "Immunoglobulin lambda variable 1-51", "gene_name": "IGLV1-51", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01704-1", "protein_name": "Immunoglobulin lambda variable 2-14", "gene_name": "IGLV2-14", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01706-1", "protein_name": "Immunoglobulin lambda variable 2-11", "gene_name": "IGLV2-11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01709-1", "protein_name": "Immunoglobulin lambda variable 2-8", "gene_name": "IGLV2-8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01717-1", "protein_name": "Immunoglobulin lambda variable 3-25", "gene_name": "IGLV3-25", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01721-1", "protein_name": "Immunoglobulin lambda variable 6-57", "gene_name": "IGLV6-57", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01703-1", "protein_name": "Immunoglobulin lambda variable 1-40", "gene_name": "IGLV1-40", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01705-1", "protein_name": "Immunoglobulin lambda variable 2-23", "gene_name": "IGLV2-23", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01715-1", "protein_name": "Immunoglobulin lambda variable 3-1", "gene_name": "IGLV3-1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01718-1", "protein_name": "Immunoglobulin lambda variable 3-27", "gene_name": "IGLV3-27", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04211-1", "protein_name": "Immunoglobulin lambda variable 7-43", "gene_name": "IGLV7-43", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q07889-1", "protein_name": "Son of sevenless homolog 1", "gene_name": "SOS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CF74-1", "protein_name": "Immunoglobulin lambda constant 6", "gene_name": "IGLC6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q06187-1", "protein_name": "Tyrosine-protein kinase BTK", "gene_name": "BTK", "tax_name": "Human" }, { "uniprot_canonical_ac": "P52735-1", "protein_name": "Guanine nucleotide exchange factor VAV2", "gene_name": "VAV2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P07948-1", "protein_name": "Tyrosine-protein kinase Lyn", "gene_name": "LYN", "tax_name": "Human" }, { "uniprot_canonical_ac": "P16885-1", "protein_name": "1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-2", "gene_name": "PLCG2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UKW4-1", "protein_name": "Guanine nucleotide exchange factor VAV3", "gene_name": "VAV3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42680-1", "protein_name": "Tyrosine-protein kinase Tec", "gene_name": "TEC", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43865-1", "protein_name": "S-adenosylhomocysteine hydrolase-like protein 1", "gene_name": "AHCYL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P63098-1", "protein_name": "Calcineurin subunit B type 1", "gene_name": "PPP3R1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q08209-1", "protein_name": "Protein phosphatase 3 catalytic subunit alpha", "gene_name": "PPP3CA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42681-1", "protein_name": "Tyrosine-protein kinase TXK", "gene_name": "TXK", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01825-1", "protein_name": "Immunoglobulin heavy variable 4-59", "gene_name": "IGHV4-59", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01817-1", "protein_name": "Immunoglobulin heavy variable 2-5", "gene_name": "IGHV2-5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01824-1", "protein_name": "Immunoglobulin heavy variable 4-39", "gene_name": "IGHV4-39", "tax_name": "Human" }, { "uniprot_canonical_ac": "P23083-1", "protein_name": "Immunoglobulin heavy variable 1-2", "gene_name": "IGHV1-2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01742-1", "protein_name": "Immunoglobulin heavy variable 1-69", "gene_name": "IGHV1-69", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01768-1", "protein_name": "Immunoglobulin heavy variable 3-30", "gene_name": "IGHV3-30", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01814-1", "protein_name": "Immunoglobulin heavy variable 2-70", "gene_name": "IGHV2-70", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01772-1", "protein_name": "Immunoglobulin heavy variable 3-33", "gene_name": "IGHV3-33", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01762-1", "protein_name": "Immunoglobulin heavy variable 3-11", "gene_name": "IGHV3-11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01763-1", "protein_name": "Immunoglobulin heavy variable 3-48", "gene_name": "IGHV3-48", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01764-1", "protein_name": "Immunoglobulin heavy variable 3-23", "gene_name": "IGHV3-23", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01766-1", "protein_name": "Immunoglobulin heavy variable 3-13", "gene_name": "IGHV3-13", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01780-1", "protein_name": "Immunoglobulin heavy variable 3-7", "gene_name": "IGHV3-7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01782-1", "protein_name": "Immunoglobulin heavy variable 3-9", "gene_name": "IGHV3-9", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0M8Q6-1", "protein_name": "Immunoglobulin lambda constant 7", "gene_name": "IGLC7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01834-1", "protein_name": "Immunoglobulin kappa constant", "gene_name": "IGKC", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG04-1", "protein_name": "Immunoglobulin lambda constant 1", "gene_name": "IGLC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DOY3-1", "protein_name": "Immunoglobulin lambda constant 3", "gene_name": "IGLC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13094-1", "protein_name": "Lymphocyte cytosolic protein 2", "gene_name": "LCP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01743-1", "protein_name": "Immunoglobulin heavy variable 1-46", "gene_name": "IGHV1-46", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01854-2", "protein_name": "Immunoglobulin heavy constant epsilon", "gene_name": "IGHE", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14573-1", "protein_name": "Inositol 1,4,5-trisphosphate-gated calcium channel ITPR3", "gene_name": "ITPR3", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0C4DH73-1", "protein_name": "Immunoglobulin kappa variable 1-12", "gene_name": "IGKV1-12", "tax_name": "Human" }, { "uniprot_canonical_ac": "A2NJV5-1", "protein_name": "Immunoglobulin kappa variable 2-29", "gene_name": "IGKV2-29", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01594-1", "protein_name": "Immunoglobulin kappa variable 1-33", "gene_name": "IGKV1-33", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04430-1", "protein_name": "Immunoglobulin kappa variable 1-16", "gene_name": "IGKV1-16", "tax_name": "Human" }, { "uniprot_canonical_ac": "P12319-1", "protein_name": "High affinity immunoglobulin epsilon receptor subunit alpha", "gene_name": "FCER1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q08881-1", "protein_name": "Tyrosine-protein kinase ITK/TSK", "gene_name": "ITK", "tax_name": "Human" }, { "uniprot_canonical_ac": "P19174-1", "protein_name": "1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-1", "gene_name": "PLCG1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P15498-1", "protein_name": "Proto-oncogene vav", "gene_name": "VAV1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P01700", "url": "https://www.uniprot.org/uniprotkb/P01700" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.11015619", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 89 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Cd19-dependent activation of Akt kinase in B-lymphocytes.", "journal": "The Journal of biological chemistry", "date": "2001", "authors": "Otero DC, Omori SA, Rickert RC", "reference": { "type": "PubMed", "id": "11042164", "url": "https://pubmed.ncbi.nlm.nih.gov/11042164" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P01700-1", "protein_name": "Immunoglobulin lambda variable 1-47", "gene_name": "IGLV1-47", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01714-1", "protein_name": "Immunoglobulin lambda variable 3-19", "gene_name": "IGLV3-19", "tax_name": "Human" }, { "uniprot_canonical_ac": "P80748-1", "protein_name": "Immunoglobulin lambda variable 3-21", "gene_name": "IGLV3-21", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A075B6P5-1", "protein_name": "Immunoglobulin kappa variable 2-28", "gene_name": "IGKV2-28", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A075B6S6-1", "protein_name": "Immunoglobulin kappa variable 2D-30", "gene_name": "IGKV2D-30", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0C4DH25-1", "protein_name": "Immunoglobulin kappa variable 3D-20", "gene_name": "IGKV3D-20", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01593-1", "protein_name": "Immunoglobulin kappa variable 1D-33", "gene_name": "IGKV1D-33", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01599-1", "protein_name": "Immunoglobulin kappa variable 1-17", "gene_name": "IGKV1-17", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01601-1", "protein_name": "Immunoglobulin kappa variable 1D-16", "gene_name": "IGKV1D-16", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01611-1", "protein_name": "Immunoglobulin kappa variable 1D-12", "gene_name": "IGKV1D-12", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01615-1", "protein_name": "Immunoglobulin kappa variable 2D-28", "gene_name": "IGKV2D-28", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01619-1", "protein_name": "Immunoglobulin kappa variable 3-20", "gene_name": "IGKV3-20", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01624-1", "protein_name": "Immunoglobulin kappa variable 3-15", "gene_name": "IGKV3-15", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04433-1", "protein_name": "Immunoglobulin kappa variable 3-11", "gene_name": "IGKV3-11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01602-1", "protein_name": "Immunoglobulin kappa variable 1-5", "gene_name": "IGKV1-5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8WV28-1", "protein_name": "B-cell linker protein", "gene_name": "BLNK", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14643-1", "protein_name": "Inositol 1,4,5-trisphosphate-gated calcium channel ITPR1", "gene_name": "ITPR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UN19-1", "protein_name": "Dual adapter for phosphotyrosine and 3-phosphotyrosine and 3-phosphoinositide", "gene_name": "DAPP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P43405-1", "protein_name": "Tyrosine-protein kinase SYK", "gene_name": "SYK", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96SN7-1", "protein_name": "Protein orai-2", "gene_name": "ORAI2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P15391-1", "protein_name": "B-lymphocyte antigen CD19", "gene_name": "CD19", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01871-2", "protein_name": "Immunoglobulin heavy constant mu", "gene_name": "IGHM", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13586-1", "protein_name": "Stromal interaction molecule 1", "gene_name": "STIM1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01767-1", "protein_name": "Immunoglobulin heavy variable 3-53", "gene_name": "IGHV3-53", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06331-1", "protein_name": "Immunoglobulin heavy variable 4-34", "gene_name": "IGHV4-34", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14571-1", "protein_name": "Inositol 1,4,5-trisphosphate-gated calcium channel ITPR2", "gene_name": "ITPR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01597-1", "protein_name": "Immunoglobulin kappa variable 1-39", "gene_name": "IGKV1-39", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06310-1", "protein_name": "Immunoglobulin kappa variable 2-30", "gene_name": "IGKV2-30", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06312-1", "protein_name": "Immunoglobulin kappa variable 4-1", "gene_name": "IGKV4-1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01614-1", "protein_name": "Immunoglobulin kappa variable 2D-40", "gene_name": "IGKV2D-40", "tax_name": "Human" }, { "uniprot_canonical_ac": "P48995-1", "protein_name": "Short transient receptor potential channel 1", "gene_name": "TRPC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DOY2-1", "protein_name": "Immunoglobulin lambda constant 2", "gene_name": "IGLC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6ZUJ8-1", "protein_name": "Phosphoinositide 3-kinase adapter protein 1", "gene_name": "PIK3AP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96D31-1", "protein_name": "Calcium release-activated calcium channel protein 1", "gene_name": "ORAI1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DP23-1", "protein_name": "Calmodulin-1", "gene_name": "CALM1; CALM2; CALM3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P29350-1", "protein_name": "Tyrosine-protein phosphatase non-receptor type 6", "gene_name": "PTPN6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P20273-1", "protein_name": "B-cell receptor CD22", "gene_name": "CD22", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04432-1", "protein_name": "Immunoglobulin kappa variable 1D-39", "gene_name": "IGKV1D-39", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06315-1", "protein_name": "Immunoglobulin kappa variable 5-2", "gene_name": "IGKV5-2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01699-1", "protein_name": "Immunoglobulin lambda variable 1-44", "gene_name": "IGLV1-44", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01701-1", "protein_name": "Immunoglobulin lambda variable 1-51", "gene_name": "IGLV1-51", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01704-1", "protein_name": "Immunoglobulin lambda variable 2-14", "gene_name": "IGLV2-14", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01706-1", "protein_name": "Immunoglobulin lambda variable 2-11", "gene_name": "IGLV2-11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01709-1", "protein_name": "Immunoglobulin lambda variable 2-8", "gene_name": "IGLV2-8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01717-1", "protein_name": "Immunoglobulin lambda variable 3-25", "gene_name": "IGLV3-25", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01721-1", "protein_name": "Immunoglobulin lambda variable 6-57", "gene_name": "IGLV6-57", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01703-1", "protein_name": "Immunoglobulin lambda variable 1-40", "gene_name": "IGLV1-40", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01705-1", "protein_name": "Immunoglobulin lambda variable 2-23", "gene_name": "IGLV2-23", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01715-1", "protein_name": "Immunoglobulin lambda variable 3-1", "gene_name": "IGLV3-1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01718-1", "protein_name": "Immunoglobulin lambda variable 3-27", "gene_name": "IGLV3-27", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04211-1", "protein_name": "Immunoglobulin lambda variable 7-43", "gene_name": "IGLV7-43", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q07889-1", "protein_name": "Son of sevenless homolog 1", "gene_name": "SOS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01880-2", "protein_name": "Immunoglobulin heavy constant delta", "gene_name": "IGHD", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CF74-1", "protein_name": "Immunoglobulin lambda constant 6", "gene_name": "IGLC6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q06187-1", "protein_name": "Tyrosine-protein kinase BTK", "gene_name": "BTK", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96B97-1", "protein_name": "SH3 domain-containing kinase-binding protein 1", "gene_name": "SH3KBP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P07948-1", "protein_name": "Tyrosine-protein kinase Lyn", "gene_name": "LYN", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51451-1", "protein_name": "Tyrosine-protein kinase Blk", "gene_name": "BLK", "tax_name": "Human" }, { "uniprot_canonical_ac": "P16885-1", "protein_name": "1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-2", "gene_name": "PLCG2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43865-1", "protein_name": "S-adenosylhomocysteine hydrolase-like protein 1", "gene_name": "AHCYL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01825-1", "protein_name": "Immunoglobulin heavy variable 4-59", "gene_name": "IGHV4-59", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01817-1", "protein_name": "Immunoglobulin heavy variable 2-5", "gene_name": "IGHV2-5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01824-1", "protein_name": "Immunoglobulin heavy variable 4-39", "gene_name": "IGHV4-39", "tax_name": "Human" }, { "uniprot_canonical_ac": "P23083-1", "protein_name": "Immunoglobulin heavy variable 1-2", "gene_name": "IGHV1-2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00329-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit delta isoform", "gene_name": "PIK3CD", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01742-1", "protein_name": "Immunoglobulin heavy variable 1-69", "gene_name": "IGHV1-69", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01768-1", "protein_name": "Immunoglobulin heavy variable 3-30", "gene_name": "IGHV3-30", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01814-1", "protein_name": "Immunoglobulin heavy variable 2-70", "gene_name": "IGHV2-70", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01772-1", "protein_name": "Immunoglobulin heavy variable 3-33", "gene_name": "IGHV3-33", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01762-1", "protein_name": "Immunoglobulin heavy variable 3-11", "gene_name": "IGHV3-11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01763-1", "protein_name": "Immunoglobulin heavy variable 3-48", "gene_name": "IGHV3-48", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01764-1", "protein_name": "Immunoglobulin heavy variable 3-23", "gene_name": "IGHV3-23", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01766-1", "protein_name": "Immunoglobulin heavy variable 3-13", "gene_name": "IGHV3-13", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01780-1", "protein_name": "Immunoglobulin heavy variable 3-7", "gene_name": "IGHV3-7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01782-1", "protein_name": "Immunoglobulin heavy variable 3-9", "gene_name": "IGHV3-9", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0M8Q6-1", "protein_name": "Immunoglobulin lambda constant 7", "gene_name": "IGLC7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01834-1", "protein_name": "Immunoglobulin kappa constant", "gene_name": "IGKC", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG04-1", "protein_name": "Immunoglobulin lambda constant 1", "gene_name": "IGLC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DOY3-1", "protein_name": "Immunoglobulin lambda constant 3", "gene_name": "IGLC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P11912-1", "protein_name": "B-cell antigen receptor complex-associated protein alpha chain", "gene_name": "CD79A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P40259-1", "protein_name": "B-cell antigen receptor complex-associated protein beta chain", "gene_name": "CD79B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01743-1", "protein_name": "Immunoglobulin heavy variable 1-46", "gene_name": "IGHV1-46", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14573-1", "protein_name": "Inositol 1,4,5-trisphosphate-gated calcium channel ITPR3", "gene_name": "ITPR3", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0C4DH73-1", "protein_name": "Immunoglobulin kappa variable 1-12", "gene_name": "IGKV1-12", "tax_name": "Human" }, { "uniprot_canonical_ac": "A2NJV5-1", "protein_name": "Immunoglobulin kappa variable 2-29", "gene_name": "IGKV2-29", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01594-1", "protein_name": "Immunoglobulin kappa variable 1-33", "gene_name": "IGKV1-33", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04430-1", "protein_name": "Immunoglobulin kappa variable 1-16", "gene_name": "IGKV1-16", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27986-1", "protein_name": "Phosphatidylinositol 3-kinase regulatory subunit alpha", "gene_name": "PIK3R1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06241-1", "protein_name": "Tyrosine-protein kinase Fyn", "gene_name": "FYN", "tax_name": "Human" }, { "uniprot_canonical_ac": "P16333-1", "protein_name": "SH2/SH3 adapter protein NCK1", "gene_name": "NCK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P15498-1", "protein_name": "Proto-oncogene vav", "gene_name": "VAV1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P01700", "url": "https://www.uniprot.org/uniprotkb/P01700" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.11042164", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 91 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Characterization of the CIN85 adaptor protein and identification of components involved in CIN85 complexes.", "journal": "Biochemical and biophysical research communications", "date": "2000", "authors": "Watanabe S, Take H, Takeda K, Yu ZX, Iwata N, Kajigaya S", "reference": { "type": "PubMed", "id": "11071869", "url": "https://pubmed.ncbi.nlm.nih.gov/11071869" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P01700-1", "protein_name": "Immunoglobulin lambda variable 1-47", "gene_name": "IGLV1-47", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01714-1", "protein_name": "Immunoglobulin lambda variable 3-19", "gene_name": "IGLV3-19", "tax_name": "Human" }, { "uniprot_canonical_ac": "P80748-1", "protein_name": "Immunoglobulin lambda variable 3-21", "gene_name": "IGLV3-21", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A075B6P5-1", "protein_name": "Immunoglobulin kappa variable 2-28", "gene_name": "IGKV2-28", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A075B6S6-1", "protein_name": "Immunoglobulin kappa variable 2D-30", "gene_name": "IGKV2D-30", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0C4DH25-1", "protein_name": "Immunoglobulin kappa variable 3D-20", "gene_name": "IGKV3D-20", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01593-1", "protein_name": "Immunoglobulin kappa variable 1D-33", "gene_name": "IGKV1D-33", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01599-1", "protein_name": "Immunoglobulin kappa variable 1-17", "gene_name": "IGKV1-17", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01601-1", "protein_name": "Immunoglobulin kappa variable 1D-16", "gene_name": "IGKV1D-16", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01611-1", "protein_name": "Immunoglobulin kappa variable 1D-12", "gene_name": "IGKV1D-12", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01615-1", "protein_name": "Immunoglobulin kappa variable 2D-28", "gene_name": "IGKV2D-28", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01619-1", "protein_name": "Immunoglobulin kappa variable 3-20", "gene_name": "IGKV3-20", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01624-1", "protein_name": "Immunoglobulin kappa variable 3-15", "gene_name": "IGKV3-15", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04433-1", "protein_name": "Immunoglobulin kappa variable 3-11", "gene_name": "IGKV3-11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01602-1", "protein_name": "Immunoglobulin kappa variable 1-5", "gene_name": "IGKV1-5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8WV28-1", "protein_name": "B-cell linker protein", "gene_name": "BLNK", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14643-1", "protein_name": "Inositol 1,4,5-trisphosphate-gated calcium channel ITPR1", "gene_name": "ITPR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UN19-1", "protein_name": "Dual adapter for phosphotyrosine and 3-phosphotyrosine and 3-phosphoinositide", "gene_name": "DAPP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P43405-1", "protein_name": "Tyrosine-protein kinase SYK", "gene_name": "SYK", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96SN7-1", "protein_name": "Protein orai-2", "gene_name": "ORAI2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P15391-1", "protein_name": "B-lymphocyte antigen CD19", "gene_name": "CD19", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01871-2", "protein_name": "Immunoglobulin heavy constant mu", "gene_name": "IGHM", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13586-1", "protein_name": "Stromal interaction molecule 1", "gene_name": "STIM1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01767-1", "protein_name": "Immunoglobulin heavy variable 3-53", "gene_name": "IGHV3-53", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06331-1", "protein_name": "Immunoglobulin heavy variable 4-34", "gene_name": "IGHV4-34", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14571-1", "protein_name": "Inositol 1,4,5-trisphosphate-gated calcium channel ITPR2", "gene_name": "ITPR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01597-1", "protein_name": "Immunoglobulin kappa variable 1-39", "gene_name": "IGKV1-39", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06310-1", "protein_name": "Immunoglobulin kappa variable 2-30", "gene_name": "IGKV2-30", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06312-1", "protein_name": "Immunoglobulin kappa variable 4-1", "gene_name": "IGKV4-1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01614-1", "protein_name": "Immunoglobulin kappa variable 2D-40", "gene_name": "IGKV2D-40", "tax_name": "Human" }, { "uniprot_canonical_ac": "P48995-1", "protein_name": "Short transient receptor potential channel 1", "gene_name": "TRPC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DOY2-1", "protein_name": "Immunoglobulin lambda constant 2", "gene_name": "IGLC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6ZUJ8-1", "protein_name": "Phosphoinositide 3-kinase adapter protein 1", "gene_name": "PIK3AP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96D31-1", "protein_name": "Calcium release-activated calcium channel protein 1", "gene_name": "ORAI1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DP23-1", "protein_name": "Calmodulin-1", "gene_name": "CALM1; CALM2; CALM3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P29350-1", "protein_name": "Tyrosine-protein phosphatase non-receptor type 6", "gene_name": "PTPN6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P20273-1", "protein_name": "B-cell receptor CD22", "gene_name": "CD22", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04432-1", "protein_name": "Immunoglobulin kappa variable 1D-39", "gene_name": "IGKV1D-39", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06315-1", "protein_name": "Immunoglobulin kappa variable 5-2", "gene_name": "IGKV5-2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01699-1", "protein_name": "Immunoglobulin lambda variable 1-44", "gene_name": "IGLV1-44", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01701-1", "protein_name": "Immunoglobulin lambda variable 1-51", "gene_name": "IGLV1-51", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01704-1", "protein_name": "Immunoglobulin lambda variable 2-14", "gene_name": "IGLV2-14", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01706-1", "protein_name": "Immunoglobulin lambda variable 2-11", "gene_name": "IGLV2-11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01709-1", "protein_name": "Immunoglobulin lambda variable 2-8", "gene_name": "IGLV2-8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01717-1", "protein_name": "Immunoglobulin lambda variable 3-25", "gene_name": "IGLV3-25", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01721-1", "protein_name": "Immunoglobulin lambda variable 6-57", "gene_name": "IGLV6-57", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01703-1", "protein_name": "Immunoglobulin lambda variable 1-40", "gene_name": "IGLV1-40", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01705-1", "protein_name": "Immunoglobulin lambda variable 2-23", "gene_name": "IGLV2-23", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01715-1", "protein_name": "Immunoglobulin lambda variable 3-1", "gene_name": "IGLV3-1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01718-1", "protein_name": "Immunoglobulin lambda variable 3-27", "gene_name": "IGLV3-27", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04211-1", "protein_name": "Immunoglobulin lambda variable 7-43", "gene_name": "IGLV7-43", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q07889-1", "protein_name": "Son of sevenless homolog 1", "gene_name": "SOS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01880-2", "protein_name": "Immunoglobulin heavy constant delta", "gene_name": "IGHD", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CF74-1", "protein_name": "Immunoglobulin lambda constant 6", "gene_name": "IGLC6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q06187-1", "protein_name": "Tyrosine-protein kinase BTK", "gene_name": "BTK", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96B97-1", "protein_name": "SH3 domain-containing kinase-binding protein 1", "gene_name": "SH3KBP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P07948-1", "protein_name": "Tyrosine-protein kinase Lyn", "gene_name": "LYN", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51451-1", "protein_name": "Tyrosine-protein kinase Blk", "gene_name": "BLK", "tax_name": "Human" }, { "uniprot_canonical_ac": "P16885-1", "protein_name": "1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-2", "gene_name": "PLCG2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43865-1", "protein_name": "S-adenosylhomocysteine hydrolase-like protein 1", "gene_name": "AHCYL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01825-1", "protein_name": "Immunoglobulin heavy variable 4-59", "gene_name": "IGHV4-59", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01817-1", "protein_name": "Immunoglobulin heavy variable 2-5", "gene_name": "IGHV2-5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01824-1", "protein_name": "Immunoglobulin heavy variable 4-39", "gene_name": "IGHV4-39", "tax_name": "Human" }, { "uniprot_canonical_ac": "P23083-1", "protein_name": "Immunoglobulin heavy variable 1-2", "gene_name": "IGHV1-2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00329-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit delta isoform", "gene_name": "PIK3CD", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01742-1", "protein_name": "Immunoglobulin heavy variable 1-69", "gene_name": "IGHV1-69", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01768-1", "protein_name": "Immunoglobulin heavy variable 3-30", "gene_name": "IGHV3-30", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01814-1", "protein_name": "Immunoglobulin heavy variable 2-70", "gene_name": "IGHV2-70", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01772-1", "protein_name": "Immunoglobulin heavy variable 3-33", "gene_name": "IGHV3-33", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01762-1", "protein_name": "Immunoglobulin heavy variable 3-11", "gene_name": "IGHV3-11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01763-1", "protein_name": "Immunoglobulin heavy variable 3-48", "gene_name": "IGHV3-48", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01764-1", "protein_name": "Immunoglobulin heavy variable 3-23", "gene_name": "IGHV3-23", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01766-1", "protein_name": "Immunoglobulin heavy variable 3-13", "gene_name": "IGHV3-13", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01780-1", "protein_name": "Immunoglobulin heavy variable 3-7", "gene_name": "IGHV3-7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01782-1", "protein_name": "Immunoglobulin heavy variable 3-9", "gene_name": "IGHV3-9", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0M8Q6-1", "protein_name": "Immunoglobulin lambda constant 7", "gene_name": "IGLC7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01834-1", "protein_name": "Immunoglobulin kappa constant", "gene_name": "IGKC", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG04-1", "protein_name": "Immunoglobulin lambda constant 1", "gene_name": "IGLC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DOY3-1", "protein_name": "Immunoglobulin lambda constant 3", "gene_name": "IGLC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P11912-1", "protein_name": "B-cell antigen receptor complex-associated protein alpha chain", "gene_name": "CD79A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P40259-1", "protein_name": "B-cell antigen receptor complex-associated protein beta chain", "gene_name": "CD79B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01743-1", "protein_name": "Immunoglobulin heavy variable 1-46", "gene_name": "IGHV1-46", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14573-1", "protein_name": "Inositol 1,4,5-trisphosphate-gated calcium channel ITPR3", "gene_name": "ITPR3", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0C4DH73-1", "protein_name": "Immunoglobulin kappa variable 1-12", "gene_name": "IGKV1-12", "tax_name": "Human" }, { "uniprot_canonical_ac": "A2NJV5-1", "protein_name": "Immunoglobulin kappa variable 2-29", "gene_name": "IGKV2-29", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01594-1", "protein_name": "Immunoglobulin kappa variable 1-33", "gene_name": "IGKV1-33", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04430-1", "protein_name": "Immunoglobulin kappa variable 1-16", "gene_name": "IGKV1-16", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27986-1", "protein_name": "Phosphatidylinositol 3-kinase regulatory subunit alpha", "gene_name": "PIK3R1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06241-1", "protein_name": "Tyrosine-protein kinase Fyn", "gene_name": "FYN", "tax_name": "Human" }, { "uniprot_canonical_ac": "P16333-1", "protein_name": "SH2/SH3 adapter protein NCK1", "gene_name": "NCK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P15498-1", "protein_name": "Proto-oncogene vav", "gene_name": "VAV1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P01700", "url": "https://www.uniprot.org/uniprotkb/P01700" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.11071869", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 91 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Identification of the haemoglobin scavenger receptor.", "journal": "Nature", "date": "2001", "authors": "Kristiansen M, Graversen JH, Jacobsen C, Sonne O, Hoffman HJ, Law SK, Moestrup SK", "reference": { "type": "PubMed", "id": "11196644", "url": "https://pubmed.ncbi.nlm.nih.gov/11196644" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P01700-1", "protein_name": "Immunoglobulin lambda variable 1-47", "gene_name": "IGLV1-47", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01714-1", "protein_name": "Immunoglobulin lambda variable 3-19", "gene_name": "IGLV3-19", "tax_name": "Human" }, { "uniprot_canonical_ac": "P80748-1", "protein_name": "Immunoglobulin lambda variable 3-21", "gene_name": "IGLV3-21", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A075B6P5-1", "protein_name": "Immunoglobulin kappa variable 2-28", "gene_name": "IGKV2-28", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A075B6S6-1", "protein_name": "Immunoglobulin kappa variable 2D-30", "gene_name": "IGKV2D-30", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0C4DH25-1", "protein_name": "Immunoglobulin kappa variable 3D-20", "gene_name": "IGKV3D-20", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01593-1", "protein_name": "Immunoglobulin kappa variable 1D-33", "gene_name": "IGKV1D-33", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01599-1", "protein_name": "Immunoglobulin kappa variable 1-17", "gene_name": "IGKV1-17", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01601-1", "protein_name": "Immunoglobulin kappa variable 1D-16", "gene_name": "IGKV1D-16", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01611-1", "protein_name": "Immunoglobulin kappa variable 1D-12", "gene_name": "IGKV1D-12", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01615-1", "protein_name": "Immunoglobulin kappa variable 2D-28", "gene_name": "IGKV2D-28", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01619-1", "protein_name": "Immunoglobulin kappa variable 3-20", "gene_name": "IGKV3-20", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01624-1", "protein_name": "Immunoglobulin kappa variable 3-15", "gene_name": "IGKV3-15", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04433-1", "protein_name": "Immunoglobulin kappa variable 3-11", "gene_name": "IGKV3-11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01602-1", "protein_name": "Immunoglobulin kappa variable 1-5", "gene_name": "IGKV1-5", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14791-1", "protein_name": "Apolipoprotein L1", "gene_name": "APOL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P02760-1", "protein_name": "Protein AMBP", "gene_name": "AMBP", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q07954-1", "protein_name": "Prolow-density lipoprotein receptor-related protein 1", "gene_name": "LRP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P00739-1", "protein_name": "Haptoglobin-related protein", "gene_name": "HPR", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01767-1", "protein_name": "Immunoglobulin heavy variable 3-53", "gene_name": "IGHV3-53", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06331-1", "protein_name": "Immunoglobulin heavy variable 4-34", "gene_name": "IGHV4-34", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01597-1", "protein_name": "Immunoglobulin kappa variable 1-39", "gene_name": "IGKV1-39", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06310-1", "protein_name": "Immunoglobulin kappa variable 2-30", "gene_name": "IGKV2-30", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06312-1", "protein_name": "Immunoglobulin kappa variable 4-1", "gene_name": "IGKV4-1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01614-1", "protein_name": "Immunoglobulin kappa variable 2D-40", "gene_name": "IGKV2D-40", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DOY2-1", "protein_name": "Immunoglobulin lambda constant 2", "gene_name": "IGLC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86VB7-1", "protein_name": "Scavenger receptor cysteine-rich type 1 protein M130", "gene_name": "CD163", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04432-1", "protein_name": "Immunoglobulin kappa variable 1D-39", "gene_name": "IGKV1D-39", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06315-1", "protein_name": "Immunoglobulin kappa variable 5-2", "gene_name": "IGKV5-2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01699-1", "protein_name": "Immunoglobulin lambda variable 1-44", "gene_name": "IGLV1-44", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01701-1", "protein_name": "Immunoglobulin lambda variable 1-51", "gene_name": "IGLV1-51", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01704-1", "protein_name": "Immunoglobulin lambda variable 2-14", "gene_name": "IGLV2-14", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01706-1", "protein_name": "Immunoglobulin lambda variable 2-11", "gene_name": "IGLV2-11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01709-1", "protein_name": "Immunoglobulin lambda variable 2-8", "gene_name": "IGLV2-8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01717-1", "protein_name": "Immunoglobulin lambda variable 3-25", "gene_name": "IGLV3-25", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01721-1", "protein_name": "Immunoglobulin lambda variable 6-57", "gene_name": "IGLV6-57", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01703-1", "protein_name": "Immunoglobulin lambda variable 1-40", "gene_name": "IGLV1-40", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01705-1", "protein_name": "Immunoglobulin lambda variable 2-23", "gene_name": "IGLV2-23", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01715-1", "protein_name": "Immunoglobulin lambda variable 3-1", "gene_name": "IGLV3-1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01718-1", "protein_name": "Immunoglobulin lambda variable 3-27", "gene_name": "IGLV3-27", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04211-1", "protein_name": "Immunoglobulin lambda variable 7-43", "gene_name": "IGLV7-43", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01876-2", "protein_name": "Immunoglobulin heavy constant alpha 1", "gene_name": "IGHA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CF74-1", "protein_name": "Immunoglobulin lambda constant 6", "gene_name": "IGLC6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P69905-1", "protein_name": "Hemoglobin subunit alpha", "gene_name": "HBA1; HBA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P02768-1", "protein_name": "Albumin", "gene_name": "ALB", "tax_name": "Human" }, { "uniprot_canonical_ac": "P00738-1", "protein_name": "Haptoglobin", "gene_name": "HP", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01825-1", "protein_name": "Immunoglobulin heavy variable 4-59", "gene_name": "IGHV4-59", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01817-1", "protein_name": "Immunoglobulin heavy variable 2-5", "gene_name": "IGHV2-5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01824-1", "protein_name": "Immunoglobulin heavy variable 4-39", "gene_name": "IGHV4-39", "tax_name": "Human" }, { "uniprot_canonical_ac": "P23083-1", "protein_name": "Immunoglobulin heavy variable 1-2", "gene_name": "IGHV1-2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68871-1", "protein_name": "Hemoglobin subunit beta", "gene_name": "HBB", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01742-1", "protein_name": "Immunoglobulin heavy variable 1-69", "gene_name": "IGHV1-69", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01768-1", "protein_name": "Immunoglobulin heavy variable 3-30", "gene_name": "IGHV3-30", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01814-1", "protein_name": "Immunoglobulin heavy variable 2-70", "gene_name": "IGHV2-70", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01772-1", "protein_name": "Immunoglobulin heavy variable 3-33", "gene_name": "IGHV3-33", "tax_name": "Human" }, { "uniprot_canonical_ac": "P02790-1", "protein_name": "Hemopexin", "gene_name": "HPX", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01762-1", "protein_name": "Immunoglobulin heavy variable 3-11", "gene_name": "IGHV3-11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01763-1", "protein_name": "Immunoglobulin heavy variable 3-48", "gene_name": "IGHV3-48", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01764-1", "protein_name": "Immunoglobulin heavy variable 3-23", "gene_name": "IGHV3-23", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01766-1", "protein_name": "Immunoglobulin heavy variable 3-13", "gene_name": "IGHV3-13", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01780-1", "protein_name": "Immunoglobulin heavy variable 3-7", "gene_name": "IGHV3-7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01782-1", "protein_name": "Immunoglobulin heavy variable 3-9", "gene_name": "IGHV3-9", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01877-2", "protein_name": "Immunoglobulin heavy constant alpha 2", "gene_name": "IGHA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01591-1", "protein_name": "Immunoglobulin J chain", "gene_name": "JCHAIN", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0M8Q6-1", "protein_name": "Immunoglobulin lambda constant 7", "gene_name": "IGLC7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01834-1", "protein_name": "Immunoglobulin kappa constant", "gene_name": "IGKC", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG04-1", "protein_name": "Immunoglobulin lambda constant 1", "gene_name": "IGLC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DOY3-1", "protein_name": "Immunoglobulin lambda constant 3", "gene_name": "IGLC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01743-1", "protein_name": "Immunoglobulin heavy variable 1-46", "gene_name": "IGHV1-46", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0C4DH73-1", "protein_name": "Immunoglobulin kappa variable 1-12", "gene_name": "IGKV1-12", "tax_name": "Human" }, { "uniprot_canonical_ac": "A2NJV5-1", "protein_name": "Immunoglobulin kappa variable 2-29", "gene_name": "IGKV2-29", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01594-1", "protein_name": "Immunoglobulin kappa variable 1-33", "gene_name": "IGKV1-33", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04430-1", "protein_name": "Immunoglobulin kappa variable 1-16", "gene_name": "IGKV1-16", "tax_name": "Human" }, { "uniprot_canonical_ac": "P02647-1", "protein_name": "Apolipoprotein A-I", "gene_name": "APOA1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P01700", "url": "https://www.uniprot.org/uniprotkb/P01700" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.11196644", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 74 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Molecular analysis of neisserial Opa protein interactions with the CEA family of receptors: identification of determinants contributing to the differential specificities of binding.", "journal": "Cellular microbiology", "date": "1999", "authors": "Popp A, Dehio C, Grunert F, Meyer TF, Gray-Owen SD", "reference": { "type": "PubMed", "id": "11207550", "url": "https://pubmed.ncbi.nlm.nih.gov/11207550" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P01700-1", "protein_name": "Immunoglobulin lambda variable 1-47", "gene_name": "IGLV1-47", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01714-1", "protein_name": "Immunoglobulin lambda variable 3-19", "gene_name": "IGLV3-19", "tax_name": "Human" }, { "uniprot_canonical_ac": "P80748-1", "protein_name": "Immunoglobulin lambda variable 3-21", "gene_name": "IGLV3-21", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A075B6P5-1", "protein_name": "Immunoglobulin kappa variable 2-28", "gene_name": "IGKV2-28", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A075B6S6-1", "protein_name": "Immunoglobulin kappa variable 2D-30", "gene_name": "IGKV2D-30", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0C4DH25-1", "protein_name": "Immunoglobulin kappa variable 3D-20", "gene_name": "IGKV3D-20", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01593-1", "protein_name": "Immunoglobulin kappa variable 1D-33", "gene_name": "IGKV1D-33", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01599-1", "protein_name": "Immunoglobulin kappa variable 1-17", "gene_name": "IGKV1-17", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01601-1", "protein_name": "Immunoglobulin kappa variable 1D-16", "gene_name": "IGKV1D-16", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01611-1", "protein_name": "Immunoglobulin kappa variable 1D-12", "gene_name": "IGKV1D-12", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01615-1", "protein_name": "Immunoglobulin kappa variable 2D-28", "gene_name": "IGKV2D-28", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01619-1", "protein_name": "Immunoglobulin kappa variable 3-20", "gene_name": "IGKV3-20", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01624-1", "protein_name": "Immunoglobulin kappa variable 3-15", "gene_name": "IGKV3-15", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04433-1", "protein_name": "Immunoglobulin kappa variable 3-11", "gene_name": "IGKV3-11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01602-1", "protein_name": "Immunoglobulin kappa variable 1-5", "gene_name": "IGKV1-5", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75056-1", "protein_name": "Syndecan-3", "gene_name": "SDC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P07204-1", "protein_name": "Thrombomodulin", "gene_name": "THBD", "tax_name": "Human" }, { "uniprot_canonical_ac": "P00734-1", "protein_name": "Prothrombin", "gene_name": "F2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P02452-1", "protein_name": "Collagen alpha-1(I) chain", "gene_name": "COL1A1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04114-1", "protein_name": "Apolipoprotein B-100", "gene_name": "APOB", "tax_name": "Human" }, { "uniprot_canonical_ac": "P02751-15", "protein_name": "Fibronectin", "gene_name": "FN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00220-1", "protein_name": "Tumor necrosis factor receptor superfamily member 10A", "gene_name": "TNFRSF10A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P14209-1", "protein_name": "CD99 antigen", "gene_name": "CD99", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9P1W8-1", "protein_name": "Signal-regulatory protein gamma", "gene_name": "SIRPG", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q08722-1", "protein_name": "Leukocyte surface antigen CD47", "gene_name": "CD47", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01871-2", "protein_name": "Immunoglobulin heavy constant mu", "gene_name": "IGHM", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UNN8-1", "protein_name": "Endothelial protein C receptor", "gene_name": "PROCR", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8WWV6-1", "protein_name": "High affinity immunoglobulin alpha and immunoglobulin mu Fc receptor", "gene_name": "FCAMR", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96AP7-1", "protein_name": "Endothelial cell-selective adhesion molecule", "gene_name": "ESAM", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14393-2", "protein_name": "Growth arrest-specific protein 6", "gene_name": "GAS6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P30273-1", "protein_name": "High affinity immunoglobulin epsilon receptor subunit gamma", "gene_name": "FCER1G", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92896-1", "protein_name": "Golgi apparatus protein 1", "gene_name": "GLG1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P20701-1", "protein_name": "Integrin alpha-L", "gene_name": "ITGAL", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01767-1", "protein_name": "Immunoglobulin heavy variable 3-53", "gene_name": "IGHV3-53", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06331-1", "protein_name": "Immunoglobulin heavy variable 4-34", "gene_name": "IGHV4-34", "tax_name": "Human" }, { "uniprot_canonical_ac": "P19256-1", "protein_name": "Lymphocyte function-associated antigen 3", "gene_name": "CD58", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y624-1", "protein_name": "Junctional adhesion molecule A", "gene_name": "F11R", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01597-1", "protein_name": "Immunoglobulin kappa variable 1-39", "gene_name": "IGKV1-39", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06310-1", "protein_name": "Immunoglobulin kappa variable 2-30", "gene_name": "IGKV2-30", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06312-1", "protein_name": "Immunoglobulin kappa variable 4-1", "gene_name": "IGKV4-1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01614-1", "protein_name": "Immunoglobulin kappa variable 2D-40", "gene_name": "IGKV2D-40", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DOY2-1", "protein_name": "Immunoglobulin lambda constant 2", "gene_name": "IGLC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P78380-1", "protein_name": "Oxidized low-density lipoprotein receptor 1", "gene_name": "OLR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P11464-1", "protein_name": "Pregnancy-specific beta-1-glycoprotein 1", "gene_name": "PSG1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q00887-1", "protein_name": "Pregnancy-specific beta-1-glycoprotein 9", "gene_name": "PSG9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UQ72-1", "protein_name": "Pregnancy-specific beta-1-glycoprotein 11", "gene_name": "PSG11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06731-1", "protein_name": "Cell adhesion molecule CEACAM5", "gene_name": "CEACAM5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P18827-1", "protein_name": "Syndecan-1", "gene_name": "SDC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UIB8-1", "protein_name": "SLAM family member 5", "gene_name": "CD84", "tax_name": "Human" }, { "uniprot_canonical_ac": "P09326-1", "protein_name": "CD48 antigen", "gene_name": "CD48", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TCZ2-1", "protein_name": "CD99 antigen-like protein 2", "gene_name": "CD99L2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P02724-1", "protein_name": "Glycophorin-A", "gene_name": "GYPA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P14174-1", "protein_name": "Macrophage migration inhibitory factor", "gene_name": "MIF", "tax_name": "Human" }, { "uniprot_canonical_ac": "P13688-1", "protein_name": "Cell adhesion molecule CEACAM1", "gene_name": "CEACAM1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06729-1", "protein_name": "T-cell surface antigen CD2", "gene_name": "CD2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P40199-1", "protein_name": "Cell adhesion molecule CEACAM6", "gene_name": "CEACAM6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BZW8-1", "protein_name": "Natural killer cell receptor 2B4", "gene_name": "CD244", "tax_name": "Human" }, { "uniprot_canonical_ac": "P16070-1", "protein_name": "CD44 antigen", "gene_name": "CD44", "tax_name": "Human" }, { "uniprot_canonical_ac": "P31997-1", "protein_name": "Cell adhesion molecule CEACAM8", "gene_name": "CEACAM8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P40198-1", "protein_name": "Cell adhesion molecule CEACAM3", "gene_name": "CEACAM3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N6Q3-1", "protein_name": "CD177 antigen", "gene_name": "CD177", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04233-1", "protein_name": "HLA class II histocompatibility antigen gamma chain", "gene_name": "CD74", "tax_name": "Human" }, { "uniprot_canonical_ac": "P16284-1", "protein_name": "Platelet endothelial cell adhesion molecule", "gene_name": "PECAM1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P31431-1", "protein_name": "Syndecan-4", "gene_name": "SDC4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04432-1", "protein_name": "Immunoglobulin kappa variable 1D-39", "gene_name": "IGKV1D-39", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06315-1", "protein_name": "Immunoglobulin kappa variable 5-2", "gene_name": "IGKV5-2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01699-1", "protein_name": "Immunoglobulin lambda variable 1-44", "gene_name": "IGLV1-44", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01701-1", "protein_name": "Immunoglobulin lambda variable 1-51", "gene_name": "IGLV1-51", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01704-1", "protein_name": "Immunoglobulin lambda variable 2-14", "gene_name": "IGLV2-14", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01706-1", "protein_name": "Immunoglobulin lambda variable 2-11", "gene_name": "IGLV2-11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01709-1", "protein_name": "Immunoglobulin lambda variable 2-8", "gene_name": "IGLV2-8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01717-1", "protein_name": "Immunoglobulin lambda variable 3-25", "gene_name": "IGLV3-25", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01721-1", "protein_name": "Immunoglobulin lambda variable 6-57", "gene_name": "IGLV6-57", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01703-1", "protein_name": "Immunoglobulin lambda variable 1-40", "gene_name": "IGLV1-40", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01705-1", "protein_name": "Immunoglobulin lambda variable 2-23", "gene_name": "IGLV2-23", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01715-1", "protein_name": "Immunoglobulin lambda variable 3-1", "gene_name": "IGLV3-1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01718-1", "protein_name": "Immunoglobulin lambda variable 3-27", "gene_name": "IGLV3-27", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04211-1", "protein_name": "Immunoglobulin lambda variable 7-43", "gene_name": "IGLV7-43", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06028-1", "protein_name": "Glycophorin-B", "gene_name": "GYPB", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04921-1", "protein_name": "Glycophorin-C", "gene_name": "GYPC", "tax_name": "Human" }, { "uniprot_canonical_ac": "P15814-1", "protein_name": "Immunoglobulin lambda-like polypeptide 1", "gene_name": "IGLL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P11215-1", "protein_name": "Integrin alpha-M", "gene_name": "ITGAM", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01876-2", "protein_name": "Immunoglobulin heavy constant alpha 1", "gene_name": "IGHA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CF74-1", "protein_name": "Immunoglobulin lambda constant 6", "gene_name": "IGLC6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P08648-1", "protein_name": "Integrin alpha-5", "gene_name": "ITGA5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P13612-1", "protein_name": "Integrin alpha-4", "gene_name": "ITGA4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P02776-1", "protein_name": "Platelet factor 4", "gene_name": "PF4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P07948-1", "protein_name": "Tyrosine-protein kinase Lyn", "gene_name": "LYN", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05556-1", "protein_name": "Integrin beta-1", "gene_name": "ITGB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NRD5-1", "protein_name": "PRKCA-binding protein", "gene_name": "PICK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P08123-1", "protein_name": "Collagen alpha-2(I) chain", "gene_name": "COL1A2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04070-1", "protein_name": "Vitamin K-dependent protein C", "gene_name": "PROC", "tax_name": "Human" }, { "uniprot_canonical_ac": "P34741-1", "protein_name": "Syndecan-2", "gene_name": "SDC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P78310-1", "protein_name": "Coxsackievirus and adenovirus receptor", "gene_name": "CXADR", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HCN6-1", "protein_name": "Platelet glycoprotein VI", "gene_name": "GP6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35052-1", "protein_name": "Glypican-1", "gene_name": "GPC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NP99-1", "protein_name": "Triggering receptor expressed on myeloid cells 1", "gene_name": "TREM1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01825-1", "protein_name": "Immunoglobulin heavy variable 4-59", "gene_name": "IGHV4-59", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01817-1", "protein_name": "Immunoglobulin heavy variable 2-5", "gene_name": "IGHV2-5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01824-1", "protein_name": "Immunoglobulin heavy variable 4-39", "gene_name": "IGHV4-39", "tax_name": "Human" }, { "uniprot_canonical_ac": "P23083-1", "protein_name": "Immunoglobulin heavy variable 1-2", "gene_name": "IGHV1-2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P10720-1", "protein_name": "Platelet factor 4 variant", "gene_name": "PF4V1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q00888-1", "protein_name": "Pregnancy-specific beta-1-glycoprotein 4", "gene_name": "PSG4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13046-1", "protein_name": "Pregnancy-specific beta-1-glycoprotein 7", "gene_name": "PSG7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q00889-1", "protein_name": "Pregnancy-specific beta-1-glycoprotein 6", "gene_name": "PSG6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P07225-1", "protein_name": "Vitamin K-dependent protein S", "gene_name": "PROS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P11465-1", "protein_name": "Pregnancy-specific beta-1-glycoprotein 2", "gene_name": "PSG2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01742-1", "protein_name": "Immunoglobulin heavy variable 1-69", "gene_name": "IGHV1-69", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01768-1", "protein_name": "Immunoglobulin heavy variable 3-30", "gene_name": "IGHV3-30", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01814-1", "protein_name": "Immunoglobulin heavy variable 2-70", "gene_name": "IGHV2-70", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01772-1", "protein_name": "Immunoglobulin heavy variable 3-33", "gene_name": "IGHV3-33", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01762-1", "protein_name": "Immunoglobulin heavy variable 3-11", "gene_name": "IGHV3-11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01763-1", "protein_name": "Immunoglobulin heavy variable 3-48", "gene_name": "IGHV3-48", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01764-1", "protein_name": "Immunoglobulin heavy variable 3-23", "gene_name": "IGHV3-23", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01766-1", "protein_name": "Immunoglobulin heavy variable 3-13", "gene_name": "IGHV3-13", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01780-1", "protein_name": "Immunoglobulin heavy variable 3-7", "gene_name": "IGHV3-7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01782-1", "protein_name": "Immunoglobulin heavy variable 3-9", "gene_name": "IGHV3-9", "tax_name": "Human" }, { "uniprot_canonical_ac": "P20702-1", "protein_name": "Integrin alpha-X", "gene_name": "ITGAX", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86YT9-1", "protein_name": "Junctional adhesion molecule-like", "gene_name": "JAML", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01877-2", "protein_name": "Immunoglobulin heavy constant alpha 2", "gene_name": "IGHA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BX67-1", "protein_name": "Junctional adhesion molecule C", "gene_name": "JAM3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01591-1", "protein_name": "Immunoglobulin J chain", "gene_name": "JCHAIN", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UQ74-1", "protein_name": "Pregnancy-specific beta-1-glycoprotein 8", "gene_name": "PSG8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16557-1", "protein_name": "Pregnancy-specific beta-1-glycoprotein 3", "gene_name": "PSG3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15238-1", "protein_name": "Pregnancy-specific beta-1-glycoprotein 5", "gene_name": "PSG5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P57087-1", "protein_name": "Junctional adhesion molecule B", "gene_name": "JAM2", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0M8Q6-1", "protein_name": "Immunoglobulin lambda constant 7", "gene_name": "IGLC7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01834-1", "protein_name": "Immunoglobulin kappa constant", "gene_name": "IGKC", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG04-1", "protein_name": "Immunoglobulin lambda constant 1", "gene_name": "IGLC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DOY3-1", "protein_name": "Immunoglobulin lambda constant 3", "gene_name": "IGLC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P78324-1", "protein_name": "Tyrosine-protein phosphatase non-receptor type substrate 1", "gene_name": "SIRPA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UKI3-1", "protein_name": "Pre-B lymphocyte protein 3", "gene_name": "VPREB3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P12018-1", "protein_name": "Immunoglobulin iota chain", "gene_name": "VPREB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01743-1", "protein_name": "Immunoglobulin heavy variable 1-46", "gene_name": "IGHV1-46", "tax_name": "Human" }, { "uniprot_canonical_ac": "P16109-1", "protein_name": "P-selectin", "gene_name": "SELP", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14242-1", "protein_name": "P-selectin glycoprotein ligand 1", "gene_name": "SELPLG", "tax_name": "Human" }, { "uniprot_canonical_ac": "P16581-1", "protein_name": "E-selectin", "gene_name": "SELE", "tax_name": "Human" }, { "uniprot_canonical_ac": "P16150-1", "protein_name": "Leukosialin", "gene_name": "SPN", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0C4DH73-1", "protein_name": "Immunoglobulin kappa variable 1-12", "gene_name": "IGKV1-12", "tax_name": "Human" }, { "uniprot_canonical_ac": "A2NJV5-1", "protein_name": "Immunoglobulin kappa variable 2-29", "gene_name": "IGKV2-29", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01594-1", "protein_name": "Immunoglobulin kappa variable 1-33", "gene_name": "IGKV1-33", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04430-1", "protein_name": "Immunoglobulin kappa variable 1-16", "gene_name": "IGKV1-16", "tax_name": "Human" }, { "uniprot_canonical_ac": "P14151-1", "protein_name": "L-selectin", "gene_name": "SELL", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12866-1", "protein_name": "Tyrosine-protein kinase Mer", "gene_name": "MERTK", "tax_name": "Human" }, { "uniprot_canonical_ac": "P16422-1", "protein_name": "Epithelial cell adhesion molecule", "gene_name": "EPCAM", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UBN6-1", "protein_name": "Tumor necrosis factor receptor superfamily member 10D", "gene_name": "TNFRSF10D", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14763-1", "protein_name": "Tumor necrosis factor receptor superfamily member 10B", "gene_name": "TNFRSF10B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P41732-1", "protein_name": "Tetraspanin-7", "gene_name": "TSPAN7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01137-1", "protein_name": "Transforming growth factor beta-1 proprotein", "gene_name": "TGFB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06241-1", "protein_name": "Tyrosine-protein kinase Fyn", "gene_name": "FYN", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05107-1", "protein_name": "Integrin beta-2", "gene_name": "ITGB2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P01700", "url": "https://www.uniprot.org/uniprotkb/P01700" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.11207550", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 151 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "BLNK mediates Syk-dependent Btk activation.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2001", "authors": "Baba Y, Hashimoto S, Matsushita M, Watanabe D, Kishimoto T, Kurosaki T, Tsukada S", "reference": { "type": "PubMed", "id": "11226282", "url": "https://pubmed.ncbi.nlm.nih.gov/11226282" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P01700-1", "protein_name": "Immunoglobulin lambda variable 1-47", "gene_name": "IGLV1-47", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01714-1", "protein_name": "Immunoglobulin lambda variable 3-19", "gene_name": "IGLV3-19", "tax_name": "Human" }, { "uniprot_canonical_ac": "P80748-1", "protein_name": "Immunoglobulin lambda variable 3-21", "gene_name": "IGLV3-21", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A075B6P5-1", "protein_name": "Immunoglobulin kappa variable 2-28", "gene_name": "IGKV2-28", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A075B6S6-1", "protein_name": "Immunoglobulin kappa variable 2D-30", "gene_name": "IGKV2D-30", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0C4DH25-1", "protein_name": "Immunoglobulin kappa variable 3D-20", "gene_name": "IGKV3D-20", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01593-1", "protein_name": "Immunoglobulin kappa variable 1D-33", "gene_name": "IGKV1D-33", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01599-1", "protein_name": "Immunoglobulin kappa variable 1-17", "gene_name": "IGKV1-17", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01601-1", "protein_name": "Immunoglobulin kappa variable 1D-16", "gene_name": "IGKV1D-16", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01611-1", "protein_name": "Immunoglobulin kappa variable 1D-12", "gene_name": "IGKV1D-12", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01615-1", "protein_name": "Immunoglobulin kappa variable 2D-28", "gene_name": "IGKV2D-28", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01619-1", "protein_name": "Immunoglobulin kappa variable 3-20", "gene_name": "IGKV3-20", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01624-1", "protein_name": "Immunoglobulin kappa variable 3-15", "gene_name": "IGKV3-15", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04433-1", "protein_name": "Immunoglobulin kappa variable 3-11", "gene_name": "IGKV3-11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01602-1", "protein_name": "Immunoglobulin kappa variable 1-5", "gene_name": "IGKV1-5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8WV28-1", "protein_name": "B-cell linker protein", "gene_name": "BLNK", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14643-1", "protein_name": "Inositol 1,4,5-trisphosphate-gated calcium channel ITPR1", "gene_name": "ITPR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UN19-1", "protein_name": "Dual adapter for phosphotyrosine and 3-phosphotyrosine and 3-phosphoinositide", "gene_name": "DAPP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P43405-1", "protein_name": "Tyrosine-protein kinase SYK", "gene_name": "SYK", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96SN7-1", "protein_name": "Protein orai-2", "gene_name": "ORAI2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P15391-1", "protein_name": "B-lymphocyte antigen CD19", "gene_name": "CD19", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01871-2", "protein_name": "Immunoglobulin heavy constant mu", "gene_name": "IGHM", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13586-1", "protein_name": "Stromal interaction molecule 1", "gene_name": "STIM1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01767-1", "protein_name": "Immunoglobulin heavy variable 3-53", "gene_name": "IGHV3-53", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06331-1", "protein_name": "Immunoglobulin heavy variable 4-34", "gene_name": "IGHV4-34", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14571-1", "protein_name": "Inositol 1,4,5-trisphosphate-gated calcium channel ITPR2", "gene_name": "ITPR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01597-1", "protein_name": "Immunoglobulin kappa variable 1-39", "gene_name": "IGKV1-39", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06310-1", "protein_name": "Immunoglobulin kappa variable 2-30", "gene_name": "IGKV2-30", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06312-1", "protein_name": "Immunoglobulin kappa variable 4-1", "gene_name": "IGKV4-1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01614-1", "protein_name": "Immunoglobulin kappa variable 2D-40", "gene_name": "IGKV2D-40", "tax_name": "Human" }, { "uniprot_canonical_ac": "P48995-1", "protein_name": "Short transient receptor potential channel 1", "gene_name": "TRPC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DOY2-1", "protein_name": "Immunoglobulin lambda constant 2", "gene_name": "IGLC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6ZUJ8-1", "protein_name": "Phosphoinositide 3-kinase adapter protein 1", "gene_name": "PIK3AP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96D31-1", "protein_name": "Calcium release-activated calcium channel protein 1", "gene_name": "ORAI1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DP23-1", "protein_name": "Calmodulin-1", "gene_name": "CALM1; CALM2; CALM3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P29350-1", "protein_name": "Tyrosine-protein phosphatase non-receptor type 6", "gene_name": "PTPN6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P20273-1", "protein_name": "B-cell receptor CD22", "gene_name": "CD22", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q00655-1", "protein_name": "Tyrosine-protein kinase SYK", "gene_name": "SYK", "tax_name": "Pig" }, { "uniprot_canonical_ac": "P04432-1", "protein_name": "Immunoglobulin kappa variable 1D-39", "gene_name": "IGKV1D-39", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06315-1", "protein_name": "Immunoglobulin kappa variable 5-2", "gene_name": "IGKV5-2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01699-1", "protein_name": "Immunoglobulin lambda variable 1-44", "gene_name": "IGLV1-44", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01701-1", "protein_name": "Immunoglobulin lambda variable 1-51", "gene_name": "IGLV1-51", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01704-1", "protein_name": "Immunoglobulin lambda variable 2-14", "gene_name": "IGLV2-14", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01706-1", "protein_name": "Immunoglobulin lambda variable 2-11", "gene_name": "IGLV2-11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01709-1", "protein_name": "Immunoglobulin lambda variable 2-8", "gene_name": "IGLV2-8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01717-1", "protein_name": "Immunoglobulin lambda variable 3-25", "gene_name": "IGLV3-25", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01721-1", "protein_name": "Immunoglobulin lambda variable 6-57", "gene_name": "IGLV6-57", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01703-1", "protein_name": "Immunoglobulin lambda variable 1-40", "gene_name": "IGLV1-40", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01705-1", "protein_name": "Immunoglobulin lambda variable 2-23", "gene_name": "IGLV2-23", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01715-1", "protein_name": "Immunoglobulin lambda variable 3-1", "gene_name": "IGLV3-1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01718-1", "protein_name": "Immunoglobulin lambda variable 3-27", "gene_name": "IGLV3-27", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04211-1", "protein_name": "Immunoglobulin lambda variable 7-43", "gene_name": "IGLV7-43", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q07889-1", "protein_name": "Son of sevenless homolog 1", "gene_name": "SOS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01880-2", "protein_name": "Immunoglobulin heavy constant delta", "gene_name": "IGHD", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CF74-1", "protein_name": "Immunoglobulin lambda constant 6", "gene_name": "IGLC6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q06187-1", "protein_name": "Tyrosine-protein kinase BTK", "gene_name": "BTK", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96B97-1", "protein_name": "SH3 domain-containing kinase-binding protein 1", "gene_name": "SH3KBP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P07948-1", "protein_name": "Tyrosine-protein kinase Lyn", "gene_name": "LYN", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51451-1", "protein_name": "Tyrosine-protein kinase Blk", "gene_name": "BLK", "tax_name": "Human" }, { "uniprot_canonical_ac": "P16885-1", "protein_name": "1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-2", "gene_name": "PLCG2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43865-1", "protein_name": "S-adenosylhomocysteine hydrolase-like protein 1", "gene_name": "AHCYL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01825-1", "protein_name": "Immunoglobulin heavy variable 4-59", "gene_name": "IGHV4-59", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01817-1", "protein_name": "Immunoglobulin heavy variable 2-5", "gene_name": "IGHV2-5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01824-1", "protein_name": "Immunoglobulin heavy variable 4-39", "gene_name": "IGHV4-39", "tax_name": "Human" }, { "uniprot_canonical_ac": "P23083-1", "protein_name": "Immunoglobulin heavy variable 1-2", "gene_name": "IGHV1-2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00329-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit delta isoform", "gene_name": "PIK3CD", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01742-1", "protein_name": "Immunoglobulin heavy variable 1-69", "gene_name": "IGHV1-69", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01768-1", "protein_name": "Immunoglobulin heavy variable 3-30", "gene_name": "IGHV3-30", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01814-1", "protein_name": "Immunoglobulin heavy variable 2-70", "gene_name": "IGHV2-70", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01772-1", "protein_name": "Immunoglobulin heavy variable 3-33", "gene_name": "IGHV3-33", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01762-1", "protein_name": "Immunoglobulin heavy variable 3-11", "gene_name": "IGHV3-11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01763-1", "protein_name": "Immunoglobulin heavy variable 3-48", "gene_name": "IGHV3-48", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01764-1", "protein_name": "Immunoglobulin heavy variable 3-23", "gene_name": "IGHV3-23", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01766-1", "protein_name": "Immunoglobulin heavy variable 3-13", "gene_name": "IGHV3-13", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01780-1", "protein_name": "Immunoglobulin heavy variable 3-7", "gene_name": "IGHV3-7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01782-1", "protein_name": "Immunoglobulin heavy variable 3-9", "gene_name": "IGHV3-9", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0M8Q6-1", "protein_name": "Immunoglobulin lambda constant 7", "gene_name": "IGLC7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01834-1", "protein_name": "Immunoglobulin kappa constant", "gene_name": "IGKC", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG04-1", "protein_name": "Immunoglobulin lambda constant 1", "gene_name": "IGLC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DOY3-1", "protein_name": "Immunoglobulin lambda constant 3", "gene_name": "IGLC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P11912-1", "protein_name": "B-cell antigen receptor complex-associated protein alpha chain", "gene_name": "CD79A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P40259-1", "protein_name": "B-cell antigen receptor complex-associated protein beta chain", "gene_name": "CD79B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01743-1", "protein_name": "Immunoglobulin heavy variable 1-46", "gene_name": "IGHV1-46", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14573-1", "protein_name": "Inositol 1,4,5-trisphosphate-gated calcium channel ITPR3", "gene_name": "ITPR3", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0C4DH73-1", "protein_name": "Immunoglobulin kappa variable 1-12", "gene_name": "IGKV1-12", "tax_name": "Human" }, { "uniprot_canonical_ac": "A2NJV5-1", "protein_name": "Immunoglobulin kappa variable 2-29", "gene_name": "IGKV2-29", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01594-1", "protein_name": "Immunoglobulin kappa variable 1-33", "gene_name": "IGKV1-33", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04430-1", "protein_name": "Immunoglobulin kappa variable 1-16", "gene_name": "IGKV1-16", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27986-1", "protein_name": "Phosphatidylinositol 3-kinase regulatory subunit alpha", "gene_name": "PIK3R1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06241-1", "protein_name": "Tyrosine-protein kinase Fyn", "gene_name": "FYN", "tax_name": "Human" }, { "uniprot_canonical_ac": "P16333-1", "protein_name": "SH2/SH3 adapter protein NCK1", "gene_name": "NCK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P15498-1", "protein_name": "Proto-oncogene vav", "gene_name": "VAV1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P01700", "url": "https://www.uniprot.org/uniprotkb/P01700" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 551, "end_pos": 551, "kinase_uniprot_canonical_ac": "P07948-1", "kinase_gene_name": "LYN", "residue": "Tyr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q06187", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q06187" }, { "database": "PubMed", "id": "11226282", "url": "https://pubmed.ncbi.nlm.nih.gov/11226282" }, { "database": "PubMed", "id": "11598012", "url": "https://pubmed.ncbi.nlm.nih.gov/11598012" }, { "database": "PubMed", "id": "8629002", "url": "https://pubmed.ncbi.nlm.nih.gov/8629002" }, { "database": "PubMed", "id": "8630736", "url": "https://pubmed.ncbi.nlm.nih.gov/8630736" } ], "site_lbl": "Tyr551", "uniprot_canonical_ac": "Q06187-1" }, { "start_pos": 551, "end_pos": 551, "kinase_uniprot_canonical_ac": "P43405-1", "kinase_gene_name": "SYK", "residue": "Tyr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q06187", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q06187" }, { "database": "PubMed", "id": "11226282", "url": "https://pubmed.ncbi.nlm.nih.gov/11226282" }, { "database": "PubMed", "id": "11598012", "url": "https://pubmed.ncbi.nlm.nih.gov/11598012" }, { "database": "PubMed", "id": "8629002", "url": "https://pubmed.ncbi.nlm.nih.gov/8629002" }, { "database": "PubMed", "id": "8630736", "url": "https://pubmed.ncbi.nlm.nih.gov/8630736" } ], "site_lbl": "Tyr551", "uniprot_canonical_ac": "Q06187-1" }, { "start_pos": 551, "end_pos": 551, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "Phosphotyrosine; by LYN and SYK", "evidence": [ { "database": "UniProtKB", "id": "Q06187", "url": "https://www.uniprot.org/uniprotkb/Q06187" }, { "database": "PRO", "id": "Q06187", "url": "https://proconsortium.org/cgi-bin/entry_pro?id=Q06187" }, { "database": "iPTMnet", "id": "Q06187", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q06187" }, { "database": "PubMed", "id": "11226282", "url": "https://pubmed.ncbi.nlm.nih.gov/11226282" }, { "database": "PubMed", "id": "7565679", "url": "https://pubmed.ncbi.nlm.nih.gov/7565679" }, { "database": "PubMed", "id": "14656219", "url": "https://pubmed.ncbi.nlm.nih.gov/14656219" }, { "database": "PubMed", "id": "17264076", "url": "https://pubmed.ncbi.nlm.nih.gov/17264076" }, { "database": "PubMed", "id": "19206206", "url": "https://pubmed.ncbi.nlm.nih.gov/19206206" }, { "database": "PubMed", "id": "21752263", "url": "https://pubmed.ncbi.nlm.nih.gov/21752263" }, { "database": "PubMed", "id": "25699547", "url": "https://pubmed.ncbi.nlm.nih.gov/25699547" }, { "database": "PubMed", "id": "25944695", "url": "https://pubmed.ncbi.nlm.nih.gov/25944695" }, { "database": "PubMed", "id": "27282255", "url": "https://pubmed.ncbi.nlm.nih.gov/27282255" }, { "database": "PubMed", "id": "27602755", "url": "https://pubmed.ncbi.nlm.nih.gov/27602755" }, { "database": "PubMed", "id": "28088788", "url": "https://pubmed.ncbi.nlm.nih.gov/28088788" }, { "database": "PubMed", "id": "28352114", "url": "https://pubmed.ncbi.nlm.nih.gov/28352114" }, { "database": "PubMed", "id": "28424405", "url": "https://pubmed.ncbi.nlm.nih.gov/28424405" }, { "database": "PubMed", "id": "30026342", "url": "https://pubmed.ncbi.nlm.nih.gov/30026342" }, { "database": "PubMed", "id": "30341350", "url": "https://pubmed.ncbi.nlm.nih.gov/30341350" }, { "database": "PubMed", "id": "31949019", "url": "https://pubmed.ncbi.nlm.nih.gov/31949019" }, { "database": "PubMed", "id": "32385234", "url": "https://pubmed.ncbi.nlm.nih.gov/32385234" }, { "database": "PubMed", "id": "35639855", "url": "https://pubmed.ncbi.nlm.nih.gov/35639855" }, { "database": "PubMed", "id": "8630736", "url": "https://pubmed.ncbi.nlm.nih.gov/8630736" }, { "database": "PubMed", "id": "9052864", "url": "https://pubmed.ncbi.nlm.nih.gov/9052864" }, { "database": "PubMed", "id": "9188445", "url": "https://pubmed.ncbi.nlm.nih.gov/9188445" }, { "database": "PubMed", "id": "9012831", "url": "https://pubmed.ncbi.nlm.nih.gov/9012831" } ], "site_lbl": "Tyr551", "uniprot_canonical_ac": "Q06187-1" } ], "record_id": "pubmed.11226282", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 92 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 3 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Characterization of residues and sequences of the carbohydrate recognition domain required for cell surface localization and ligand binding of human lectin-like oxidized LDL receptor.", "journal": "Journal of cell science", "date": "2001", "authors": "Shi X, Niimi S, Ohtani T, Machida S", "reference": { "type": "PubMed", "id": "11256994", "url": "https://pubmed.ncbi.nlm.nih.gov/11256994" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P01700-1", "protein_name": "Immunoglobulin lambda variable 1-47", "gene_name": "IGLV1-47", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01714-1", "protein_name": "Immunoglobulin lambda variable 3-19", "gene_name": "IGLV3-19", "tax_name": "Human" }, { "uniprot_canonical_ac": "P80748-1", "protein_name": "Immunoglobulin lambda variable 3-21", "gene_name": "IGLV3-21", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A075B6P5-1", "protein_name": "Immunoglobulin kappa variable 2-28", "gene_name": "IGKV2-28", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A075B6S6-1", "protein_name": "Immunoglobulin kappa variable 2D-30", "gene_name": "IGKV2D-30", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0C4DH25-1", "protein_name": "Immunoglobulin kappa variable 3D-20", "gene_name": "IGKV3D-20", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01593-1", "protein_name": "Immunoglobulin kappa variable 1D-33", "gene_name": "IGKV1D-33", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01599-1", "protein_name": "Immunoglobulin kappa variable 1-17", "gene_name": "IGKV1-17", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01601-1", "protein_name": "Immunoglobulin kappa variable 1D-16", "gene_name": "IGKV1D-16", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01611-1", "protein_name": "Immunoglobulin kappa variable 1D-12", "gene_name": "IGKV1D-12", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01615-1", "protein_name": "Immunoglobulin kappa variable 2D-28", "gene_name": "IGKV2D-28", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01619-1", "protein_name": "Immunoglobulin kappa variable 3-20", "gene_name": "IGKV3-20", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01624-1", "protein_name": "Immunoglobulin kappa variable 3-15", "gene_name": "IGKV3-15", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04433-1", "protein_name": "Immunoglobulin kappa variable 3-11", "gene_name": "IGKV3-11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01602-1", "protein_name": "Immunoglobulin kappa variable 1-5", "gene_name": "IGKV1-5", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75056-1", "protein_name": "Syndecan-3", "gene_name": "SDC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P07204-1", "protein_name": "Thrombomodulin", "gene_name": "THBD", "tax_name": "Human" }, { "uniprot_canonical_ac": "P00734-1", "protein_name": "Prothrombin", "gene_name": "F2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P02452-1", "protein_name": "Collagen alpha-1(I) chain", "gene_name": "COL1A1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04114-1", "protein_name": "Apolipoprotein B-100", "gene_name": "APOB", "tax_name": "Human" }, { "uniprot_canonical_ac": "P02751-15", "protein_name": "Fibronectin", "gene_name": "FN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00220-1", "protein_name": "Tumor necrosis factor receptor superfamily member 10A", "gene_name": "TNFRSF10A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P14209-1", "protein_name": "CD99 antigen", "gene_name": "CD99", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9P1W8-1", "protein_name": "Signal-regulatory protein gamma", "gene_name": "SIRPG", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q08722-1", "protein_name": "Leukocyte surface antigen CD47", "gene_name": "CD47", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01871-2", "protein_name": "Immunoglobulin heavy constant mu", "gene_name": "IGHM", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UNN8-1", "protein_name": "Endothelial protein C receptor", "gene_name": "PROCR", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8WWV6-1", "protein_name": "High affinity immunoglobulin alpha and immunoglobulin mu Fc receptor", "gene_name": "FCAMR", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96AP7-1", "protein_name": "Endothelial cell-selective adhesion molecule", "gene_name": "ESAM", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14393-2", "protein_name": "Growth arrest-specific protein 6", "gene_name": "GAS6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P30273-1", "protein_name": "High affinity immunoglobulin epsilon receptor subunit gamma", "gene_name": "FCER1G", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92896-1", "protein_name": "Golgi apparatus protein 1", "gene_name": "GLG1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P20701-1", "protein_name": "Integrin alpha-L", "gene_name": "ITGAL", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01767-1", "protein_name": "Immunoglobulin heavy variable 3-53", "gene_name": "IGHV3-53", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06331-1", "protein_name": "Immunoglobulin heavy variable 4-34", "gene_name": "IGHV4-34", "tax_name": "Human" }, { "uniprot_canonical_ac": "P19256-1", "protein_name": "Lymphocyte function-associated antigen 3", "gene_name": "CD58", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y624-1", "protein_name": "Junctional adhesion molecule A", "gene_name": "F11R", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01597-1", "protein_name": "Immunoglobulin kappa variable 1-39", "gene_name": "IGKV1-39", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06310-1", "protein_name": "Immunoglobulin kappa variable 2-30", "gene_name": "IGKV2-30", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06312-1", "protein_name": "Immunoglobulin kappa variable 4-1", "gene_name": "IGKV4-1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01614-1", "protein_name": "Immunoglobulin kappa variable 2D-40", "gene_name": "IGKV2D-40", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DOY2-1", "protein_name": "Immunoglobulin lambda constant 2", "gene_name": "IGLC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P78380-1", "protein_name": "Oxidized low-density lipoprotein receptor 1", "gene_name": "OLR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P11464-1", "protein_name": "Pregnancy-specific beta-1-glycoprotein 1", "gene_name": "PSG1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q00887-1", "protein_name": "Pregnancy-specific beta-1-glycoprotein 9", "gene_name": "PSG9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UQ72-1", "protein_name": "Pregnancy-specific beta-1-glycoprotein 11", "gene_name": "PSG11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06731-1", "protein_name": "Cell adhesion molecule CEACAM5", "gene_name": "CEACAM5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P18827-1", "protein_name": "Syndecan-1", "gene_name": "SDC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UIB8-1", "protein_name": "SLAM family member 5", "gene_name": "CD84", "tax_name": "Human" }, { "uniprot_canonical_ac": "P09326-1", "protein_name": "CD48 antigen", "gene_name": "CD48", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TCZ2-1", "protein_name": "CD99 antigen-like protein 2", "gene_name": "CD99L2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P02724-1", "protein_name": "Glycophorin-A", "gene_name": "GYPA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P14174-1", "protein_name": "Macrophage migration inhibitory factor", "gene_name": "MIF", "tax_name": "Human" }, { "uniprot_canonical_ac": "P13688-1", "protein_name": "Cell adhesion molecule CEACAM1", "gene_name": "CEACAM1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06729-1", "protein_name": "T-cell surface antigen CD2", "gene_name": "CD2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P40199-1", "protein_name": "Cell adhesion molecule CEACAM6", "gene_name": "CEACAM6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BZW8-1", "protein_name": "Natural killer cell receptor 2B4", "gene_name": "CD244", "tax_name": "Human" }, { "uniprot_canonical_ac": "P16070-1", "protein_name": "CD44 antigen", "gene_name": "CD44", "tax_name": "Human" }, { "uniprot_canonical_ac": "P31997-1", "protein_name": "Cell adhesion molecule CEACAM8", "gene_name": "CEACAM8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P40198-1", "protein_name": "Cell adhesion molecule CEACAM3", "gene_name": "CEACAM3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N6Q3-1", "protein_name": "CD177 antigen", "gene_name": "CD177", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04233-1", "protein_name": "HLA class II histocompatibility antigen gamma chain", "gene_name": "CD74", "tax_name": "Human" }, { "uniprot_canonical_ac": "P16284-1", "protein_name": "Platelet endothelial cell adhesion molecule", "gene_name": "PECAM1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P31431-1", "protein_name": "Syndecan-4", "gene_name": "SDC4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04432-1", "protein_name": "Immunoglobulin kappa variable 1D-39", "gene_name": "IGKV1D-39", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06315-1", "protein_name": "Immunoglobulin kappa variable 5-2", "gene_name": "IGKV5-2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01699-1", "protein_name": "Immunoglobulin lambda variable 1-44", "gene_name": "IGLV1-44", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01701-1", "protein_name": "Immunoglobulin lambda variable 1-51", "gene_name": "IGLV1-51", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01704-1", "protein_name": "Immunoglobulin lambda variable 2-14", "gene_name": "IGLV2-14", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01706-1", "protein_name": "Immunoglobulin lambda variable 2-11", "gene_name": "IGLV2-11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01709-1", "protein_name": "Immunoglobulin lambda variable 2-8", "gene_name": "IGLV2-8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01717-1", "protein_name": "Immunoglobulin lambda variable 3-25", "gene_name": "IGLV3-25", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01721-1", "protein_name": "Immunoglobulin lambda variable 6-57", "gene_name": "IGLV6-57", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01703-1", "protein_name": "Immunoglobulin lambda variable 1-40", "gene_name": "IGLV1-40", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01705-1", "protein_name": "Immunoglobulin lambda variable 2-23", "gene_name": "IGLV2-23", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01715-1", "protein_name": "Immunoglobulin lambda variable 3-1", "gene_name": "IGLV3-1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01718-1", "protein_name": "Immunoglobulin lambda variable 3-27", "gene_name": "IGLV3-27", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04211-1", "protein_name": "Immunoglobulin lambda variable 7-43", "gene_name": "IGLV7-43", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06028-1", "protein_name": "Glycophorin-B", "gene_name": "GYPB", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04921-1", "protein_name": "Glycophorin-C", "gene_name": "GYPC", "tax_name": "Human" }, { "uniprot_canonical_ac": "P15814-1", "protein_name": "Immunoglobulin lambda-like polypeptide 1", "gene_name": "IGLL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P11215-1", "protein_name": "Integrin alpha-M", "gene_name": "ITGAM", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01876-2", "protein_name": "Immunoglobulin heavy constant alpha 1", "gene_name": "IGHA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CF74-1", "protein_name": "Immunoglobulin lambda constant 6", "gene_name": "IGLC6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P08648-1", "protein_name": "Integrin alpha-5", "gene_name": "ITGA5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P13612-1", "protein_name": "Integrin alpha-4", "gene_name": "ITGA4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P02776-1", "protein_name": "Platelet factor 4", "gene_name": "PF4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P07948-1", "protein_name": "Tyrosine-protein kinase Lyn", "gene_name": "LYN", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05556-1", "protein_name": "Integrin beta-1", "gene_name": "ITGB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NRD5-1", "protein_name": "PRKCA-binding protein", "gene_name": "PICK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P08123-1", "protein_name": "Collagen alpha-2(I) chain", "gene_name": "COL1A2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04070-1", "protein_name": "Vitamin K-dependent protein C", "gene_name": "PROC", "tax_name": "Human" }, { "uniprot_canonical_ac": "P34741-1", "protein_name": "Syndecan-2", "gene_name": "SDC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P78310-1", "protein_name": "Coxsackievirus and adenovirus receptor", "gene_name": "CXADR", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HCN6-1", "protein_name": "Platelet glycoprotein VI", "gene_name": "GP6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35052-1", "protein_name": "Glypican-1", "gene_name": "GPC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NP99-1", "protein_name": "Triggering receptor expressed on myeloid cells 1", "gene_name": "TREM1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01825-1", "protein_name": "Immunoglobulin heavy variable 4-59", "gene_name": "IGHV4-59", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01817-1", "protein_name": "Immunoglobulin heavy variable 2-5", "gene_name": "IGHV2-5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01824-1", "protein_name": "Immunoglobulin heavy variable 4-39", "gene_name": "IGHV4-39", "tax_name": "Human" }, { "uniprot_canonical_ac": "P23083-1", "protein_name": "Immunoglobulin heavy variable 1-2", "gene_name": "IGHV1-2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P10720-1", "protein_name": "Platelet factor 4 variant", "gene_name": "PF4V1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q00888-1", "protein_name": "Pregnancy-specific beta-1-glycoprotein 4", "gene_name": "PSG4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13046-1", "protein_name": "Pregnancy-specific beta-1-glycoprotein 7", "gene_name": "PSG7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q00889-1", "protein_name": "Pregnancy-specific beta-1-glycoprotein 6", "gene_name": "PSG6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P07225-1", "protein_name": "Vitamin K-dependent protein S", "gene_name": "PROS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P11465-1", "protein_name": "Pregnancy-specific beta-1-glycoprotein 2", "gene_name": "PSG2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01742-1", "protein_name": "Immunoglobulin heavy variable 1-69", "gene_name": "IGHV1-69", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01768-1", "protein_name": "Immunoglobulin heavy variable 3-30", "gene_name": "IGHV3-30", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01814-1", "protein_name": "Immunoglobulin heavy variable 2-70", "gene_name": "IGHV2-70", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01772-1", "protein_name": "Immunoglobulin heavy variable 3-33", "gene_name": "IGHV3-33", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01762-1", "protein_name": "Immunoglobulin heavy variable 3-11", "gene_name": "IGHV3-11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01763-1", "protein_name": "Immunoglobulin heavy variable 3-48", "gene_name": "IGHV3-48", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01764-1", "protein_name": "Immunoglobulin heavy variable 3-23", "gene_name": "IGHV3-23", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01766-1", "protein_name": "Immunoglobulin heavy variable 3-13", "gene_name": "IGHV3-13", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01780-1", "protein_name": "Immunoglobulin heavy variable 3-7", "gene_name": "IGHV3-7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01782-1", "protein_name": "Immunoglobulin heavy variable 3-9", "gene_name": "IGHV3-9", "tax_name": "Human" }, { "uniprot_canonical_ac": "P20702-1", "protein_name": "Integrin alpha-X", "gene_name": "ITGAX", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86YT9-1", "protein_name": "Junctional adhesion molecule-like", "gene_name": "JAML", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01877-2", "protein_name": "Immunoglobulin heavy constant alpha 2", "gene_name": "IGHA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BX67-1", "protein_name": "Junctional adhesion molecule C", "gene_name": "JAM3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01591-1", "protein_name": "Immunoglobulin J chain", "gene_name": "JCHAIN", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UQ74-1", "protein_name": "Pregnancy-specific beta-1-glycoprotein 8", "gene_name": "PSG8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16557-1", "protein_name": "Pregnancy-specific beta-1-glycoprotein 3", "gene_name": "PSG3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15238-1", "protein_name": "Pregnancy-specific beta-1-glycoprotein 5", "gene_name": "PSG5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P57087-1", "protein_name": "Junctional adhesion molecule B", "gene_name": "JAM2", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0M8Q6-1", "protein_name": "Immunoglobulin lambda constant 7", "gene_name": "IGLC7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01834-1", "protein_name": "Immunoglobulin kappa constant", "gene_name": "IGKC", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG04-1", "protein_name": "Immunoglobulin lambda constant 1", "gene_name": "IGLC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DOY3-1", "protein_name": "Immunoglobulin lambda constant 3", "gene_name": "IGLC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P78324-1", "protein_name": "Tyrosine-protein phosphatase non-receptor type substrate 1", "gene_name": "SIRPA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UKI3-1", "protein_name": "Pre-B lymphocyte protein 3", "gene_name": "VPREB3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P12018-1", "protein_name": "Immunoglobulin iota chain", "gene_name": "VPREB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01743-1", "protein_name": "Immunoglobulin heavy variable 1-46", "gene_name": "IGHV1-46", "tax_name": "Human" }, { "uniprot_canonical_ac": "P16109-1", "protein_name": "P-selectin", "gene_name": "SELP", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14242-1", "protein_name": "P-selectin glycoprotein ligand 1", "gene_name": "SELPLG", "tax_name": "Human" }, { "uniprot_canonical_ac": "P16581-1", "protein_name": "E-selectin", "gene_name": "SELE", "tax_name": "Human" }, { "uniprot_canonical_ac": "P16150-1", "protein_name": "Leukosialin", "gene_name": "SPN", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0C4DH73-1", "protein_name": "Immunoglobulin kappa variable 1-12", "gene_name": "IGKV1-12", "tax_name": "Human" }, { "uniprot_canonical_ac": "A2NJV5-1", "protein_name": "Immunoglobulin kappa variable 2-29", "gene_name": "IGKV2-29", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01594-1", "protein_name": "Immunoglobulin kappa variable 1-33", "gene_name": "IGKV1-33", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04430-1", "protein_name": "Immunoglobulin kappa variable 1-16", "gene_name": "IGKV1-16", "tax_name": "Human" }, { "uniprot_canonical_ac": "P14151-1", "protein_name": "L-selectin", "gene_name": "SELL", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12866-1", "protein_name": "Tyrosine-protein kinase Mer", "gene_name": "MERTK", "tax_name": "Human" }, { "uniprot_canonical_ac": "P16422-1", "protein_name": "Epithelial cell adhesion molecule", "gene_name": "EPCAM", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UBN6-1", "protein_name": "Tumor necrosis factor receptor superfamily member 10D", "gene_name": "TNFRSF10D", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14763-1", "protein_name": "Tumor necrosis factor receptor superfamily member 10B", "gene_name": "TNFRSF10B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P41732-1", "protein_name": "Tetraspanin-7", "gene_name": "TSPAN7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01137-1", "protein_name": "Transforming growth factor beta-1 proprotein", "gene_name": "TGFB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06241-1", "protein_name": "Tyrosine-protein kinase Fyn", "gene_name": "FYN", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05107-1", "protein_name": "Integrin beta-2", "gene_name": "ITGB2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P01700", "url": "https://www.uniprot.org/uniprotkb/P01700" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 144, "end_pos": 144, "sequence_org": "C", "sequence_mut": "S", "comment": "Abolishes sorting into the cell surface and binding to acetylated LDL (AcLDL) while increasing N-glycosylation; when associated with S-155; S-172; S-243; S-256 and S-264.", "evidence": [ { "database": "UniProtKB", "id": "P78380", "url": "https://www.uniprot.org/uniprotkb/P78380" }, { "database": "PubMed", "id": "11256994", "url": "https://pubmed.ncbi.nlm.nih.gov/11256994" } ], "uniprot_canonical_ac": "P78380-1" }, { "start_pos": 155, "end_pos": 155, "sequence_org": "C", "sequence_mut": "S", "comment": "Abolishes sorting into the cell surface and binding to acetylated LDL (AcLDL) while increasing N-glycosylation; when associated with S-144; S-172; S-243; S-256 and S-264.", "evidence": [ { "database": "UniProtKB", "id": "P78380", "url": "https://www.uniprot.org/uniprotkb/P78380" }, { "database": "PubMed", "id": "11256994", "url": "https://pubmed.ncbi.nlm.nih.gov/11256994" } ], "uniprot_canonical_ac": "P78380-1" }, { "start_pos": 172, "end_pos": 172, "sequence_org": "C", "sequence_mut": "S", "comment": "Abolishes sorting into the cell surface and binding to acetylated LDL (AcLDL) while increasing N-glycosylation; when associated with S-144; S-155; S-243; S-256 and S-264.", "evidence": [ { "database": "UniProtKB", "id": "P78380", "url": "https://www.uniprot.org/uniprotkb/P78380" }, { "database": "PubMed", "id": "11256994", "url": "https://pubmed.ncbi.nlm.nih.gov/11256994" } ], "uniprot_canonical_ac": "P78380-1" }, { "start_pos": 183, "end_pos": 183, "sequence_org": "N", "sequence_mut": "Q", "comment": "Does not affect glycosylation state.", "evidence": [ { "database": "UniProtKB", "id": "P78380", "url": "https://www.uniprot.org/uniprotkb/P78380" }, { "database": "PubMed", "id": "11256994", "url": "https://pubmed.ncbi.nlm.nih.gov/11256994" } ], "uniprot_canonical_ac": "P78380-1" }, { "start_pos": 209, "end_pos": 210, "sequence_org": "RN", "sequence_mut": "LL", "comment": "Abolishes binding to acetylated LDL (AcLDL).", "evidence": [ { "database": "UniProtKB", "id": "P78380", "url": "https://www.uniprot.org/uniprotkb/P78380" }, { "database": "PubMed", "id": "11256994", "url": "https://pubmed.ncbi.nlm.nih.gov/11256994" } ], "uniprot_canonical_ac": "P78380-1" }, { "start_pos": 226, "end_pos": 226, "sequence_org": "H", "sequence_mut": "A", "comment": "No effect.", "evidence": [ { "database": "UniProtKB", "id": "P78380", "url": "https://www.uniprot.org/uniprotkb/P78380" }, { "database": "PubMed", "id": "15939022", "url": "https://pubmed.ncbi.nlm.nih.gov/15939022" }, { "database": "PubMed", "id": "11256994", "url": "https://pubmed.ncbi.nlm.nih.gov/11256994" } ], "uniprot_canonical_ac": "P78380-1" }, { "start_pos": 226, "end_pos": 226, "sequence_org": "H", "sequence_mut": "Q", "comment": "Abolishes binding to acetylated LDL (AcLDL); when associated with N-229 and N-231.", "evidence": [ { "database": "UniProtKB", "id": "P78380", "url": "https://www.uniprot.org/uniprotkb/P78380" }, { "database": "PubMed", "id": "15939022", "url": "https://pubmed.ncbi.nlm.nih.gov/15939022" }, { "database": "PubMed", "id": "11256994", "url": "https://pubmed.ncbi.nlm.nih.gov/11256994" } ], "uniprot_canonical_ac": "P78380-1" }, { "start_pos": 229, "end_pos": 229, "sequence_org": "R", "sequence_mut": "N", "comment": "Does not affect subcellular location but displays a reduced affinity for acetylated LDL (AcLDL). Abolishes binding to acetylated LDL (AcLDL); when associated with Q-226 and N-231.", "evidence": [ { "database": "UniProtKB", "id": "P78380", "url": "https://www.uniprot.org/uniprotkb/P78380" }, { "database": "PubMed", "id": "15939022", "url": "https://pubmed.ncbi.nlm.nih.gov/15939022" }, { "database": "PubMed", "id": "11256994", "url": "https://pubmed.ncbi.nlm.nih.gov/11256994" } ], "uniprot_canonical_ac": "P78380-1" }, { "start_pos": 231, "end_pos": 231, "sequence_org": "R", "sequence_mut": "N", "comment": "Abolishes binding to acetylated LDL (AcLDL). Abolishes binding to AcLDL; when associated with Q-226 and N-229.", "evidence": [ { "database": "UniProtKB", "id": "P78380", "url": "https://www.uniprot.org/uniprotkb/P78380" }, { "database": "PubMed", "id": "15939022", "url": "https://pubmed.ncbi.nlm.nih.gov/15939022" }, { "database": "PubMed", "id": "11256994", "url": "https://pubmed.ncbi.nlm.nih.gov/11256994" } ], "uniprot_canonical_ac": "P78380-1" }, { "start_pos": 235, "end_pos": 236, "sequence_org": "SQ", "sequence_mut": "AL", "comment": "Impairs binding to acetylated LDL (AcLDL); when associated with A-240.", "evidence": [ { "database": "UniProtKB", "id": "P78380", "url": "https://www.uniprot.org/uniprotkb/P78380" }, { "database": "PubMed", "id": "11256994", "url": "https://pubmed.ncbi.nlm.nih.gov/11256994" } ], "uniprot_canonical_ac": "P78380-1" }, { "start_pos": 240, "end_pos": 240, "sequence_org": "S", "sequence_mut": "A", "comment": "Impairs binding to acetylated LDL (AcLDL); when associated with 235-AL-236.", "evidence": [ { "database": "UniProtKB", "id": "P78380", "url": "https://www.uniprot.org/uniprotkb/P78380" }, { "database": "PubMed", "id": "11256994", "url": "https://pubmed.ncbi.nlm.nih.gov/11256994" } ], "uniprot_canonical_ac": "P78380-1" }, { "start_pos": 243, "end_pos": 243, "sequence_org": "C", "sequence_mut": "S", "comment": "Abolishes sorting into the cell surface and binding to acetylated LDL (AcLDL) while increasing N-glycosylation; when associated with S-144; S-155; S-172; S-256 and S-264.", "evidence": [ { "database": "UniProtKB", "id": "P78380", "url": "https://www.uniprot.org/uniprotkb/P78380" }, { "database": "PubMed", "id": "11256994", "url": "https://pubmed.ncbi.nlm.nih.gov/11256994" } ], "uniprot_canonical_ac": "P78380-1" }, { "start_pos": 256, "end_pos": 256, "sequence_org": "C", "sequence_mut": "S", "comment": "Abolishes sorting into the cell surface and binding to acetylated LDL (AcLDL) while increasing N-glycosylation; when associated with S-144; S-155; S-172; S-243 and S-264.", "evidence": [ { "database": "UniProtKB", "id": "P78380", "url": "https://www.uniprot.org/uniprotkb/P78380" }, { "database": "PubMed", "id": "11256994", "url": "https://pubmed.ncbi.nlm.nih.gov/11256994" } ], "uniprot_canonical_ac": "P78380-1" }, { "start_pos": 264, "end_pos": 264, "sequence_org": "C", "sequence_mut": "S", "comment": "Abolishes sorting into the cell surface and binding to acetylated LDL (AcLDL) while increasing N-glycosylation; when associated with S-144; S-155; S-172; S-243 and S-256.", "evidence": [ { "database": "UniProtKB", "id": "P78380", "url": "https://www.uniprot.org/uniprotkb/P78380" }, { "database": "PubMed", "id": "11256994", "url": "https://pubmed.ncbi.nlm.nih.gov/11256994" } ], "uniprot_canonical_ac": "P78380-1" }, { "start_pos": 267, "end_pos": 273, "sequence_org": "KANLRAQ", "sequence_mut": "", "comment": "Impairs protein folding and transport.", "evidence": [ { "database": "UniProtKB", "id": "P78380", "url": "https://www.uniprot.org/uniprotkb/P78380" }, { "database": "PubMed", "id": "11256994", "url": "https://pubmed.ncbi.nlm.nih.gov/11256994" } ], "uniprot_canonical_ac": "P78380-1" } ], "record_id": "pubmed.11256994", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 151 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Mitogen-activated protein kinase kinase 4 metastasis suppressor gene expression is inversely related to histological pattern in advancing human prostatic cancers.", "journal": "Cancer research", "date": "2001", "authors": "Kim HL, Vander Griend DJ, Yang X, Benson DA, Dubauskas Z, Yoshida BA, Chekmareva MA, Ichikawa Y, Sokoloff MH, Zhan P, Karrison T, Lin A, Stadler WM, Ichikawa T, Rubin MA, Rinker-Schaeffer CW", "reference": { "type": "PubMed", "id": "11306453", "url": "https://pubmed.ncbi.nlm.nih.gov/11306453" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P01700-1", "protein_name": "Immunoglobulin lambda variable 1-47", "gene_name": "IGLV1-47", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01714-1", "protein_name": "Immunoglobulin lambda variable 3-19", "gene_name": "IGLV3-19", "tax_name": "Human" }, { "uniprot_canonical_ac": "P80748-1", "protein_name": "Immunoglobulin lambda variable 3-21", "gene_name": "IGLV3-21", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A075B6P5-1", "protein_name": "Immunoglobulin kappa variable 2-28", "gene_name": "IGKV2-28", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A075B6S6-1", "protein_name": "Immunoglobulin kappa variable 2D-30", "gene_name": "IGKV2D-30", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0C4DH25-1", "protein_name": "Immunoglobulin kappa variable 3D-20", "gene_name": "IGKV3D-20", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01593-1", "protein_name": "Immunoglobulin kappa variable 1D-33", "gene_name": "IGKV1D-33", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01599-1", "protein_name": "Immunoglobulin kappa variable 1-17", "gene_name": "IGKV1-17", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01601-1", "protein_name": "Immunoglobulin kappa variable 1D-16", "gene_name": "IGKV1D-16", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01611-1", "protein_name": "Immunoglobulin kappa variable 1D-12", "gene_name": "IGKV1D-12", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01615-1", "protein_name": "Immunoglobulin kappa variable 2D-28", "gene_name": "IGKV2D-28", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01619-1", "protein_name": "Immunoglobulin kappa variable 3-20", "gene_name": "IGKV3-20", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01624-1", "protein_name": "Immunoglobulin kappa variable 3-15", "gene_name": "IGKV3-15", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04433-1", "protein_name": "Immunoglobulin kappa variable 3-11", "gene_name": "IGKV3-11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01602-1", "protein_name": "Immunoglobulin kappa variable 1-5", "gene_name": "IGKV1-5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P28482-1", "protein_name": "Mitogen-activated protein kinase 1", "gene_name": "MAPK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P45984-1", "protein_name": "Mitogen-activated protein kinase 9", "gene_name": "MAPK9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13233-1", "protein_name": "Mitogen-activated protein kinase kinase kinase 1", "gene_name": "MAP3K1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13153-1", "protein_name": "Serine/threonine-protein kinase PAK 1", "gene_name": "PAK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13177-1", "protein_name": "Serine/threonine-protein kinase PAK 2", "gene_name": "PAK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01112-1", "protein_name": "GTPase HRas", "gene_name": "HRAS", "tax_name": "Human" }, { "uniprot_canonical_ac": "P53779-1", "protein_name": "Mitogen-activated protein kinase 10", "gene_name": "MAPK10", "tax_name": "Human" }, { "uniprot_canonical_ac": "P43405-1", "protein_name": "Tyrosine-protein kinase SYK", "gene_name": "SYK", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01362-1", "protein_name": "High affinity immunoglobulin epsilon receptor subunit beta", "gene_name": "MS4A2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P30273-1", "protein_name": "High affinity immunoglobulin epsilon receptor subunit gamma", "gene_name": "FCER1G", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01767-1", "protein_name": "Immunoglobulin heavy variable 3-53", "gene_name": "IGHV3-53", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06331-1", "protein_name": "Immunoglobulin heavy variable 4-34", "gene_name": "IGHV4-34", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01597-1", "protein_name": "Immunoglobulin kappa variable 1-39", "gene_name": "IGKV1-39", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06310-1", "protein_name": "Immunoglobulin kappa variable 2-30", "gene_name": "IGKV2-30", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06312-1", "protein_name": "Immunoglobulin kappa variable 4-1", "gene_name": "IGKV4-1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01614-1", "protein_name": "Immunoglobulin kappa variable 2D-40", "gene_name": "IGKV2D-40", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14733-1", "protein_name": "Dual specificity mitogen-activated protein kinase kinase 7", "gene_name": "MAP2K7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01111-1", "protein_name": "GTPase NRas", "gene_name": "NRAS", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DOY2-1", "protein_name": "Immunoglobulin lambda constant 2", "gene_name": "IGLC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75791-1", "protein_name": "GRB2-related adapter protein 2", "gene_name": "GRAP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04432-1", "protein_name": "Immunoglobulin kappa variable 1D-39", "gene_name": "IGKV1D-39", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06315-1", "protein_name": "Immunoglobulin kappa variable 5-2", "gene_name": "IGKV5-2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01699-1", "protein_name": "Immunoglobulin lambda variable 1-44", "gene_name": "IGLV1-44", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01701-1", "protein_name": "Immunoglobulin lambda variable 1-51", "gene_name": "IGLV1-51", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01704-1", "protein_name": "Immunoglobulin lambda variable 2-14", "gene_name": "IGLV2-14", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01706-1", "protein_name": "Immunoglobulin lambda variable 2-11", "gene_name": "IGLV2-11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01709-1", "protein_name": "Immunoglobulin lambda variable 2-8", "gene_name": "IGLV2-8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01717-1", "protein_name": "Immunoglobulin lambda variable 3-25", "gene_name": "IGLV3-25", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01721-1", "protein_name": "Immunoglobulin lambda variable 6-57", "gene_name": "IGLV6-57", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01703-1", "protein_name": "Immunoglobulin lambda variable 1-40", "gene_name": "IGLV1-40", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01705-1", "protein_name": "Immunoglobulin lambda variable 2-23", "gene_name": "IGLV2-23", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01715-1", "protein_name": "Immunoglobulin lambda variable 3-1", "gene_name": "IGLV3-1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01718-1", "protein_name": "Immunoglobulin lambda variable 3-27", "gene_name": "IGLV3-27", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04211-1", "protein_name": "Immunoglobulin lambda variable 7-43", "gene_name": "IGLV7-43", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q07889-1", "protein_name": "Son of sevenless homolog 1", "gene_name": "SOS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P45985-1", "protein_name": "Dual specificity mitogen-activated protein kinase kinase 4", "gene_name": "MAP2K4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CF74-1", "protein_name": "Immunoglobulin lambda constant 6", "gene_name": "IGLC6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P52735-1", "protein_name": "Guanine nucleotide exchange factor VAV2", "gene_name": "VAV2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P63000-1", "protein_name": "Ras-related C3 botulinum toxin substrate 1", "gene_name": "RAC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P07948-1", "protein_name": "Tyrosine-protein kinase Lyn", "gene_name": "LYN", "tax_name": "Human" }, { "uniprot_canonical_ac": "P16885-1", "protein_name": "1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-2", "gene_name": "PLCG2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UKW4-1", "protein_name": "Guanine nucleotide exchange factor VAV3", "gene_name": "VAV3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P45983-1", "protein_name": "Mitogen-activated protein kinase 8", "gene_name": "MAPK8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01825-1", "protein_name": "Immunoglobulin heavy variable 4-59", "gene_name": "IGHV4-59", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01817-1", "protein_name": "Immunoglobulin heavy variable 2-5", "gene_name": "IGHV2-5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01824-1", "protein_name": "Immunoglobulin heavy variable 4-39", "gene_name": "IGHV4-39", "tax_name": "Human" }, { "uniprot_canonical_ac": "P23083-1", "protein_name": "Immunoglobulin heavy variable 1-2", "gene_name": "IGHV1-2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01742-1", "protein_name": "Immunoglobulin heavy variable 1-69", "gene_name": "IGHV1-69", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01768-1", "protein_name": "Immunoglobulin heavy variable 3-30", "gene_name": "IGHV3-30", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01814-1", "protein_name": "Immunoglobulin heavy variable 2-70", "gene_name": "IGHV2-70", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01772-1", "protein_name": "Immunoglobulin heavy variable 3-33", "gene_name": "IGHV3-33", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01762-1", "protein_name": "Immunoglobulin heavy variable 3-11", "gene_name": "IGHV3-11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01763-1", "protein_name": "Immunoglobulin heavy variable 3-48", "gene_name": "IGHV3-48", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01764-1", "protein_name": "Immunoglobulin heavy variable 3-23", "gene_name": "IGHV3-23", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01766-1", "protein_name": "Immunoglobulin heavy variable 3-13", "gene_name": "IGHV3-13", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01780-1", "protein_name": "Immunoglobulin heavy variable 3-7", "gene_name": "IGHV3-7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01782-1", "protein_name": "Immunoglobulin heavy variable 3-9", "gene_name": "IGHV3-9", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0M8Q6-1", "protein_name": "Immunoglobulin lambda constant 7", "gene_name": "IGLC7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01834-1", "protein_name": "Immunoglobulin kappa constant", "gene_name": "IGKC", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG04-1", "protein_name": "Immunoglobulin lambda constant 1", "gene_name": "IGLC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DOY3-1", "protein_name": "Immunoglobulin lambda constant 3", "gene_name": "IGLC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13094-1", "protein_name": "Lymphocyte cytosolic protein 2", "gene_name": "LCP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27361-1", "protein_name": "Mitogen-activated protein kinase 3", "gene_name": "MAPK3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01743-1", "protein_name": "Immunoglobulin heavy variable 1-46", "gene_name": "IGHV1-46", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01854-2", "protein_name": "Immunoglobulin heavy constant epsilon", "gene_name": "IGHE", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0C4DH73-1", "protein_name": "Immunoglobulin kappa variable 1-12", "gene_name": "IGKV1-12", "tax_name": "Human" }, { "uniprot_canonical_ac": "A2NJV5-1", "protein_name": "Immunoglobulin kappa variable 2-29", "gene_name": "IGKV2-29", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01594-1", "protein_name": "Immunoglobulin kappa variable 1-33", "gene_name": "IGKV1-33", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04430-1", "protein_name": "Immunoglobulin kappa variable 1-16", "gene_name": "IGKV1-16", "tax_name": "Human" }, { "uniprot_canonical_ac": "P12319-1", "protein_name": "High affinity immunoglobulin epsilon receptor subunit alpha", "gene_name": "FCER1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01100-1", "protein_name": "Protein c-Fos", "gene_name": "FOS", "tax_name": "Human" }, { "uniprot_canonical_ac": "P19174-1", "protein_name": "1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-1", "gene_name": "PLCG1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05412-1", "protein_name": "Transcription factor Jun", "gene_name": "JUN", "tax_name": "Human" }, { "uniprot_canonical_ac": "P15498-1", "protein_name": "Proto-oncogene vav", "gene_name": "VAV1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P01700", "url": "https://www.uniprot.org/uniprotkb/P01700" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.11306453", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 89 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Vav1 regulates phospholipase cgamma activation and calcium responses in mast cells.", "journal": "Molecular and cellular biology", "date": "2001", "authors": "Manetz TS, Gonzalez-Espinosa C, Arudchandran R, Xirasagar S, Tybulewicz V, Rivera J", "reference": { "type": "PubMed", "id": "11340169", "url": "https://pubmed.ncbi.nlm.nih.gov/11340169" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P01700-1", "protein_name": "Immunoglobulin lambda variable 1-47", "gene_name": "IGLV1-47", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01714-1", "protein_name": "Immunoglobulin lambda variable 3-19", "gene_name": "IGLV3-19", "tax_name": "Human" }, { "uniprot_canonical_ac": "P80748-1", "protein_name": "Immunoglobulin lambda variable 3-21", "gene_name": "IGLV3-21", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A075B6P5-1", "protein_name": "Immunoglobulin kappa variable 2-28", "gene_name": "IGKV2-28", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A075B6S6-1", "protein_name": "Immunoglobulin kappa variable 2D-30", "gene_name": "IGKV2D-30", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0C4DH25-1", "protein_name": "Immunoglobulin kappa variable 3D-20", "gene_name": "IGKV3D-20", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01593-1", "protein_name": "Immunoglobulin kappa variable 1D-33", "gene_name": "IGKV1D-33", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01599-1", "protein_name": "Immunoglobulin kappa variable 1-17", "gene_name": "IGKV1-17", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01601-1", "protein_name": "Immunoglobulin kappa variable 1D-16", "gene_name": "IGKV1D-16", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01611-1", "protein_name": "Immunoglobulin kappa variable 1D-12", "gene_name": "IGKV1D-12", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01615-1", "protein_name": "Immunoglobulin kappa variable 2D-28", "gene_name": "IGKV2D-28", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01619-1", "protein_name": "Immunoglobulin kappa variable 3-20", "gene_name": "IGKV3-20", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01624-1", "protein_name": "Immunoglobulin kappa variable 3-15", "gene_name": "IGKV3-15", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04433-1", "protein_name": "Immunoglobulin kappa variable 3-11", "gene_name": "IGKV3-11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01602-1", "protein_name": "Immunoglobulin kappa variable 1-5", "gene_name": "IGKV1-5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P28482-1", "protein_name": "Mitogen-activated protein kinase 1", "gene_name": "MAPK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P45984-1", "protein_name": "Mitogen-activated protein kinase 9", "gene_name": "MAPK9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13233-1", "protein_name": "Mitogen-activated protein kinase kinase kinase 1", "gene_name": "MAP3K1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13153-1", "protein_name": "Serine/threonine-protein kinase PAK 1", "gene_name": "PAK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13177-1", "protein_name": "Serine/threonine-protein kinase PAK 2", "gene_name": "PAK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01112-1", "protein_name": "GTPase HRas", "gene_name": "HRAS", "tax_name": "Human" }, { "uniprot_canonical_ac": "P53779-1", "protein_name": "Mitogen-activated protein kinase 10", "gene_name": "MAPK10", "tax_name": "Human" }, { "uniprot_canonical_ac": "P43405-1", "protein_name": "Tyrosine-protein kinase SYK", "gene_name": "SYK", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01362-1", "protein_name": "High affinity immunoglobulin epsilon receptor subunit beta", "gene_name": "MS4A2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P30273-1", "protein_name": "High affinity immunoglobulin epsilon receptor subunit gamma", "gene_name": "FCER1G", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01767-1", "protein_name": "Immunoglobulin heavy variable 3-53", "gene_name": "IGHV3-53", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06331-1", "protein_name": "Immunoglobulin heavy variable 4-34", "gene_name": "IGHV4-34", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01597-1", "protein_name": "Immunoglobulin kappa variable 1-39", "gene_name": "IGKV1-39", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06310-1", "protein_name": "Immunoglobulin kappa variable 2-30", "gene_name": "IGKV2-30", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06312-1", "protein_name": "Immunoglobulin kappa variable 4-1", "gene_name": "IGKV4-1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01614-1", "protein_name": "Immunoglobulin kappa variable 2D-40", "gene_name": "IGKV2D-40", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14733-1", "protein_name": "Dual specificity mitogen-activated protein kinase kinase 7", "gene_name": "MAP2K7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01111-1", "protein_name": "GTPase NRas", "gene_name": "NRAS", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DOY2-1", "protein_name": "Immunoglobulin lambda constant 2", "gene_name": "IGLC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75791-1", "protein_name": "GRB2-related adapter protein 2", "gene_name": "GRAP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04432-1", "protein_name": "Immunoglobulin kappa variable 1D-39", "gene_name": "IGKV1D-39", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06315-1", "protein_name": "Immunoglobulin kappa variable 5-2", "gene_name": "IGKV5-2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01699-1", "protein_name": "Immunoglobulin lambda variable 1-44", "gene_name": "IGLV1-44", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01701-1", "protein_name": "Immunoglobulin lambda variable 1-51", "gene_name": "IGLV1-51", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01704-1", "protein_name": "Immunoglobulin lambda variable 2-14", "gene_name": "IGLV2-14", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01706-1", "protein_name": "Immunoglobulin lambda variable 2-11", "gene_name": "IGLV2-11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01709-1", "protein_name": "Immunoglobulin lambda variable 2-8", "gene_name": "IGLV2-8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01717-1", "protein_name": "Immunoglobulin lambda variable 3-25", "gene_name": "IGLV3-25", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01721-1", "protein_name": "Immunoglobulin lambda variable 6-57", "gene_name": "IGLV6-57", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01703-1", "protein_name": "Immunoglobulin lambda variable 1-40", "gene_name": "IGLV1-40", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01705-1", "protein_name": "Immunoglobulin lambda variable 2-23", "gene_name": "IGLV2-23", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01715-1", "protein_name": "Immunoglobulin lambda variable 3-1", "gene_name": "IGLV3-1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01718-1", "protein_name": "Immunoglobulin lambda variable 3-27", "gene_name": "IGLV3-27", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04211-1", "protein_name": "Immunoglobulin lambda variable 7-43", "gene_name": "IGLV7-43", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q07889-1", "protein_name": "Son of sevenless homolog 1", "gene_name": "SOS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P45985-1", "protein_name": "Dual specificity mitogen-activated protein kinase kinase 4", "gene_name": "MAP2K4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CF74-1", "protein_name": "Immunoglobulin lambda constant 6", "gene_name": "IGLC6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P52735-1", "protein_name": "Guanine nucleotide exchange factor VAV2", "gene_name": "VAV2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P63000-1", "protein_name": "Ras-related C3 botulinum toxin substrate 1", "gene_name": "RAC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P07948-1", "protein_name": "Tyrosine-protein kinase Lyn", "gene_name": "LYN", "tax_name": "Human" }, { "uniprot_canonical_ac": "P16885-1", "protein_name": "1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-2", "gene_name": "PLCG2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UKW4-1", "protein_name": "Guanine nucleotide exchange factor VAV3", "gene_name": "VAV3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P45983-1", "protein_name": "Mitogen-activated protein kinase 8", "gene_name": "MAPK8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01825-1", "protein_name": "Immunoglobulin heavy variable 4-59", "gene_name": "IGHV4-59", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01817-1", "protein_name": "Immunoglobulin heavy variable 2-5", "gene_name": "IGHV2-5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01824-1", "protein_name": "Immunoglobulin heavy variable 4-39", "gene_name": "IGHV4-39", "tax_name": "Human" }, { "uniprot_canonical_ac": "P23083-1", "protein_name": "Immunoglobulin heavy variable 1-2", "gene_name": "IGHV1-2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01742-1", "protein_name": "Immunoglobulin heavy variable 1-69", "gene_name": "IGHV1-69", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01768-1", "protein_name": "Immunoglobulin heavy variable 3-30", "gene_name": "IGHV3-30", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01814-1", "protein_name": "Immunoglobulin heavy variable 2-70", "gene_name": "IGHV2-70", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01772-1", "protein_name": "Immunoglobulin heavy variable 3-33", "gene_name": "IGHV3-33", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01762-1", "protein_name": "Immunoglobulin heavy variable 3-11", "gene_name": "IGHV3-11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01763-1", "protein_name": "Immunoglobulin heavy variable 3-48", "gene_name": "IGHV3-48", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01764-1", "protein_name": "Immunoglobulin heavy variable 3-23", "gene_name": "IGHV3-23", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01766-1", "protein_name": "Immunoglobulin heavy variable 3-13", "gene_name": "IGHV3-13", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01780-1", "protein_name": "Immunoglobulin heavy variable 3-7", "gene_name": "IGHV3-7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01782-1", "protein_name": "Immunoglobulin heavy variable 3-9", "gene_name": "IGHV3-9", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0M8Q6-1", "protein_name": "Immunoglobulin lambda constant 7", "gene_name": "IGLC7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01834-1", "protein_name": "Immunoglobulin kappa constant", "gene_name": "IGKC", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG04-1", "protein_name": "Immunoglobulin lambda constant 1", "gene_name": "IGLC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DOY3-1", "protein_name": "Immunoglobulin lambda constant 3", "gene_name": "IGLC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13094-1", "protein_name": "Lymphocyte cytosolic protein 2", "gene_name": "LCP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27361-1", "protein_name": "Mitogen-activated protein kinase 3", "gene_name": "MAPK3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01743-1", "protein_name": "Immunoglobulin heavy variable 1-46", "gene_name": "IGHV1-46", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01854-2", "protein_name": "Immunoglobulin heavy constant epsilon", "gene_name": "IGHE", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0C4DH73-1", "protein_name": "Immunoglobulin kappa variable 1-12", "gene_name": "IGKV1-12", "tax_name": "Human" }, { "uniprot_canonical_ac": "A2NJV5-1", "protein_name": "Immunoglobulin kappa variable 2-29", "gene_name": "IGKV2-29", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01594-1", "protein_name": "Immunoglobulin kappa variable 1-33", "gene_name": "IGKV1-33", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04430-1", "protein_name": "Immunoglobulin kappa variable 1-16", "gene_name": "IGKV1-16", "tax_name": "Human" }, { "uniprot_canonical_ac": "P12319-1", "protein_name": "High affinity immunoglobulin epsilon receptor subunit alpha", "gene_name": "FCER1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01100-1", "protein_name": "Protein c-Fos", "gene_name": "FOS", "tax_name": "Human" }, { "uniprot_canonical_ac": "P19174-1", "protein_name": "1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-1", "gene_name": "PLCG1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05412-1", "protein_name": "Transcription factor Jun", "gene_name": "JUN", "tax_name": "Human" }, { "uniprot_canonical_ac": "P15498-1", "protein_name": "Proto-oncogene vav", "gene_name": "VAV1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P01700", "url": "https://www.uniprot.org/uniprotkb/P01700" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.11340169", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 89 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Mapping the Zap-70 phosphorylation sites on LAT (linker for activation of T cells) required for recruitment and activation of signalling proteins in T cells.", "journal": "The Biochemical journal", "date": "2001", "authors": "Paz PE, Wang S, Clarke H, Lu X, Stokoe D, Abo A", "reference": { "type": "PubMed", "id": "11368773", "url": "https://pubmed.ncbi.nlm.nih.gov/11368773" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P01700-1", "protein_name": "Immunoglobulin lambda variable 1-47", "gene_name": "IGLV1-47", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01714-1", "protein_name": "Immunoglobulin lambda variable 3-19", "gene_name": "IGLV3-19", "tax_name": "Human" }, { "uniprot_canonical_ac": "P80748-1", "protein_name": "Immunoglobulin lambda variable 3-21", "gene_name": "IGLV3-21", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A075B6P5-1", "protein_name": "Immunoglobulin kappa variable 2-28", "gene_name": "IGKV2-28", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A075B6S6-1", "protein_name": "Immunoglobulin kappa variable 2D-30", "gene_name": "IGKV2D-30", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0C4DH25-1", "protein_name": "Immunoglobulin kappa variable 3D-20", "gene_name": "IGKV3D-20", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01593-1", "protein_name": "Immunoglobulin kappa variable 1D-33", "gene_name": "IGKV1D-33", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01599-1", "protein_name": "Immunoglobulin kappa variable 1-17", "gene_name": "IGKV1-17", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01601-1", "protein_name": "Immunoglobulin kappa variable 1D-16", "gene_name": "IGKV1D-16", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01611-1", "protein_name": "Immunoglobulin kappa variable 1D-12", "gene_name": "IGKV1D-12", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01615-1", "protein_name": "Immunoglobulin kappa variable 2D-28", "gene_name": "IGKV2D-28", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01619-1", "protein_name": "Immunoglobulin kappa variable 3-20", "gene_name": "IGKV3-20", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01624-1", "protein_name": "Immunoglobulin kappa variable 3-15", "gene_name": "IGKV3-15", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04433-1", "protein_name": "Immunoglobulin kappa variable 3-11", "gene_name": "IGKV3-11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01602-1", "protein_name": "Immunoglobulin kappa variable 1-5", "gene_name": "IGKV1-5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01112-1", "protein_name": "GTPase HRas", "gene_name": "HRAS", "tax_name": "Human" }, { "uniprot_canonical_ac": "P43405-1", "protein_name": "Tyrosine-protein kinase SYK", "gene_name": "SYK", "tax_name": "Human" }, { "uniprot_canonical_ac": "P26717-1", "protein_name": "NKG2-C type II integral membrane protein", "gene_name": "KLRC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42336-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform", "gene_name": "PIK3CA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01362-1", "protein_name": "High affinity immunoglobulin epsilon receptor subunit beta", "gene_name": "MS4A2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P30273-1", "protein_name": "High affinity immunoglobulin epsilon receptor subunit gamma", "gene_name": "FCER1G", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01767-1", "protein_name": "Immunoglobulin heavy variable 3-53", "gene_name": "IGHV3-53", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06331-1", "protein_name": "Immunoglobulin heavy variable 4-34", "gene_name": "IGHV4-34", "tax_name": "Human" }, { "uniprot_canonical_ac": "P26718-1", "protein_name": "NKG2-D type II integral membrane protein", "gene_name": "KLRK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01597-1", "protein_name": "Immunoglobulin kappa variable 1-39", "gene_name": "IGKV1-39", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06310-1", "protein_name": "Immunoglobulin kappa variable 2-30", "gene_name": "IGKV2-30", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06312-1", "protein_name": "Immunoglobulin kappa variable 4-1", "gene_name": "IGKV4-1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01614-1", "protein_name": "Immunoglobulin kappa variable 2D-40", "gene_name": "IGKV2D-40", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01111-1", "protein_name": "GTPase NRas", "gene_name": "NRAS", "tax_name": "Human" }, { "uniprot_canonical_ac": "P13747-1", "protein_name": "HLA class I histocompatibility antigen, alpha chain E", "gene_name": "HLA-E", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DOY2-1", "protein_name": "Immunoglobulin lambda constant 2", "gene_name": "IGLC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43561-1", "protein_name": "Linker for activation of T-cells family member 1", "gene_name": "LAT", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75791-1", "protein_name": "GRB2-related adapter protein 2", "gene_name": "GRAP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04432-1", "protein_name": "Immunoglobulin kappa variable 1D-39", "gene_name": "IGKV1D-39", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06315-1", "protein_name": "Immunoglobulin kappa variable 5-2", "gene_name": "IGKV5-2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01699-1", "protein_name": "Immunoglobulin lambda variable 1-44", "gene_name": "IGLV1-44", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01701-1", "protein_name": "Immunoglobulin lambda variable 1-51", "gene_name": "IGLV1-51", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01704-1", "protein_name": "Immunoglobulin lambda variable 2-14", "gene_name": "IGLV2-14", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01706-1", "protein_name": "Immunoglobulin lambda variable 2-11", "gene_name": "IGLV2-11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01709-1", "protein_name": "Immunoglobulin lambda variable 2-8", "gene_name": "IGLV2-8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01717-1", "protein_name": "Immunoglobulin lambda variable 3-25", "gene_name": "IGLV3-25", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01721-1", "protein_name": "Immunoglobulin lambda variable 6-57", "gene_name": "IGLV6-57", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01703-1", "protein_name": "Immunoglobulin lambda variable 1-40", "gene_name": "IGLV1-40", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01705-1", "protein_name": "Immunoglobulin lambda variable 2-23", "gene_name": "IGLV2-23", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01715-1", "protein_name": "Immunoglobulin lambda variable 3-1", "gene_name": "IGLV3-1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01718-1", "protein_name": "Immunoglobulin lambda variable 3-27", "gene_name": "IGLV3-27", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04211-1", "protein_name": "Immunoglobulin lambda variable 7-43", "gene_name": "IGLV7-43", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13241-1", "protein_name": "Natural killer cells antigen CD94", "gene_name": "KLRD1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q07889-1", "protein_name": "Son of sevenless homolog 1", "gene_name": "SOS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CF74-1", "protein_name": "Immunoglobulin lambda constant 6", "gene_name": "IGLC6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q06187-1", "protein_name": "Tyrosine-protein kinase BTK", "gene_name": "BTK", "tax_name": "Human" }, { "uniprot_canonical_ac": "P52735-1", "protein_name": "Guanine nucleotide exchange factor VAV2", "gene_name": "VAV2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61769-1", "protein_name": "Beta-2-microglobulin", "gene_name": "B2M", "tax_name": "Human" }, { "uniprot_canonical_ac": "P63000-1", "protein_name": "Ras-related C3 botulinum toxin substrate 1", "gene_name": "RAC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00459-1", "protein_name": "Phosphatidylinositol 3-kinase regulatory subunit beta", "gene_name": "PIK3R2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06239-1", "protein_name": "Tyrosine-protein kinase Lck", "gene_name": "LCK", "tax_name": "Human" }, { "uniprot_canonical_ac": "P07948-1", "protein_name": "Tyrosine-protein kinase Lyn", "gene_name": "LYN", "tax_name": "Human" }, { "uniprot_canonical_ac": "P16885-1", "protein_name": "1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-2", "gene_name": "PLCG2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UKW4-1", "protein_name": "Guanine nucleotide exchange factor VAV3", "gene_name": "VAV3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01825-1", "protein_name": "Immunoglobulin heavy variable 4-59", "gene_name": "IGHV4-59", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42338-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit beta isoform", "gene_name": "PIK3CB", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01817-1", "protein_name": "Immunoglobulin heavy variable 2-5", "gene_name": "IGHV2-5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01824-1", "protein_name": "Immunoglobulin heavy variable 4-39", "gene_name": "IGHV4-39", "tax_name": "Human" }, { "uniprot_canonical_ac": "P23083-1", "protein_name": "Immunoglobulin heavy variable 1-2", "gene_name": "IGHV1-2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43914-1", "protein_name": "TYRO protein tyrosine kinase-binding protein", "gene_name": "TYROBP", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01742-1", "protein_name": "Immunoglobulin heavy variable 1-69", "gene_name": "IGHV1-69", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01768-1", "protein_name": "Immunoglobulin heavy variable 3-30", "gene_name": "IGHV3-30", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01814-1", "protein_name": "Immunoglobulin heavy variable 2-70", "gene_name": "IGHV2-70", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01772-1", "protein_name": "Immunoglobulin heavy variable 3-33", "gene_name": "IGHV3-33", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01762-1", "protein_name": "Immunoglobulin heavy variable 3-11", "gene_name": "IGHV3-11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01763-1", "protein_name": "Immunoglobulin heavy variable 3-48", "gene_name": "IGHV3-48", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01764-1", "protein_name": "Immunoglobulin heavy variable 3-23", "gene_name": "IGHV3-23", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01766-1", "protein_name": "Immunoglobulin heavy variable 3-13", "gene_name": "IGHV3-13", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01780-1", "protein_name": "Immunoglobulin heavy variable 3-7", "gene_name": "IGHV3-7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01782-1", "protein_name": "Immunoglobulin heavy variable 3-9", "gene_name": "IGHV3-9", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0M8Q6-1", "protein_name": "Immunoglobulin lambda constant 7", "gene_name": "IGLC7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01834-1", "protein_name": "Immunoglobulin kappa constant", "gene_name": "IGKC", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG04-1", "protein_name": "Immunoglobulin lambda constant 1", "gene_name": "IGLC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DOY3-1", "protein_name": "Immunoglobulin lambda constant 3", "gene_name": "IGLC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NZC2-1", "protein_name": "Triggering receptor expressed on myeloid cells 2", "gene_name": "TREM2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13094-1", "protein_name": "Lymphocyte cytosolic protein 2", "gene_name": "LCP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01743-1", "protein_name": "Immunoglobulin heavy variable 1-46", "gene_name": "IGHV1-46", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01854-2", "protein_name": "Immunoglobulin heavy constant epsilon", "gene_name": "IGHE", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0C4DH73-1", "protein_name": "Immunoglobulin kappa variable 1-12", "gene_name": "IGKV1-12", "tax_name": "Human" }, { "uniprot_canonical_ac": "A2NJV5-1", "protein_name": "Immunoglobulin kappa variable 2-29", "gene_name": "IGKV2-29", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01594-1", "protein_name": "Immunoglobulin kappa variable 1-33", "gene_name": "IGKV1-33", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04430-1", "protein_name": "Immunoglobulin kappa variable 1-16", "gene_name": "IGKV1-16", "tax_name": "Human" }, { "uniprot_canonical_ac": "P12319-1", "protein_name": "High affinity immunoglobulin epsilon receptor subunit alpha", "gene_name": "FCER1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27986-1", "protein_name": "Phosphatidylinositol 3-kinase regulatory subunit alpha", "gene_name": "PIK3R1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P19174-1", "protein_name": "1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-1", "gene_name": "PLCG1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06241-1", "protein_name": "Tyrosine-protein kinase Fyn", "gene_name": "FYN", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P01700", "url": "https://www.uniprot.org/uniprotkb/P01700" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 161, "end_pos": 161, "sequence_org": "Y", "sequence_mut": "F", "comment": "Abolishes interaction with PLCG1.", "evidence": [ { "database": "UniProtKB", "id": "O43561", "url": "https://www.uniprot.org/uniprotkb/O43561" }, { "database": "PubMed", "id": "11368773", "url": "https://pubmed.ncbi.nlm.nih.gov/11368773" } ], "uniprot_canonical_ac": "O43561-1" } ], "phosphorylation": [ { "start_pos": 156, "end_pos": 156, "kinase_uniprot_canonical_ac": "P43403-1", "kinase_gene_name": "ZAP70", "residue": "Tyr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O43561", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O43561" }, { "database": "PubMed", "id": "11368773", "url": "https://pubmed.ncbi.nlm.nih.gov/11368773" } ], "site_lbl": "Tyr156", "uniprot_canonical_ac": "O43561-1" }, { "start_pos": 161, "end_pos": 161, "kinase_uniprot_canonical_ac": "P43403-1", "kinase_gene_name": "ZAP70", "residue": "Tyr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O43561", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O43561" }, { "database": "PubMed", "id": "11368773", "url": "https://pubmed.ncbi.nlm.nih.gov/11368773" } ], "site_lbl": "Tyr161", "uniprot_canonical_ac": "O43561-1" }, { "start_pos": 200, "end_pos": 200, "kinase_uniprot_canonical_ac": "P43403-1", "kinase_gene_name": "ZAP70", "residue": "Tyr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O43561", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O43561" }, { "database": "PubMed", "id": "11368773", "url": "https://pubmed.ncbi.nlm.nih.gov/11368773" } ], "site_lbl": "Tyr200", "uniprot_canonical_ac": "O43561-1" }, { "start_pos": 220, "end_pos": 220, "kinase_uniprot_canonical_ac": "P43403-1", "kinase_gene_name": "ZAP70", "residue": "Tyr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O43561", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O43561" }, { "database": "PubMed", "id": "11368773", "url": "https://pubmed.ncbi.nlm.nih.gov/11368773" } ], "site_lbl": "Tyr220", "uniprot_canonical_ac": "O43561-1" }, { "start_pos": 255, "end_pos": 255, "kinase_uniprot_canonical_ac": "P43403-1", "kinase_gene_name": "ZAP70", "residue": "Tyr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O43561", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O43561" }, { "database": "PubMed", "id": "11368773", "url": "https://pubmed.ncbi.nlm.nih.gov/11368773" } ], "site_lbl": "Tyr255", "uniprot_canonical_ac": "O43561-1" } ], "record_id": "pubmed.11368773", "abstract": "", "glycosylation": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 91 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 5 }, { "field": "total_sites", "count": 5 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Regulation of phosphoinositide-specific phospholipase C.", "journal": "Annual review of biochemistry", "date": "2001", "authors": "Rhee SG", "reference": { "type": "PubMed", "id": "11395409", "url": "https://pubmed.ncbi.nlm.nih.gov/11395409" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P01700-1", "protein_name": "Immunoglobulin lambda variable 1-47", "gene_name": "IGLV1-47", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01714-1", "protein_name": "Immunoglobulin lambda variable 3-19", "gene_name": "IGLV3-19", "tax_name": "Human" }, { "uniprot_canonical_ac": "P80748-1", "protein_name": "Immunoglobulin lambda variable 3-21", "gene_name": "IGLV3-21", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A075B6P5-1", "protein_name": "Immunoglobulin kappa variable 2-28", "gene_name": "IGKV2-28", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A075B6S6-1", "protein_name": "Immunoglobulin kappa variable 2D-30", "gene_name": "IGKV2D-30", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0C4DH25-1", "protein_name": "Immunoglobulin kappa variable 3D-20", "gene_name": "IGKV3D-20", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01593-1", "protein_name": "Immunoglobulin kappa variable 1D-33", "gene_name": "IGKV1D-33", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01599-1", "protein_name": "Immunoglobulin kappa variable 1-17", "gene_name": "IGKV1-17", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01601-1", "protein_name": "Immunoglobulin kappa variable 1D-16", "gene_name": "IGKV1D-16", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01611-1", "protein_name": "Immunoglobulin kappa variable 1D-12", "gene_name": "IGKV1D-12", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01615-1", "protein_name": "Immunoglobulin kappa variable 2D-28", "gene_name": "IGKV2D-28", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01619-1", "protein_name": "Immunoglobulin kappa variable 3-20", "gene_name": "IGKV3-20", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01624-1", "protein_name": "Immunoglobulin kappa variable 3-15", "gene_name": "IGKV3-15", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04433-1", "protein_name": "Immunoglobulin kappa variable 3-11", "gene_name": "IGKV3-11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01602-1", "protein_name": "Immunoglobulin kappa variable 1-5", "gene_name": "IGKV1-5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14643-1", "protein_name": "Inositol 1,4,5-trisphosphate-gated calcium channel ITPR1", "gene_name": "ITPR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95644-1", "protein_name": "Nuclear factor of activated T-cells, cytoplasmic 1", "gene_name": "NFATC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P43405-1", "protein_name": "Tyrosine-protein kinase SYK", "gene_name": "SYK", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12968-1", "protein_name": "Nuclear factor of activated T-cells, cytoplasmic 3", "gene_name": "NFATC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13469-1", "protein_name": "Nuclear factor of activated T-cells, cytoplasmic 2", "gene_name": "NFATC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01362-1", "protein_name": "High affinity immunoglobulin epsilon receptor subunit beta", "gene_name": "MS4A2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P30273-1", "protein_name": "High affinity immunoglobulin epsilon receptor subunit gamma", "gene_name": "FCER1G", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01767-1", "protein_name": "Immunoglobulin heavy variable 3-53", "gene_name": "IGHV3-53", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06331-1", "protein_name": "Immunoglobulin heavy variable 4-34", "gene_name": "IGHV4-34", "tax_name": "Human" }, { "uniprot_canonical_ac": "P16298-1", "protein_name": "Serine/threonine-protein phosphatase 2B catalytic subunit beta isoform", "gene_name": "PPP3CB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14571-1", "protein_name": "Inositol 1,4,5-trisphosphate-gated calcium channel ITPR2", "gene_name": "ITPR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01597-1", "protein_name": "Immunoglobulin kappa variable 1-39", "gene_name": "IGKV1-39", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06310-1", "protein_name": "Immunoglobulin kappa variable 2-30", "gene_name": "IGKV2-30", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06312-1", "protein_name": "Immunoglobulin kappa variable 4-1", "gene_name": "IGKV4-1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01614-1", "protein_name": "Immunoglobulin kappa variable 2D-40", "gene_name": "IGKV2D-40", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DOY2-1", "protein_name": "Immunoglobulin lambda constant 2", "gene_name": "IGLC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75791-1", "protein_name": "GRB2-related adapter protein 2", "gene_name": "GRAP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DP23-1", "protein_name": "Calmodulin-1", "gene_name": "CALM1; CALM2; CALM3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04432-1", "protein_name": "Immunoglobulin kappa variable 1D-39", "gene_name": "IGKV1D-39", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06315-1", "protein_name": "Immunoglobulin kappa variable 5-2", "gene_name": "IGKV5-2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01699-1", "protein_name": "Immunoglobulin lambda variable 1-44", "gene_name": "IGLV1-44", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01701-1", "protein_name": "Immunoglobulin lambda variable 1-51", "gene_name": "IGLV1-51", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01704-1", "protein_name": "Immunoglobulin lambda variable 2-14", "gene_name": "IGLV2-14", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01706-1", "protein_name": "Immunoglobulin lambda variable 2-11", "gene_name": "IGLV2-11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01709-1", "protein_name": "Immunoglobulin lambda variable 2-8", "gene_name": "IGLV2-8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01717-1", "protein_name": "Immunoglobulin lambda variable 3-25", "gene_name": "IGLV3-25", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01721-1", "protein_name": "Immunoglobulin lambda variable 6-57", "gene_name": "IGLV6-57", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01703-1", "protein_name": "Immunoglobulin lambda variable 1-40", "gene_name": "IGLV1-40", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01705-1", "protein_name": "Immunoglobulin lambda variable 2-23", "gene_name": "IGLV2-23", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01715-1", "protein_name": "Immunoglobulin lambda variable 3-1", "gene_name": "IGLV3-1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01718-1", "protein_name": "Immunoglobulin lambda variable 3-27", "gene_name": "IGLV3-27", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04211-1", "protein_name": "Immunoglobulin lambda variable 7-43", "gene_name": "IGLV7-43", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q07889-1", "protein_name": "Son of sevenless homolog 1", "gene_name": "SOS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CF74-1", "protein_name": "Immunoglobulin lambda constant 6", "gene_name": "IGLC6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q06187-1", "protein_name": "Tyrosine-protein kinase BTK", "gene_name": "BTK", "tax_name": "Human" }, { "uniprot_canonical_ac": "P52735-1", "protein_name": "Guanine nucleotide exchange factor VAV2", "gene_name": "VAV2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P07948-1", "protein_name": "Tyrosine-protein kinase Lyn", "gene_name": "LYN", "tax_name": "Human" }, { "uniprot_canonical_ac": "P16885-1", "protein_name": "1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-2", "gene_name": "PLCG2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UKW4-1", "protein_name": "Guanine nucleotide exchange factor VAV3", "gene_name": "VAV3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42680-1", "protein_name": "Tyrosine-protein kinase Tec", "gene_name": "TEC", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43865-1", "protein_name": "S-adenosylhomocysteine hydrolase-like protein 1", "gene_name": "AHCYL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P63098-1", "protein_name": "Calcineurin subunit B type 1", "gene_name": "PPP3R1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q08209-1", "protein_name": "Protein phosphatase 3 catalytic subunit alpha", "gene_name": "PPP3CA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42681-1", "protein_name": "Tyrosine-protein kinase TXK", "gene_name": "TXK", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01825-1", "protein_name": "Immunoglobulin heavy variable 4-59", "gene_name": "IGHV4-59", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01817-1", "protein_name": "Immunoglobulin heavy variable 2-5", "gene_name": "IGHV2-5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01824-1", "protein_name": "Immunoglobulin heavy variable 4-39", "gene_name": "IGHV4-39", "tax_name": "Human" }, { "uniprot_canonical_ac": "P23083-1", "protein_name": "Immunoglobulin heavy variable 1-2", "gene_name": "IGHV1-2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01742-1", "protein_name": "Immunoglobulin heavy variable 1-69", "gene_name": "IGHV1-69", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01768-1", "protein_name": "Immunoglobulin heavy variable 3-30", "gene_name": "IGHV3-30", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01814-1", "protein_name": "Immunoglobulin heavy variable 2-70", "gene_name": "IGHV2-70", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01772-1", "protein_name": "Immunoglobulin heavy variable 3-33", "gene_name": "IGHV3-33", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01762-1", "protein_name": "Immunoglobulin heavy variable 3-11", "gene_name": "IGHV3-11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01763-1", "protein_name": "Immunoglobulin heavy variable 3-48", "gene_name": "IGHV3-48", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01764-1", "protein_name": "Immunoglobulin heavy variable 3-23", "gene_name": "IGHV3-23", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01766-1", "protein_name": "Immunoglobulin heavy variable 3-13", "gene_name": "IGHV3-13", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01780-1", "protein_name": "Immunoglobulin heavy variable 3-7", "gene_name": "IGHV3-7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01782-1", "protein_name": "Immunoglobulin heavy variable 3-9", "gene_name": "IGHV3-9", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0M8Q6-1", "protein_name": "Immunoglobulin lambda constant 7", "gene_name": "IGLC7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01834-1", "protein_name": "Immunoglobulin kappa constant", "gene_name": "IGKC", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG04-1", "protein_name": "Immunoglobulin lambda constant 1", "gene_name": "IGLC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DOY3-1", "protein_name": "Immunoglobulin lambda constant 3", "gene_name": "IGLC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13094-1", "protein_name": "Lymphocyte cytosolic protein 2", "gene_name": "LCP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01743-1", "protein_name": "Immunoglobulin heavy variable 1-46", "gene_name": "IGHV1-46", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01854-2", "protein_name": "Immunoglobulin heavy constant epsilon", "gene_name": "IGHE", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14573-1", "protein_name": "Inositol 1,4,5-trisphosphate-gated calcium channel ITPR3", "gene_name": "ITPR3", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0C4DH73-1", "protein_name": "Immunoglobulin kappa variable 1-12", "gene_name": "IGKV1-12", "tax_name": "Human" }, { "uniprot_canonical_ac": "A2NJV5-1", "protein_name": "Immunoglobulin kappa variable 2-29", "gene_name": "IGKV2-29", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01594-1", "protein_name": "Immunoglobulin kappa variable 1-33", "gene_name": "IGKV1-33", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04430-1", "protein_name": "Immunoglobulin kappa variable 1-16", "gene_name": "IGKV1-16", "tax_name": "Human" }, { "uniprot_canonical_ac": "P12319-1", "protein_name": "High affinity immunoglobulin epsilon receptor subunit alpha", "gene_name": "FCER1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q08881-1", "protein_name": "Tyrosine-protein kinase ITK/TSK", "gene_name": "ITK", "tax_name": "Human" }, { "uniprot_canonical_ac": "P19174-1", "protein_name": "1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-1", "gene_name": "PLCG1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P15498-1", "protein_name": "Proto-oncogene vav", "gene_name": "VAV1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P01700", "url": "https://www.uniprot.org/uniprotkb/P01700" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.11395409", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 89 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Restricted accumulation of phosphatidylinositol 3-kinase products in a plasmalemmal subdomain during Fc gamma receptor-mediated phagocytosis.", "journal": "The Journal of cell biology", "date": "2001", "authors": "Marshall JG, Booth JW, Stambolic V, Mak T, Balla T, Schreiber AD, Meyer T, Grinstein S", "reference": { "type": "PubMed", "id": "11425868", "url": "https://pubmed.ncbi.nlm.nih.gov/11425868" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P01700-1", "protein_name": "Immunoglobulin lambda variable 1-47", "gene_name": "IGLV1-47", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01714-1", "protein_name": "Immunoglobulin lambda variable 3-19", "gene_name": "IGLV3-19", "tax_name": "Human" }, { "uniprot_canonical_ac": "P80748-1", "protein_name": "Immunoglobulin lambda variable 3-21", "gene_name": "IGLV3-21", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A075B6P5-1", "protein_name": "Immunoglobulin kappa variable 2-28", "gene_name": "IGKV2-28", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A075B6S6-1", "protein_name": "Immunoglobulin kappa variable 2D-30", "gene_name": "IGKV2D-30", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0C4DH25-1", "protein_name": "Immunoglobulin kappa variable 3D-20", "gene_name": "IGKV3D-20", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01593-1", "protein_name": "Immunoglobulin kappa variable 1D-33", "gene_name": "IGKV1D-33", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01599-1", "protein_name": "Immunoglobulin kappa variable 1-17", "gene_name": "IGKV1-17", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01601-1", "protein_name": "Immunoglobulin kappa variable 1D-16", "gene_name": "IGKV1D-16", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01611-1", "protein_name": "Immunoglobulin kappa variable 1D-12", "gene_name": "IGKV1D-12", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01615-1", "protein_name": "Immunoglobulin kappa variable 2D-28", "gene_name": "IGKV2D-28", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01619-1", "protein_name": "Immunoglobulin kappa variable 3-20", "gene_name": "IGKV3-20", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01624-1", "protein_name": "Immunoglobulin kappa variable 3-15", "gene_name": "IGKV3-15", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04433-1", "protein_name": "Immunoglobulin kappa variable 3-11", "gene_name": "IGKV3-11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01602-1", "protein_name": "Immunoglobulin kappa variable 1-5", "gene_name": "IGKV1-5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14643-1", "protein_name": "Inositol 1,4,5-trisphosphate-gated calcium channel ITPR1", "gene_name": "ITPR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P43405-1", "protein_name": "Tyrosine-protein kinase SYK", "gene_name": "SYK", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42336-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform", "gene_name": "PIK3CA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P08637-1", "protein_name": "Low affinity immunoglobulin gamma Fc region receptor III-A", "gene_name": "FCGR3A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01767-1", "protein_name": "Immunoglobulin heavy variable 3-53", "gene_name": "IGHV3-53", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06331-1", "protein_name": "Immunoglobulin heavy variable 4-34", "gene_name": "IGHV4-34", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14571-1", "protein_name": "Inositol 1,4,5-trisphosphate-gated calcium channel ITPR2", "gene_name": "ITPR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01597-1", "protein_name": "Immunoglobulin kappa variable 1-39", "gene_name": "IGKV1-39", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06310-1", "protein_name": "Immunoglobulin kappa variable 2-30", "gene_name": "IGKV2-30", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06312-1", "protein_name": "Immunoglobulin kappa variable 4-1", "gene_name": "IGKV4-1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01614-1", "protein_name": "Immunoglobulin kappa variable 2D-40", "gene_name": "IGKV2D-40", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q05655-1", "protein_name": "Protein kinase C delta type", "gene_name": "PRKCD", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13393-1", "protein_name": "Phospholipase D1", "gene_name": "PLD1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14939-1", "protein_name": "Phospholipase D2", "gene_name": "PLD2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DOY2-1", "protein_name": "Immunoglobulin lambda constant 2", "gene_name": "IGLC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P09693-1", "protein_name": "T-cell surface glycoprotein CD3 gamma chain", "gene_name": "CD3G", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04432-1", "protein_name": "Immunoglobulin kappa variable 1D-39", "gene_name": "IGKV1D-39", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06315-1", "protein_name": "Immunoglobulin kappa variable 5-2", "gene_name": "IGKV5-2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01699-1", "protein_name": "Immunoglobulin lambda variable 1-44", "gene_name": "IGLV1-44", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01701-1", "protein_name": "Immunoglobulin lambda variable 1-51", "gene_name": "IGLV1-51", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01704-1", "protein_name": "Immunoglobulin lambda variable 2-14", "gene_name": "IGLV2-14", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01706-1", "protein_name": "Immunoglobulin lambda variable 2-11", "gene_name": "IGLV2-11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01709-1", "protein_name": "Immunoglobulin lambda variable 2-8", "gene_name": "IGLV2-8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01717-1", "protein_name": "Immunoglobulin lambda variable 3-25", "gene_name": "IGLV3-25", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01721-1", "protein_name": "Immunoglobulin lambda variable 6-57", "gene_name": "IGLV6-57", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01703-1", "protein_name": "Immunoglobulin lambda variable 1-40", "gene_name": "IGLV1-40", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01705-1", "protein_name": "Immunoglobulin lambda variable 2-23", "gene_name": "IGLV2-23", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01715-1", "protein_name": "Immunoglobulin lambda variable 3-1", "gene_name": "IGLV3-1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01718-1", "protein_name": "Immunoglobulin lambda variable 3-27", "gene_name": "IGLV3-27", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04211-1", "protein_name": "Immunoglobulin lambda variable 7-43", "gene_name": "IGLV7-43", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01860-2", "protein_name": "Immunoglobulin heavy constant gamma 3", "gene_name": "IGHG3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01861-2", "protein_name": "Immunoglobulin heavy constant gamma 4", "gene_name": "IGHG4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CF74-1", "protein_name": "Immunoglobulin lambda constant 6", "gene_name": "IGLC6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q02156-1", "protein_name": "Protein kinase C epsilon type", "gene_name": "PRKCE", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00459-1", "protein_name": "Phosphatidylinositol 3-kinase regulatory subunit beta", "gene_name": "PIK3R2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P16885-1", "protein_name": "1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-2", "gene_name": "PLCG2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P12314-1", "protein_name": "High affinity immunoglobulin gamma Fc receptor I", "gene_name": "FCGR1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43865-1", "protein_name": "S-adenosylhomocysteine hydrolase-like protein 1", "gene_name": "AHCYL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01825-1", "protein_name": "Immunoglobulin heavy variable 4-59", "gene_name": "IGHV4-59", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42338-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit beta isoform", "gene_name": "PIK3CB", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01817-1", "protein_name": "Immunoglobulin heavy variable 2-5", "gene_name": "IGHV2-5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01824-1", "protein_name": "Immunoglobulin heavy variable 4-39", "gene_name": "IGHV4-39", "tax_name": "Human" }, { "uniprot_canonical_ac": "P23083-1", "protein_name": "Immunoglobulin heavy variable 1-2", "gene_name": "IGHV1-2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60733-1", "protein_name": "85/88 kDa calcium-independent phospholipase A2", "gene_name": "PLA2G6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5VZY2-1", "protein_name": "Phospholipid phosphatase 4", "gene_name": "PLPP4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NEB5-1", "protein_name": "Phospholipid phosphatase 5", "gene_name": "PLPP5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96BZ4-1", "protein_name": "5'-3' exonuclease PLD4", "gene_name": "PLD4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01742-1", "protein_name": "Immunoglobulin heavy variable 1-69", "gene_name": "IGHV1-69", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01768-1", "protein_name": "Immunoglobulin heavy variable 3-30", "gene_name": "IGHV3-30", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01814-1", "protein_name": "Immunoglobulin heavy variable 2-70", "gene_name": "IGHV2-70", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01772-1", "protein_name": "Immunoglobulin heavy variable 3-33", "gene_name": "IGHV3-33", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01762-1", "protein_name": "Immunoglobulin heavy variable 3-11", "gene_name": "IGHV3-11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01763-1", "protein_name": "Immunoglobulin heavy variable 3-48", "gene_name": "IGHV3-48", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01764-1", "protein_name": "Immunoglobulin heavy variable 3-23", "gene_name": "IGHV3-23", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01766-1", "protein_name": "Immunoglobulin heavy variable 3-13", "gene_name": "IGHV3-13", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01780-1", "protein_name": "Immunoglobulin heavy variable 3-7", "gene_name": "IGHV3-7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01782-1", "protein_name": "Immunoglobulin heavy variable 3-9", "gene_name": "IGHV3-9", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0M8Q6-1", "protein_name": "Immunoglobulin lambda constant 7", "gene_name": "IGLC7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01834-1", "protein_name": "Immunoglobulin kappa constant", "gene_name": "IGKC", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01859-2", "protein_name": "Immunoglobulin heavy constant gamma 2", "gene_name": "IGHG2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG04-1", "protein_name": "Immunoglobulin lambda constant 1", "gene_name": "IGLC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DOY3-1", "protein_name": "Immunoglobulin lambda constant 3", "gene_name": "IGLC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8IV08-1", "protein_name": "5'-3' exonuclease PLD3", "gene_name": "PLD3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01743-1", "protein_name": "Immunoglobulin heavy variable 1-46", "gene_name": "IGHV1-46", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14573-1", "protein_name": "Inositol 1,4,5-trisphosphate-gated calcium channel ITPR3", "gene_name": "ITPR3", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0C4DH73-1", "protein_name": "Immunoglobulin kappa variable 1-12", "gene_name": "IGKV1-12", "tax_name": "Human" }, { "uniprot_canonical_ac": "A2NJV5-1", "protein_name": "Immunoglobulin kappa variable 2-29", "gene_name": "IGKV2-29", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01594-1", "protein_name": "Immunoglobulin kappa variable 1-33", "gene_name": "IGKV1-33", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04430-1", "protein_name": "Immunoglobulin kappa variable 1-16", "gene_name": "IGKV1-16", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01857-2", "protein_name": "Immunoglobulin heavy constant gamma 1", "gene_name": "IGHG1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P12318-1", "protein_name": "Low affinity immunoglobulin gamma Fc region receptor II-a", "gene_name": "FCGR2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27986-1", "protein_name": "Phosphatidylinositol 3-kinase regulatory subunit alpha", "gene_name": "PIK3R1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P19174-1", "protein_name": "1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-1", "gene_name": "PLCG1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P01700", "url": "https://www.uniprot.org/uniprotkb/P01700" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.11425868", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 88 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Association of SLP-65/BLNK with the B cell antigen receptor through a non-ITAM tyrosine of Ig-alpha.", "journal": "European journal of immunology", "date": "2001", "authors": "Engels N, Wollscheid B, Wienands J", "reference": { "type": "PubMed", "id": "11449366", "url": "https://pubmed.ncbi.nlm.nih.gov/11449366" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P01700-1", "protein_name": "Immunoglobulin lambda variable 1-47", "gene_name": "IGLV1-47", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01714-1", "protein_name": "Immunoglobulin lambda variable 3-19", "gene_name": "IGLV3-19", "tax_name": "Human" }, { "uniprot_canonical_ac": "P80748-1", "protein_name": "Immunoglobulin lambda variable 3-21", "gene_name": "IGLV3-21", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A075B6P5-1", "protein_name": "Immunoglobulin kappa variable 2-28", "gene_name": "IGKV2-28", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A075B6S6-1", "protein_name": "Immunoglobulin kappa variable 2D-30", "gene_name": "IGKV2D-30", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0C4DH25-1", "protein_name": "Immunoglobulin kappa variable 3D-20", "gene_name": "IGKV3D-20", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01593-1", "protein_name": "Immunoglobulin kappa variable 1D-33", "gene_name": "IGKV1D-33", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01599-1", "protein_name": "Immunoglobulin kappa variable 1-17", "gene_name": "IGKV1-17", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01601-1", "protein_name": "Immunoglobulin kappa variable 1D-16", "gene_name": "IGKV1D-16", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01611-1", "protein_name": "Immunoglobulin kappa variable 1D-12", "gene_name": "IGKV1D-12", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01615-1", "protein_name": "Immunoglobulin kappa variable 2D-28", "gene_name": "IGKV2D-28", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01619-1", "protein_name": "Immunoglobulin kappa variable 3-20", "gene_name": "IGKV3-20", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01624-1", "protein_name": "Immunoglobulin kappa variable 3-15", "gene_name": "IGKV3-15", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04433-1", "protein_name": "Immunoglobulin kappa variable 3-11", "gene_name": "IGKV3-11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01602-1", "protein_name": "Immunoglobulin kappa variable 1-5", "gene_name": "IGKV1-5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8WV28-1", "protein_name": "B-cell linker protein", "gene_name": "BLNK", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14643-1", "protein_name": "Inositol 1,4,5-trisphosphate-gated calcium channel ITPR1", "gene_name": "ITPR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UN19-1", "protein_name": "Dual adapter for phosphotyrosine and 3-phosphotyrosine and 3-phosphoinositide", "gene_name": "DAPP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P43405-1", "protein_name": "Tyrosine-protein kinase SYK", "gene_name": "SYK", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96SN7-1", "protein_name": "Protein orai-2", "gene_name": "ORAI2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P15391-1", "protein_name": "B-lymphocyte antigen CD19", "gene_name": "CD19", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01871-2", "protein_name": "Immunoglobulin heavy constant mu", "gene_name": "IGHM", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13586-1", "protein_name": "Stromal interaction molecule 1", "gene_name": "STIM1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01767-1", "protein_name": "Immunoglobulin heavy variable 3-53", "gene_name": "IGHV3-53", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06331-1", "protein_name": "Immunoglobulin heavy variable 4-34", "gene_name": "IGHV4-34", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14571-1", "protein_name": "Inositol 1,4,5-trisphosphate-gated calcium channel ITPR2", "gene_name": "ITPR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01597-1", "protein_name": "Immunoglobulin kappa variable 1-39", "gene_name": "IGKV1-39", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06310-1", "protein_name": "Immunoglobulin kappa variable 2-30", "gene_name": "IGKV2-30", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06312-1", "protein_name": "Immunoglobulin kappa variable 4-1", "gene_name": "IGKV4-1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01614-1", "protein_name": "Immunoglobulin kappa variable 2D-40", "gene_name": "IGKV2D-40", "tax_name": "Human" }, { "uniprot_canonical_ac": "P48995-1", "protein_name": "Short transient receptor potential channel 1", "gene_name": "TRPC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DOY2-1", "protein_name": "Immunoglobulin lambda constant 2", "gene_name": "IGLC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6ZUJ8-1", "protein_name": "Phosphoinositide 3-kinase adapter protein 1", "gene_name": "PIK3AP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96D31-1", "protein_name": "Calcium release-activated calcium channel protein 1", "gene_name": "ORAI1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DP23-1", "protein_name": "Calmodulin-1", "gene_name": "CALM1; CALM2; CALM3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P29350-1", "protein_name": "Tyrosine-protein phosphatase non-receptor type 6", "gene_name": "PTPN6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P20273-1", "protein_name": "B-cell receptor CD22", "gene_name": "CD22", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04432-1", "protein_name": "Immunoglobulin kappa variable 1D-39", "gene_name": "IGKV1D-39", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06315-1", "protein_name": "Immunoglobulin kappa variable 5-2", "gene_name": "IGKV5-2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01699-1", "protein_name": "Immunoglobulin lambda variable 1-44", "gene_name": "IGLV1-44", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01701-1", "protein_name": "Immunoglobulin lambda variable 1-51", "gene_name": "IGLV1-51", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01704-1", "protein_name": "Immunoglobulin lambda variable 2-14", "gene_name": "IGLV2-14", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01706-1", "protein_name": "Immunoglobulin lambda variable 2-11", "gene_name": "IGLV2-11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01709-1", "protein_name": "Immunoglobulin lambda variable 2-8", "gene_name": "IGLV2-8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01717-1", "protein_name": "Immunoglobulin lambda variable 3-25", "gene_name": "IGLV3-25", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01721-1", "protein_name": "Immunoglobulin lambda variable 6-57", "gene_name": "IGLV6-57", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01703-1", "protein_name": "Immunoglobulin lambda variable 1-40", "gene_name": "IGLV1-40", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01705-1", "protein_name": "Immunoglobulin lambda variable 2-23", "gene_name": "IGLV2-23", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01715-1", "protein_name": "Immunoglobulin lambda variable 3-1", "gene_name": "IGLV3-1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01718-1", "protein_name": "Immunoglobulin lambda variable 3-27", "gene_name": "IGLV3-27", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04211-1", "protein_name": "Immunoglobulin lambda variable 7-43", "gene_name": "IGLV7-43", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q07889-1", "protein_name": "Son of sevenless homolog 1", "gene_name": "SOS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01880-2", "protein_name": "Immunoglobulin heavy constant delta", "gene_name": "IGHD", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CF74-1", "protein_name": "Immunoglobulin lambda constant 6", "gene_name": "IGLC6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q06187-1", "protein_name": "Tyrosine-protein kinase BTK", "gene_name": "BTK", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96B97-1", "protein_name": "SH3 domain-containing kinase-binding protein 1", "gene_name": "SH3KBP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P07948-1", "protein_name": "Tyrosine-protein kinase Lyn", "gene_name": "LYN", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51451-1", "protein_name": "Tyrosine-protein kinase Blk", "gene_name": "BLK", "tax_name": "Human" }, { "uniprot_canonical_ac": "P16885-1", "protein_name": "1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-2", "gene_name": "PLCG2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43865-1", "protein_name": "S-adenosylhomocysteine hydrolase-like protein 1", "gene_name": "AHCYL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01825-1", "protein_name": "Immunoglobulin heavy variable 4-59", "gene_name": "IGHV4-59", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01817-1", "protein_name": "Immunoglobulin heavy variable 2-5", "gene_name": "IGHV2-5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01824-1", "protein_name": "Immunoglobulin heavy variable 4-39", "gene_name": "IGHV4-39", "tax_name": "Human" }, { "uniprot_canonical_ac": "P23083-1", "protein_name": "Immunoglobulin heavy variable 1-2", "gene_name": "IGHV1-2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00329-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit delta isoform", "gene_name": "PIK3CD", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01742-1", "protein_name": "Immunoglobulin heavy variable 1-69", "gene_name": "IGHV1-69", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01768-1", "protein_name": "Immunoglobulin heavy variable 3-30", "gene_name": "IGHV3-30", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01814-1", "protein_name": "Immunoglobulin heavy variable 2-70", "gene_name": "IGHV2-70", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01772-1", "protein_name": "Immunoglobulin heavy variable 3-33", "gene_name": "IGHV3-33", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01762-1", "protein_name": "Immunoglobulin heavy variable 3-11", "gene_name": "IGHV3-11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01763-1", "protein_name": "Immunoglobulin heavy variable 3-48", "gene_name": "IGHV3-48", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01764-1", "protein_name": "Immunoglobulin heavy variable 3-23", "gene_name": "IGHV3-23", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01766-1", "protein_name": "Immunoglobulin heavy variable 3-13", "gene_name": "IGHV3-13", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01780-1", "protein_name": "Immunoglobulin heavy variable 3-7", "gene_name": "IGHV3-7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01782-1", "protein_name": "Immunoglobulin heavy variable 3-9", "gene_name": "IGHV3-9", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0M8Q6-1", "protein_name": "Immunoglobulin lambda constant 7", "gene_name": "IGLC7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01834-1", "protein_name": "Immunoglobulin kappa constant", "gene_name": "IGKC", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG04-1", "protein_name": "Immunoglobulin lambda constant 1", "gene_name": "IGLC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DOY3-1", "protein_name": "Immunoglobulin lambda constant 3", "gene_name": "IGLC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P11911-1", "protein_name": "B-cell antigen receptor complex-associated protein alpha chain", "gene_name": "Cd79a", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "P11912-1", "protein_name": "B-cell antigen receptor complex-associated protein alpha chain", "gene_name": "CD79A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P40259-1", "protein_name": "B-cell antigen receptor complex-associated protein beta chain", "gene_name": "CD79B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01743-1", "protein_name": "Immunoglobulin heavy variable 1-46", "gene_name": "IGHV1-46", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14573-1", "protein_name": "Inositol 1,4,5-trisphosphate-gated calcium channel ITPR3", "gene_name": "ITPR3", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0C4DH73-1", "protein_name": "Immunoglobulin kappa variable 1-12", "gene_name": "IGKV1-12", "tax_name": "Human" }, { "uniprot_canonical_ac": "A2NJV5-1", "protein_name": "Immunoglobulin kappa variable 2-29", "gene_name": "IGKV2-29", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01594-1", "protein_name": "Immunoglobulin kappa variable 1-33", "gene_name": "IGKV1-33", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04430-1", "protein_name": "Immunoglobulin kappa variable 1-16", "gene_name": "IGKV1-16", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9QUN3-1", "protein_name": "B-cell linker protein", "gene_name": "Blnk", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "P27986-1", "protein_name": "Phosphatidylinositol 3-kinase regulatory subunit alpha", "gene_name": "PIK3R1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06241-1", "protein_name": "Tyrosine-protein kinase Fyn", "gene_name": "FYN", "tax_name": "Human" }, { "uniprot_canonical_ac": "P16333-1", "protein_name": "SH2/SH3 adapter protein NCK1", "gene_name": "NCK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P15498-1", "protein_name": "Proto-oncogene vav", "gene_name": "VAV1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P01700", "url": "https://www.uniprot.org/uniprotkb/P01700" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 204, "end_pos": 204, "sequence_org": "Y", "sequence_mut": "F", "comment": "Has little effect on tyrosine phosphorylation. Reduces pre-B-cell differentiation. Abolishes binding to BLNK. Inhibits phosphorylation of BLNK. No effect on cap formation or BCR internalization. Impaired antigen presentation; when associated with F-176.", "evidence": [ { "database": "UniProtKB", "id": "P11911", "url": "https://www.uniprot.org/uniprotkb/P11911" }, { "database": "PubMed", "id": "16860757", "url": "https://pubmed.ncbi.nlm.nih.gov/16860757" }, { "database": "PubMed", "id": "11449366", "url": "https://pubmed.ncbi.nlm.nih.gov/11449366" }, { "database": "PubMed", "id": "17163454", "url": "https://pubmed.ncbi.nlm.nih.gov/17163454" }, { "database": "PubMed", "id": "11859098", "url": "https://pubmed.ncbi.nlm.nih.gov/11859098" }, { "database": "PubMed", "id": "11909947", "url": "https://pubmed.ncbi.nlm.nih.gov/11909947" } ], "uniprot_canonical_ac": "P11911-1" }, { "start_pos": 373, "end_pos": 373, "sequence_org": "R", "sequence_mut": "L", "comment": "Abolishes binding to CD79A and SYK.", "evidence": [ { "database": "UniProtKB", "id": "Q9QUN3", "url": "https://www.uniprot.org/uniprotkb/Q9QUN3" }, { "database": "PubMed", "id": "18369315", "url": "https://pubmed.ncbi.nlm.nih.gov/18369315" }, { "database": "PubMed", "id": "11449366", "url": "https://pubmed.ncbi.nlm.nih.gov/11449366" } ], "uniprot_canonical_ac": "Q9QUN3-1" } ], "phosphorylation": [ { "start_pos": 204, "end_pos": 204, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "Phosphotyrosine; by Tyr-kinases", "evidence": [ { "database": "UniProtKB", "id": "P11911", "url": "https://www.uniprot.org/uniprotkb/P11911" }, { "database": "iPTMnet", "id": "P11911", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P11911" }, { "database": "PubMed", "id": "16860757", "url": "https://pubmed.ncbi.nlm.nih.gov/16860757" }, { "database": "PubMed", "id": "11449366", "url": "https://pubmed.ncbi.nlm.nih.gov/11449366" } ], "site_lbl": "Tyr204", "uniprot_canonical_ac": "P11911-1" } ], "record_id": "pubmed.11449366", "abstract": "", "glycosylation": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 93 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "CD84 functions as a homophilic adhesion molecule and enhances IFN-gamma secretion: adhesion is mediated by Ig-like domain 1.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "2001", "authors": "Martin M, Romero X, de la Fuente MA, Tovar V, Zapater N, Esplugues E, Pizcueta P, Bosch J, Engel P", "reference": { "type": "PubMed", "id": "11564780", "url": "https://pubmed.ncbi.nlm.nih.gov/11564780" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P01700-1", "protein_name": "Immunoglobulin lambda variable 1-47", "gene_name": "IGLV1-47", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01714-1", "protein_name": "Immunoglobulin lambda variable 3-19", "gene_name": "IGLV3-19", "tax_name": "Human" }, { "uniprot_canonical_ac": "P80748-1", "protein_name": "Immunoglobulin lambda variable 3-21", "gene_name": "IGLV3-21", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A075B6P5-1", "protein_name": "Immunoglobulin kappa variable 2-28", "gene_name": "IGKV2-28", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A075B6S6-1", "protein_name": "Immunoglobulin kappa variable 2D-30", "gene_name": "IGKV2D-30", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0C4DH25-1", "protein_name": "Immunoglobulin kappa variable 3D-20", "gene_name": "IGKV3D-20", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01593-1", "protein_name": "Immunoglobulin kappa variable 1D-33", "gene_name": "IGKV1D-33", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01599-1", "protein_name": "Immunoglobulin kappa variable 1-17", "gene_name": "IGKV1-17", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01601-1", "protein_name": "Immunoglobulin kappa variable 1D-16", "gene_name": "IGKV1D-16", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01611-1", "protein_name": "Immunoglobulin kappa variable 1D-12", "gene_name": "IGKV1D-12", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01615-1", "protein_name": "Immunoglobulin kappa variable 2D-28", "gene_name": "IGKV2D-28", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01619-1", "protein_name": "Immunoglobulin kappa variable 3-20", "gene_name": "IGKV3-20", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01624-1", "protein_name": "Immunoglobulin kappa variable 3-15", "gene_name": "IGKV3-15", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04433-1", "protein_name": "Immunoglobulin kappa variable 3-11", "gene_name": "IGKV3-11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01602-1", "protein_name": "Immunoglobulin kappa variable 1-5", "gene_name": "IGKV1-5", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75056-1", "protein_name": "Syndecan-3", "gene_name": "SDC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P07204-1", "protein_name": "Thrombomodulin", "gene_name": "THBD", "tax_name": "Human" }, { "uniprot_canonical_ac": "P00734-1", "protein_name": "Prothrombin", "gene_name": "F2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P02452-1", "protein_name": "Collagen alpha-1(I) chain", "gene_name": "COL1A1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04114-1", "protein_name": "Apolipoprotein B-100", "gene_name": "APOB", "tax_name": "Human" }, { "uniprot_canonical_ac": "P02751-15", "protein_name": "Fibronectin", "gene_name": "FN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00220-1", "protein_name": "Tumor necrosis factor receptor superfamily member 10A", "gene_name": "TNFRSF10A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P14209-1", "protein_name": "CD99 antigen", "gene_name": "CD99", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9P1W8-1", "protein_name": "Signal-regulatory protein gamma", "gene_name": "SIRPG", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q08722-1", "protein_name": "Leukocyte surface antigen CD47", "gene_name": "CD47", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01871-2", "protein_name": "Immunoglobulin heavy constant mu", "gene_name": "IGHM", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UNN8-1", "protein_name": "Endothelial protein C receptor", "gene_name": "PROCR", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8WWV6-1", "protein_name": "High affinity immunoglobulin alpha and immunoglobulin mu Fc receptor", "gene_name": "FCAMR", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96AP7-1", "protein_name": "Endothelial cell-selective adhesion molecule", "gene_name": "ESAM", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14393-2", "protein_name": "Growth arrest-specific protein 6", "gene_name": "GAS6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P30273-1", "protein_name": "High affinity immunoglobulin epsilon receptor subunit gamma", "gene_name": "FCER1G", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92896-1", "protein_name": "Golgi apparatus protein 1", "gene_name": "GLG1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P20701-1", "protein_name": "Integrin alpha-L", "gene_name": "ITGAL", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01767-1", "protein_name": "Immunoglobulin heavy variable 3-53", "gene_name": "IGHV3-53", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06331-1", "protein_name": "Immunoglobulin heavy variable 4-34", "gene_name": "IGHV4-34", "tax_name": "Human" }, { "uniprot_canonical_ac": "P19256-1", "protein_name": "Lymphocyte function-associated antigen 3", "gene_name": "CD58", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y624-1", "protein_name": "Junctional adhesion molecule A", "gene_name": "F11R", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01597-1", "protein_name": "Immunoglobulin kappa variable 1-39", "gene_name": "IGKV1-39", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06310-1", "protein_name": "Immunoglobulin kappa variable 2-30", "gene_name": "IGKV2-30", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06312-1", "protein_name": "Immunoglobulin kappa variable 4-1", "gene_name": "IGKV4-1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01614-1", "protein_name": "Immunoglobulin kappa variable 2D-40", "gene_name": "IGKV2D-40", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DOY2-1", "protein_name": "Immunoglobulin lambda constant 2", "gene_name": "IGLC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P78380-1", "protein_name": "Oxidized low-density lipoprotein receptor 1", "gene_name": "OLR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P11464-1", "protein_name": "Pregnancy-specific beta-1-glycoprotein 1", "gene_name": "PSG1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q00887-1", "protein_name": "Pregnancy-specific beta-1-glycoprotein 9", "gene_name": "PSG9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UQ72-1", "protein_name": "Pregnancy-specific beta-1-glycoprotein 11", "gene_name": "PSG11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06731-1", "protein_name": "Cell adhesion molecule CEACAM5", "gene_name": "CEACAM5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P18827-1", "protein_name": "Syndecan-1", "gene_name": "SDC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UIB8-1", "protein_name": "SLAM family member 5", "gene_name": "CD84", "tax_name": "Human" }, { "uniprot_canonical_ac": "P09326-1", "protein_name": "CD48 antigen", "gene_name": "CD48", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TCZ2-1", "protein_name": "CD99 antigen-like protein 2", "gene_name": "CD99L2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P02724-1", "protein_name": "Glycophorin-A", "gene_name": "GYPA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P14174-1", "protein_name": "Macrophage migration inhibitory factor", "gene_name": "MIF", "tax_name": "Human" }, { "uniprot_canonical_ac": "P13688-1", "protein_name": "Cell adhesion molecule CEACAM1", "gene_name": "CEACAM1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06729-1", "protein_name": "T-cell surface antigen CD2", "gene_name": "CD2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P40199-1", "protein_name": "Cell adhesion molecule CEACAM6", "gene_name": "CEACAM6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BZW8-1", "protein_name": "Natural killer cell receptor 2B4", "gene_name": "CD244", "tax_name": "Human" }, { "uniprot_canonical_ac": "P16070-1", "protein_name": "CD44 antigen", "gene_name": "CD44", "tax_name": "Human" }, { "uniprot_canonical_ac": "P31997-1", "protein_name": "Cell adhesion molecule CEACAM8", "gene_name": "CEACAM8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P40198-1", "protein_name": "Cell adhesion molecule CEACAM3", "gene_name": "CEACAM3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N6Q3-1", "protein_name": "CD177 antigen", "gene_name": "CD177", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04233-1", "protein_name": "HLA class II histocompatibility antigen gamma chain", "gene_name": "CD74", "tax_name": "Human" }, { "uniprot_canonical_ac": "P16284-1", "protein_name": "Platelet endothelial cell adhesion molecule", "gene_name": "PECAM1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P31431-1", "protein_name": "Syndecan-4", "gene_name": "SDC4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04432-1", "protein_name": "Immunoglobulin kappa variable 1D-39", "gene_name": "IGKV1D-39", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06315-1", "protein_name": "Immunoglobulin kappa variable 5-2", "gene_name": "IGKV5-2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01699-1", "protein_name": "Immunoglobulin lambda variable 1-44", "gene_name": "IGLV1-44", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01701-1", "protein_name": "Immunoglobulin lambda variable 1-51", "gene_name": "IGLV1-51", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01704-1", "protein_name": "Immunoglobulin lambda variable 2-14", "gene_name": "IGLV2-14", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01706-1", "protein_name": "Immunoglobulin lambda variable 2-11", "gene_name": "IGLV2-11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01709-1", "protein_name": "Immunoglobulin lambda variable 2-8", "gene_name": "IGLV2-8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01717-1", "protein_name": "Immunoglobulin lambda variable 3-25", "gene_name": "IGLV3-25", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01721-1", "protein_name": "Immunoglobulin lambda variable 6-57", "gene_name": "IGLV6-57", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01703-1", "protein_name": "Immunoglobulin lambda variable 1-40", "gene_name": "IGLV1-40", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01705-1", "protein_name": "Immunoglobulin lambda variable 2-23", "gene_name": "IGLV2-23", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01715-1", "protein_name": "Immunoglobulin lambda variable 3-1", "gene_name": "IGLV3-1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01718-1", "protein_name": "Immunoglobulin lambda variable 3-27", "gene_name": "IGLV3-27", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04211-1", "protein_name": "Immunoglobulin lambda variable 7-43", "gene_name": "IGLV7-43", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06028-1", "protein_name": "Glycophorin-B", "gene_name": "GYPB", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04921-1", "protein_name": "Glycophorin-C", "gene_name": "GYPC", "tax_name": "Human" }, { "uniprot_canonical_ac": "P15814-1", "protein_name": "Immunoglobulin lambda-like polypeptide 1", "gene_name": "IGLL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P11215-1", "protein_name": "Integrin alpha-M", "gene_name": "ITGAM", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01876-2", "protein_name": "Immunoglobulin heavy constant alpha 1", "gene_name": "IGHA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CF74-1", "protein_name": "Immunoglobulin lambda constant 6", "gene_name": "IGLC6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P08648-1", "protein_name": "Integrin alpha-5", "gene_name": "ITGA5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P13612-1", "protein_name": "Integrin alpha-4", "gene_name": "ITGA4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P02776-1", "protein_name": "Platelet factor 4", "gene_name": "PF4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P07948-1", "protein_name": "Tyrosine-protein kinase Lyn", "gene_name": "LYN", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05556-1", "protein_name": "Integrin beta-1", "gene_name": "ITGB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NRD5-1", "protein_name": "PRKCA-binding protein", "gene_name": "PICK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P08123-1", "protein_name": "Collagen alpha-2(I) chain", "gene_name": "COL1A2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04070-1", "protein_name": "Vitamin K-dependent protein C", "gene_name": "PROC", "tax_name": "Human" }, { "uniprot_canonical_ac": "P34741-1", "protein_name": "Syndecan-2", "gene_name": "SDC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P78310-1", "protein_name": "Coxsackievirus and adenovirus receptor", "gene_name": "CXADR", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HCN6-1", "protein_name": "Platelet glycoprotein VI", "gene_name": "GP6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35052-1", "protein_name": "Glypican-1", "gene_name": "GPC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NP99-1", "protein_name": "Triggering receptor expressed on myeloid cells 1", "gene_name": "TREM1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01825-1", "protein_name": "Immunoglobulin heavy variable 4-59", "gene_name": "IGHV4-59", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01817-1", "protein_name": "Immunoglobulin heavy variable 2-5", "gene_name": "IGHV2-5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01824-1", "protein_name": "Immunoglobulin heavy variable 4-39", "gene_name": "IGHV4-39", "tax_name": "Human" }, { "uniprot_canonical_ac": "P23083-1", "protein_name": "Immunoglobulin heavy variable 1-2", "gene_name": "IGHV1-2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P10720-1", "protein_name": "Platelet factor 4 variant", "gene_name": "PF4V1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q00888-1", "protein_name": "Pregnancy-specific beta-1-glycoprotein 4", "gene_name": "PSG4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13046-1", "protein_name": "Pregnancy-specific beta-1-glycoprotein 7", "gene_name": "PSG7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q00889-1", "protein_name": "Pregnancy-specific beta-1-glycoprotein 6", "gene_name": "PSG6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P07225-1", "protein_name": "Vitamin K-dependent protein S", "gene_name": "PROS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P11465-1", "protein_name": "Pregnancy-specific beta-1-glycoprotein 2", "gene_name": "PSG2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01742-1", "protein_name": "Immunoglobulin heavy variable 1-69", "gene_name": "IGHV1-69", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01768-1", "protein_name": "Immunoglobulin heavy variable 3-30", "gene_name": "IGHV3-30", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01814-1", "protein_name": "Immunoglobulin heavy variable 2-70", "gene_name": "IGHV2-70", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01772-1", "protein_name": "Immunoglobulin heavy variable 3-33", "gene_name": "IGHV3-33", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01762-1", "protein_name": "Immunoglobulin heavy variable 3-11", "gene_name": "IGHV3-11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01763-1", "protein_name": "Immunoglobulin heavy variable 3-48", "gene_name": "IGHV3-48", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01764-1", "protein_name": "Immunoglobulin heavy variable 3-23", "gene_name": "IGHV3-23", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01766-1", "protein_name": "Immunoglobulin heavy variable 3-13", "gene_name": "IGHV3-13", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01780-1", "protein_name": "Immunoglobulin heavy variable 3-7", "gene_name": "IGHV3-7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01782-1", "protein_name": "Immunoglobulin heavy variable 3-9", "gene_name": "IGHV3-9", "tax_name": "Human" }, { "uniprot_canonical_ac": "P20702-1", "protein_name": "Integrin alpha-X", "gene_name": "ITGAX", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86YT9-1", "protein_name": "Junctional adhesion molecule-like", "gene_name": "JAML", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01877-2", "protein_name": "Immunoglobulin heavy constant alpha 2", "gene_name": "IGHA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BX67-1", "protein_name": "Junctional adhesion molecule C", "gene_name": "JAM3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01591-1", "protein_name": "Immunoglobulin J chain", "gene_name": "JCHAIN", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UQ74-1", "protein_name": "Pregnancy-specific beta-1-glycoprotein 8", "gene_name": "PSG8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16557-1", "protein_name": "Pregnancy-specific beta-1-glycoprotein 3", "gene_name": "PSG3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15238-1", "protein_name": "Pregnancy-specific beta-1-glycoprotein 5", "gene_name": "PSG5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P57087-1", "protein_name": "Junctional adhesion molecule B", "gene_name": "JAM2", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0M8Q6-1", "protein_name": "Immunoglobulin lambda constant 7", "gene_name": "IGLC7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01834-1", "protein_name": "Immunoglobulin kappa constant", "gene_name": "IGKC", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG04-1", "protein_name": "Immunoglobulin lambda constant 1", "gene_name": "IGLC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DOY3-1", "protein_name": "Immunoglobulin lambda constant 3", "gene_name": "IGLC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P78324-1", "protein_name": "Tyrosine-protein phosphatase non-receptor type substrate 1", "gene_name": "SIRPA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UKI3-1", "protein_name": "Pre-B lymphocyte protein 3", "gene_name": "VPREB3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P12018-1", "protein_name": "Immunoglobulin iota chain", "gene_name": "VPREB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01743-1", "protein_name": "Immunoglobulin heavy variable 1-46", "gene_name": "IGHV1-46", "tax_name": "Human" }, { "uniprot_canonical_ac": "P16109-1", "protein_name": "P-selectin", "gene_name": "SELP", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14242-1", "protein_name": "P-selectin glycoprotein ligand 1", "gene_name": "SELPLG", "tax_name": "Human" }, { "uniprot_canonical_ac": "P16581-1", "protein_name": "E-selectin", "gene_name": "SELE", "tax_name": "Human" }, { "uniprot_canonical_ac": "P16150-1", "protein_name": "Leukosialin", "gene_name": "SPN", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0C4DH73-1", "protein_name": "Immunoglobulin kappa variable 1-12", "gene_name": "IGKV1-12", "tax_name": "Human" }, { "uniprot_canonical_ac": "A2NJV5-1", "protein_name": "Immunoglobulin kappa variable 2-29", "gene_name": "IGKV2-29", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01594-1", "protein_name": "Immunoglobulin kappa variable 1-33", "gene_name": "IGKV1-33", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04430-1", "protein_name": "Immunoglobulin kappa variable 1-16", "gene_name": "IGKV1-16", "tax_name": "Human" }, { "uniprot_canonical_ac": "P14151-1", "protein_name": "L-selectin", "gene_name": "SELL", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12866-1", "protein_name": "Tyrosine-protein kinase Mer", "gene_name": "MERTK", "tax_name": "Human" }, { "uniprot_canonical_ac": "P16422-1", "protein_name": "Epithelial cell adhesion molecule", "gene_name": "EPCAM", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UBN6-1", "protein_name": "Tumor necrosis factor receptor superfamily member 10D", "gene_name": "TNFRSF10D", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14763-1", "protein_name": "Tumor necrosis factor receptor superfamily member 10B", "gene_name": "TNFRSF10B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P41732-1", "protein_name": "Tetraspanin-7", "gene_name": "TSPAN7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01137-1", "protein_name": "Transforming growth factor beta-1 proprotein", "gene_name": "TGFB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06241-1", "protein_name": "Tyrosine-protein kinase Fyn", "gene_name": "FYN", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05107-1", "protein_name": "Integrin beta-2", "gene_name": "ITGB2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P01700", "url": "https://www.uniprot.org/uniprotkb/P01700" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.11564780", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 151 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Decay-accelerating factor (DAF), complement receptor 1 (CR1), and factor H dissociate the complement AP C3 convertase (C3bBb) via sites on the type A domain of Bb.", "journal": "The Journal of biological chemistry", "date": "2002", "authors": "Hourcade DE, Mitchell L, Kuttner-Kondo LA, Atkinson JP, Medof ME", "reference": { "type": "PubMed", "id": "11694537", "url": "https://pubmed.ncbi.nlm.nih.gov/11694537" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P01700-1", "protein_name": "Immunoglobulin lambda variable 1-47", "gene_name": "IGLV1-47", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01714-1", "protein_name": "Immunoglobulin lambda variable 3-19", "gene_name": "IGLV3-19", "tax_name": "Human" }, { "uniprot_canonical_ac": "P80748-1", "protein_name": "Immunoglobulin lambda variable 3-21", "gene_name": "IGLV3-21", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A075B6P5-1", "protein_name": "Immunoglobulin kappa variable 2-28", "gene_name": "IGKV2-28", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A075B6S6-1", "protein_name": "Immunoglobulin kappa variable 2D-30", "gene_name": "IGKV2D-30", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0C4DH25-1", "protein_name": "Immunoglobulin kappa variable 3D-20", "gene_name": "IGKV3D-20", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01593-1", "protein_name": "Immunoglobulin kappa variable 1D-33", "gene_name": "IGKV1D-33", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01599-1", "protein_name": "Immunoglobulin kappa variable 1-17", "gene_name": "IGKV1-17", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01601-1", "protein_name": "Immunoglobulin kappa variable 1D-16", "gene_name": "IGKV1D-16", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01611-1", "protein_name": "Immunoglobulin kappa variable 1D-12", "gene_name": "IGKV1D-12", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01615-1", "protein_name": "Immunoglobulin kappa variable 2D-28", "gene_name": "IGKV2D-28", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01619-1", "protein_name": "Immunoglobulin kappa variable 3-20", "gene_name": "IGKV3-20", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01624-1", "protein_name": "Immunoglobulin kappa variable 3-15", "gene_name": "IGKV3-15", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04433-1", "protein_name": "Immunoglobulin kappa variable 3-11", "gene_name": "IGKV3-11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01602-1", "protein_name": "Immunoglobulin kappa variable 1-5", "gene_name": "IGKV1-5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P00734-1", "protein_name": "Prothrombin", "gene_name": "F2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P10909-1", "protein_name": "Clusterin", "gene_name": "CLU", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06681-1", "protein_name": "Complement C2", "gene_name": "C2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P15391-1", "protein_name": "B-lymphocyte antigen CD19", "gene_name": "CD19", "tax_name": "Human" }, { "uniprot_canonical_ac": "P08246-1", "protein_name": "Neutrophil elastase", "gene_name": "ELANE", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01767-1", "protein_name": "Immunoglobulin heavy variable 3-53", "gene_name": "IGHV3-53", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06331-1", "protein_name": "Immunoglobulin heavy variable 4-34", "gene_name": "IGHV4-34", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01597-1", "protein_name": "Immunoglobulin kappa variable 1-39", "gene_name": "IGKV1-39", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06310-1", "protein_name": "Immunoglobulin kappa variable 2-30", "gene_name": "IGKV2-30", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06312-1", "protein_name": "Immunoglobulin kappa variable 4-1", "gene_name": "IGKV4-1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01614-1", "protein_name": "Immunoglobulin kappa variable 2D-40", "gene_name": "IGKV2D-40", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DOY2-1", "protein_name": "Immunoglobulin lambda constant 2", "gene_name": "IGLC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P08603-1", "protein_name": "Complement factor H", "gene_name": "CFH", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05156-1", "protein_name": "Complement factor I", "gene_name": "CFI", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16581-1", "protein_name": "C3a anaphylatoxin chemotactic receptor", "gene_name": "C3AR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P00736-1", "protein_name": "Complement C1r subcomponent", "gene_name": "C1R", "tax_name": "Human" }, { "uniprot_canonical_ac": "P09871-1", "protein_name": "Complement C1s subcomponent", "gene_name": "C1S", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04003-1", "protein_name": "C4b-binding protein alpha chain", "gene_name": "C4BPA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P02747-1", "protein_name": "Complement C1q subcomponent subunit C", "gene_name": "C1QC", "tax_name": "Human" }, { "uniprot_canonical_ac": "P20851-1", "protein_name": "C4b-binding protein beta chain", "gene_name": "C4BPB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96IY4-1", "protein_name": "Carboxypeptidase B2", "gene_name": "CPB2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0C0L5-1", "protein_name": "Complement C4-B", "gene_name": "C4B_2; C4B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0C0L4-1", "protein_name": "Complement C4-A", "gene_name": "C4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P07360-1", "protein_name": "Complement component C8 gamma chain", "gene_name": "C8G", "tax_name": "Human" }, { "uniprot_canonical_ac": "P13671-1", "protein_name": "Complement component C6", "gene_name": "C6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01031-1", "protein_name": "Complement C5", "gene_name": "C5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P02748-1", "protein_name": "Complement component C9", "gene_name": "C9", "tax_name": "Human" }, { "uniprot_canonical_ac": "P07357-1", "protein_name": "Complement component C8 alpha chain", "gene_name": "C8A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P08174-1", "protein_name": "Complement decay-accelerating factor", "gene_name": "CD55", "tax_name": "Human" }, { "uniprot_canonical_ac": "P15529-1", "protein_name": "Membrane cofactor protein", "gene_name": "CD46", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04432-1", "protein_name": "Immunoglobulin kappa variable 1D-39", "gene_name": "IGKV1D-39", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06315-1", "protein_name": "Immunoglobulin kappa variable 5-2", "gene_name": "IGKV5-2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01699-1", "protein_name": "Immunoglobulin lambda variable 1-44", "gene_name": "IGLV1-44", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01701-1", "protein_name": "Immunoglobulin lambda variable 1-51", "gene_name": "IGLV1-51", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01704-1", "protein_name": "Immunoglobulin lambda variable 2-14", "gene_name": "IGLV2-14", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01706-1", "protein_name": "Immunoglobulin lambda variable 2-11", "gene_name": "IGLV2-11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01709-1", "protein_name": "Immunoglobulin lambda variable 2-8", "gene_name": "IGLV2-8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01717-1", "protein_name": "Immunoglobulin lambda variable 3-25", "gene_name": "IGLV3-25", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01721-1", "protein_name": "Immunoglobulin lambda variable 6-57", "gene_name": "IGLV6-57", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01703-1", "protein_name": "Immunoglobulin lambda variable 1-40", "gene_name": "IGLV1-40", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01705-1", "protein_name": "Immunoglobulin lambda variable 2-23", "gene_name": "IGLV2-23", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01715-1", "protein_name": "Immunoglobulin lambda variable 3-1", "gene_name": "IGLV3-1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01718-1", "protein_name": "Immunoglobulin lambda variable 3-27", "gene_name": "IGLV3-27", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04211-1", "protein_name": "Immunoglobulin lambda variable 7-43", "gene_name": "IGLV7-43", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05155-1", "protein_name": "Plasma protease C1 inhibitor", "gene_name": "SERPING1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P22792-1", "protein_name": "Carboxypeptidase N subunit 2", "gene_name": "CPN2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P20023-1", "protein_name": "Complement receptor type 2", "gene_name": "CR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01860-2", "protein_name": "Immunoglobulin heavy constant gamma 3", "gene_name": "IGHG3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01861-2", "protein_name": "Immunoglobulin heavy constant gamma 4", "gene_name": "IGHG4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CF74-1", "protein_name": "Immunoglobulin lambda constant 6", "gene_name": "IGLC6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P17927-1", "protein_name": "Complement receptor type 1", "gene_name": "CR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P10643-1", "protein_name": "Complement component C7", "gene_name": "C7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P07358-1", "protein_name": "Complement component C8 beta chain", "gene_name": "C8B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BXR6-1", "protein_name": "Complement factor H-related protein 5", "gene_name": "CFHR5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P36980-1", "protein_name": "Complement factor H-related protein 2", "gene_name": "CFHR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q02985-1", "protein_name": "Complement factor H-related protein 3", "gene_name": "CFHR3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P02746-1", "protein_name": "Complement C1q subcomponent subunit B", "gene_name": "C1QB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9P296-1", "protein_name": "C5a anaphylatoxin chemotactic receptor 2", "gene_name": "C5AR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P02745-1", "protein_name": "Complement C1q subcomponent subunit A", "gene_name": "C1QA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04004-1", "protein_name": "Vitronectin", "gene_name": "VTN", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01825-1", "protein_name": "Immunoglobulin heavy variable 4-59", "gene_name": "IGHV4-59", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01817-1", "protein_name": "Immunoglobulin heavy variable 2-5", "gene_name": "IGHV2-5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01824-1", "protein_name": "Immunoglobulin heavy variable 4-39", "gene_name": "IGHV4-39", "tax_name": "Human" }, { "uniprot_canonical_ac": "P23083-1", "protein_name": "Immunoglobulin heavy variable 1-2", "gene_name": "IGHV1-2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P07225-1", "protein_name": "Vitamin K-dependent protein S", "gene_name": "PROS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01742-1", "protein_name": "Immunoglobulin heavy variable 1-69", "gene_name": "IGHV1-69", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01768-1", "protein_name": "Immunoglobulin heavy variable 3-30", "gene_name": "IGHV3-30", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01814-1", "protein_name": "Immunoglobulin heavy variable 2-70", "gene_name": "IGHV2-70", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92496-1", "protein_name": "Complement factor H-related protein 4", "gene_name": "CFHR4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01772-1", "protein_name": "Immunoglobulin heavy variable 3-33", "gene_name": "IGHV3-33", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01762-1", "protein_name": "Immunoglobulin heavy variable 3-11", "gene_name": "IGHV3-11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01763-1", "protein_name": "Immunoglobulin heavy variable 3-48", "gene_name": "IGHV3-48", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01764-1", "protein_name": "Immunoglobulin heavy variable 3-23", "gene_name": "IGHV3-23", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01766-1", "protein_name": "Immunoglobulin heavy variable 3-13", "gene_name": "IGHV3-13", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01780-1", "protein_name": "Immunoglobulin heavy variable 3-7", "gene_name": "IGHV3-7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01782-1", "protein_name": "Immunoglobulin heavy variable 3-9", "gene_name": "IGHV3-9", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0M8Q6-1", "protein_name": "Immunoglobulin lambda constant 7", "gene_name": "IGLC7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01834-1", "protein_name": "Immunoglobulin kappa constant", "gene_name": "IGKC", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01859-2", "protein_name": "Immunoglobulin heavy constant gamma 2", "gene_name": "IGHG2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG04-1", "protein_name": "Immunoglobulin lambda constant 1", "gene_name": "IGLC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DOY3-1", "protein_name": "Immunoglobulin lambda constant 3", "gene_name": "IGLC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P13987-1", "protein_name": "CD59 glycoprotein", "gene_name": "CD59", "tax_name": "Human" }, { "uniprot_canonical_ac": "P60033-1", "protein_name": "CD81 antigen", "gene_name": "CD81", "tax_name": "Human" }, { "uniprot_canonical_ac": "P21730-1", "protein_name": "C5a anaphylatoxin chemotactic receptor 1", "gene_name": "C5AR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P15169-1", "protein_name": "Carboxypeptidase N catalytic chain", "gene_name": "CPN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01024-1", "protein_name": "Complement C3", "gene_name": "C3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P00751-1", "protein_name": "Complement factor B", "gene_name": "CFB", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01743-1", "protein_name": "Immunoglobulin heavy variable 1-46", "gene_name": "IGHV1-46", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27918-1", "protein_name": "Properdin", "gene_name": "CFP", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0C4DH73-1", "protein_name": "Immunoglobulin kappa variable 1-12", "gene_name": "IGKV1-12", "tax_name": "Human" }, { "uniprot_canonical_ac": "A2NJV5-1", "protein_name": "Immunoglobulin kappa variable 2-29", "gene_name": "IGKV2-29", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01594-1", "protein_name": "Immunoglobulin kappa variable 1-33", "gene_name": "IGKV1-33", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04430-1", "protein_name": "Immunoglobulin kappa variable 1-16", "gene_name": "IGKV1-16", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01857-2", "protein_name": "Immunoglobulin heavy constant gamma 1", "gene_name": "IGHG1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q03591-1", "protein_name": "Complement factor H-related protein 1", "gene_name": "CFHR1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P01700", "url": "https://www.uniprot.org/uniprotkb/P01700" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.11694537", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 110 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Structure-function analysis of Lyn kinase association with lipid rafts and initiation of early signaling events after Fcepsilon receptor I aggregation.", "journal": "Molecular and cellular biology", "date": "2001", "authors": "Kovarova M, Tolar P, Arudchandran R, Draberova L, Rivera J, Draber P", "reference": { "type": "PubMed", "id": "11713268", "url": "https://pubmed.ncbi.nlm.nih.gov/11713268" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P01700-1", "protein_name": "Immunoglobulin lambda variable 1-47", "gene_name": "IGLV1-47", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01714-1", "protein_name": "Immunoglobulin lambda variable 3-19", "gene_name": "IGLV3-19", "tax_name": "Human" }, { "uniprot_canonical_ac": "P80748-1", "protein_name": "Immunoglobulin lambda variable 3-21", "gene_name": "IGLV3-21", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A075B6P5-1", "protein_name": "Immunoglobulin kappa variable 2-28", "gene_name": "IGKV2-28", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A075B6S6-1", "protein_name": "Immunoglobulin kappa variable 2D-30", "gene_name": "IGKV2D-30", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0C4DH25-1", "protein_name": "Immunoglobulin kappa variable 3D-20", "gene_name": "IGKV3D-20", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01593-1", "protein_name": "Immunoglobulin kappa variable 1D-33", "gene_name": "IGKV1D-33", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01599-1", "protein_name": "Immunoglobulin kappa variable 1-17", "gene_name": "IGKV1-17", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01601-1", "protein_name": "Immunoglobulin kappa variable 1D-16", "gene_name": "IGKV1D-16", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01611-1", "protein_name": "Immunoglobulin kappa variable 1D-12", "gene_name": "IGKV1D-12", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01615-1", "protein_name": "Immunoglobulin kappa variable 2D-28", "gene_name": "IGKV2D-28", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01619-1", "protein_name": "Immunoglobulin kappa variable 3-20", "gene_name": "IGKV3-20", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01624-1", "protein_name": "Immunoglobulin kappa variable 3-15", "gene_name": "IGKV3-15", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04433-1", "protein_name": "Immunoglobulin kappa variable 3-11", "gene_name": "IGKV3-11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01602-1", "protein_name": "Immunoglobulin kappa variable 1-5", "gene_name": "IGKV1-5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P43405-1", "protein_name": "Tyrosine-protein kinase SYK", "gene_name": "SYK", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01362-1", "protein_name": "High affinity immunoglobulin epsilon receptor subunit beta", "gene_name": "MS4A2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P30273-1", "protein_name": "High affinity immunoglobulin epsilon receptor subunit gamma", "gene_name": "FCER1G", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01767-1", "protein_name": "Immunoglobulin heavy variable 3-53", "gene_name": "IGHV3-53", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06331-1", "protein_name": "Immunoglobulin heavy variable 4-34", "gene_name": "IGHV4-34", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01597-1", "protein_name": "Immunoglobulin kappa variable 1-39", "gene_name": "IGKV1-39", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06310-1", "protein_name": "Immunoglobulin kappa variable 2-30", "gene_name": "IGKV2-30", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06312-1", "protein_name": "Immunoglobulin kappa variable 4-1", "gene_name": "IGKV4-1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01614-1", "protein_name": "Immunoglobulin kappa variable 2D-40", "gene_name": "IGKV2D-40", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DOY2-1", "protein_name": "Immunoglobulin lambda constant 2", "gene_name": "IGLC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04432-1", "protein_name": "Immunoglobulin kappa variable 1D-39", "gene_name": "IGKV1D-39", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06315-1", "protein_name": "Immunoglobulin kappa variable 5-2", "gene_name": "IGKV5-2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01699-1", "protein_name": "Immunoglobulin lambda variable 1-44", "gene_name": "IGLV1-44", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01701-1", "protein_name": "Immunoglobulin lambda variable 1-51", "gene_name": "IGLV1-51", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01704-1", "protein_name": "Immunoglobulin lambda variable 2-14", "gene_name": "IGLV2-14", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01706-1", "protein_name": "Immunoglobulin lambda variable 2-11", "gene_name": "IGLV2-11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01709-1", "protein_name": "Immunoglobulin lambda variable 2-8", "gene_name": "IGLV2-8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01717-1", "protein_name": "Immunoglobulin lambda variable 3-25", "gene_name": "IGLV3-25", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01721-1", "protein_name": "Immunoglobulin lambda variable 6-57", "gene_name": "IGLV6-57", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01703-1", "protein_name": "Immunoglobulin lambda variable 1-40", "gene_name": "IGLV1-40", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01705-1", "protein_name": "Immunoglobulin lambda variable 2-23", "gene_name": "IGLV2-23", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01715-1", "protein_name": "Immunoglobulin lambda variable 3-1", "gene_name": "IGLV3-1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01718-1", "protein_name": "Immunoglobulin lambda variable 3-27", "gene_name": "IGLV3-27", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04211-1", "protein_name": "Immunoglobulin lambda variable 7-43", "gene_name": "IGLV7-43", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CF74-1", "protein_name": "Immunoglobulin lambda constant 6", "gene_name": "IGLC6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P07948-1", "protein_name": "Tyrosine-protein kinase Lyn", "gene_name": "LYN", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01825-1", "protein_name": "Immunoglobulin heavy variable 4-59", "gene_name": "IGHV4-59", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01817-1", "protein_name": "Immunoglobulin heavy variable 2-5", "gene_name": "IGHV2-5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01824-1", "protein_name": "Immunoglobulin heavy variable 4-39", "gene_name": "IGHV4-39", "tax_name": "Human" }, { "uniprot_canonical_ac": "P23083-1", "protein_name": "Immunoglobulin heavy variable 1-2", "gene_name": "IGHV1-2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01742-1", "protein_name": "Immunoglobulin heavy variable 1-69", "gene_name": "IGHV1-69", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01768-1", "protein_name": "Immunoglobulin heavy variable 3-30", "gene_name": "IGHV3-30", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01814-1", "protein_name": "Immunoglobulin heavy variable 2-70", "gene_name": "IGHV2-70", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01772-1", "protein_name": "Immunoglobulin heavy variable 3-33", "gene_name": "IGHV3-33", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01762-1", "protein_name": "Immunoglobulin heavy variable 3-11", "gene_name": "IGHV3-11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01763-1", "protein_name": "Immunoglobulin heavy variable 3-48", "gene_name": "IGHV3-48", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01764-1", "protein_name": "Immunoglobulin heavy variable 3-23", "gene_name": "IGHV3-23", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01766-1", "protein_name": "Immunoglobulin heavy variable 3-13", "gene_name": "IGHV3-13", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01780-1", "protein_name": "Immunoglobulin heavy variable 3-7", "gene_name": "IGHV3-7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01782-1", "protein_name": "Immunoglobulin heavy variable 3-9", "gene_name": "IGHV3-9", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0M8Q6-1", "protein_name": "Immunoglobulin lambda constant 7", "gene_name": "IGLC7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01834-1", "protein_name": "Immunoglobulin kappa constant", "gene_name": "IGKC", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG04-1", "protein_name": "Immunoglobulin lambda constant 1", "gene_name": "IGLC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DOY3-1", "protein_name": "Immunoglobulin lambda constant 3", "gene_name": "IGLC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01743-1", "protein_name": "Immunoglobulin heavy variable 1-46", "gene_name": "IGHV1-46", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01854-2", "protein_name": "Immunoglobulin heavy constant epsilon", "gene_name": "IGHE", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0C4DH73-1", "protein_name": "Immunoglobulin kappa variable 1-12", "gene_name": "IGKV1-12", "tax_name": "Human" }, { "uniprot_canonical_ac": "A2NJV5-1", "protein_name": "Immunoglobulin kappa variable 2-29", "gene_name": "IGKV2-29", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01594-1", "protein_name": "Immunoglobulin kappa variable 1-33", "gene_name": "IGKV1-33", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04430-1", "protein_name": "Immunoglobulin kappa variable 1-16", "gene_name": "IGKV1-16", "tax_name": "Human" }, { "uniprot_canonical_ac": "P12319-1", "protein_name": "High affinity immunoglobulin epsilon receptor subunit alpha", "gene_name": "FCER1A", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P01700", "url": "https://www.uniprot.org/uniprotkb/P01700" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.11713268", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 66 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Protein kinase C: structural and spatial regulation by phosphorylation, cofactors, and macromolecular interactions.", "journal": "Chemical reviews", "date": "2001", "authors": "Newton AC", "reference": { "type": "PubMed", "id": "11749377", "url": "https://pubmed.ncbi.nlm.nih.gov/11749377" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P01700-1", "protein_name": "Immunoglobulin lambda variable 1-47", "gene_name": "IGLV1-47", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01714-1", "protein_name": "Immunoglobulin lambda variable 3-19", "gene_name": "IGLV3-19", "tax_name": "Human" }, { "uniprot_canonical_ac": "P80748-1", "protein_name": "Immunoglobulin lambda variable 3-21", "gene_name": "IGLV3-21", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A075B6P5-1", "protein_name": "Immunoglobulin kappa variable 2-28", "gene_name": "IGKV2-28", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A075B6S6-1", "protein_name": "Immunoglobulin kappa variable 2D-30", "gene_name": "IGKV2D-30", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0C4DH25-1", "protein_name": "Immunoglobulin kappa variable 3D-20", "gene_name": "IGKV3D-20", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01593-1", "protein_name": "Immunoglobulin kappa variable 1D-33", "gene_name": "IGKV1D-33", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01599-1", "protein_name": "Immunoglobulin kappa variable 1-17", "gene_name": "IGKV1-17", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01601-1", "protein_name": "Immunoglobulin kappa variable 1D-16", "gene_name": "IGKV1D-16", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01611-1", "protein_name": "Immunoglobulin kappa variable 1D-12", "gene_name": "IGKV1D-12", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01615-1", "protein_name": "Immunoglobulin kappa variable 2D-28", "gene_name": "IGKV2D-28", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01619-1", "protein_name": "Immunoglobulin kappa variable 3-20", "gene_name": "IGKV3-20", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01624-1", "protein_name": "Immunoglobulin kappa variable 3-15", "gene_name": "IGKV3-15", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04433-1", "protein_name": "Immunoglobulin kappa variable 3-11", "gene_name": "IGKV3-11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01602-1", "protein_name": "Immunoglobulin kappa variable 1-5", "gene_name": "IGKV1-5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14643-1", "protein_name": "Inositol 1,4,5-trisphosphate-gated calcium channel ITPR1", "gene_name": "ITPR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P43405-1", "protein_name": "Tyrosine-protein kinase SYK", "gene_name": "SYK", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42336-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform", "gene_name": "PIK3CA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P08637-1", "protein_name": "Low affinity immunoglobulin gamma Fc region receptor III-A", "gene_name": "FCGR3A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01767-1", "protein_name": "Immunoglobulin heavy variable 3-53", "gene_name": "IGHV3-53", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06331-1", "protein_name": "Immunoglobulin heavy variable 4-34", "gene_name": "IGHV4-34", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14571-1", "protein_name": "Inositol 1,4,5-trisphosphate-gated calcium channel ITPR2", "gene_name": "ITPR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01597-1", "protein_name": "Immunoglobulin kappa variable 1-39", "gene_name": "IGKV1-39", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06310-1", "protein_name": "Immunoglobulin kappa variable 2-30", "gene_name": "IGKV2-30", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06312-1", "protein_name": "Immunoglobulin kappa variable 4-1", "gene_name": "IGKV4-1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01614-1", "protein_name": "Immunoglobulin kappa variable 2D-40", "gene_name": "IGKV2D-40", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q05655-1", "protein_name": "Protein kinase C delta type", "gene_name": "PRKCD", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13393-1", "protein_name": "Phospholipase D1", "gene_name": "PLD1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14939-1", "protein_name": "Phospholipase D2", "gene_name": "PLD2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DOY2-1", "protein_name": "Immunoglobulin lambda constant 2", "gene_name": "IGLC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P09693-1", "protein_name": "T-cell surface glycoprotein CD3 gamma chain", "gene_name": "CD3G", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04432-1", "protein_name": "Immunoglobulin kappa variable 1D-39", "gene_name": "IGKV1D-39", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06315-1", "protein_name": "Immunoglobulin kappa variable 5-2", "gene_name": "IGKV5-2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01699-1", "protein_name": "Immunoglobulin lambda variable 1-44", "gene_name": "IGLV1-44", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01701-1", "protein_name": "Immunoglobulin lambda variable 1-51", "gene_name": "IGLV1-51", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01704-1", "protein_name": "Immunoglobulin lambda variable 2-14", "gene_name": "IGLV2-14", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01706-1", "protein_name": "Immunoglobulin lambda variable 2-11", "gene_name": "IGLV2-11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01709-1", "protein_name": "Immunoglobulin lambda variable 2-8", "gene_name": "IGLV2-8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01717-1", "protein_name": "Immunoglobulin lambda variable 3-25", "gene_name": "IGLV3-25", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01721-1", "protein_name": "Immunoglobulin lambda variable 6-57", "gene_name": "IGLV6-57", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01703-1", "protein_name": "Immunoglobulin lambda variable 1-40", "gene_name": "IGLV1-40", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01705-1", "protein_name": "Immunoglobulin lambda variable 2-23", "gene_name": "IGLV2-23", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01715-1", "protein_name": "Immunoglobulin lambda variable 3-1", "gene_name": "IGLV3-1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01718-1", "protein_name": "Immunoglobulin lambda variable 3-27", "gene_name": "IGLV3-27", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04211-1", "protein_name": "Immunoglobulin lambda variable 7-43", "gene_name": "IGLV7-43", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01860-2", "protein_name": "Immunoglobulin heavy constant gamma 3", "gene_name": "IGHG3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01861-2", "protein_name": "Immunoglobulin heavy constant gamma 4", "gene_name": "IGHG4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CF74-1", "protein_name": "Immunoglobulin lambda constant 6", "gene_name": "IGLC6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q02156-1", "protein_name": "Protein kinase C epsilon type", "gene_name": "PRKCE", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00459-1", "protein_name": "Phosphatidylinositol 3-kinase regulatory subunit beta", "gene_name": "PIK3R2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P16885-1", "protein_name": "1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-2", "gene_name": "PLCG2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P12314-1", "protein_name": "High affinity immunoglobulin gamma Fc receptor I", "gene_name": "FCGR1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43865-1", "protein_name": "S-adenosylhomocysteine hydrolase-like protein 1", "gene_name": "AHCYL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01825-1", "protein_name": "Immunoglobulin heavy variable 4-59", "gene_name": "IGHV4-59", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42338-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit beta isoform", "gene_name": "PIK3CB", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01817-1", "protein_name": "Immunoglobulin heavy variable 2-5", "gene_name": "IGHV2-5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01824-1", "protein_name": "Immunoglobulin heavy variable 4-39", "gene_name": "IGHV4-39", "tax_name": "Human" }, { "uniprot_canonical_ac": "P23083-1", "protein_name": "Immunoglobulin heavy variable 1-2", "gene_name": "IGHV1-2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60733-1", "protein_name": "85/88 kDa calcium-independent phospholipase A2", "gene_name": "PLA2G6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5VZY2-1", "protein_name": "Phospholipid phosphatase 4", "gene_name": "PLPP4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NEB5-1", "protein_name": "Phospholipid phosphatase 5", "gene_name": "PLPP5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96BZ4-1", "protein_name": "5'-3' exonuclease PLD4", "gene_name": "PLD4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01742-1", "protein_name": "Immunoglobulin heavy variable 1-69", "gene_name": "IGHV1-69", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01768-1", "protein_name": "Immunoglobulin heavy variable 3-30", "gene_name": "IGHV3-30", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01814-1", "protein_name": "Immunoglobulin heavy variable 2-70", "gene_name": "IGHV2-70", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01772-1", "protein_name": "Immunoglobulin heavy variable 3-33", "gene_name": "IGHV3-33", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01762-1", "protein_name": "Immunoglobulin heavy variable 3-11", "gene_name": "IGHV3-11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01763-1", "protein_name": "Immunoglobulin heavy variable 3-48", "gene_name": "IGHV3-48", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01764-1", "protein_name": "Immunoglobulin heavy variable 3-23", "gene_name": "IGHV3-23", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01766-1", "protein_name": "Immunoglobulin heavy variable 3-13", "gene_name": "IGHV3-13", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01780-1", "protein_name": "Immunoglobulin heavy variable 3-7", "gene_name": "IGHV3-7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01782-1", "protein_name": "Immunoglobulin heavy variable 3-9", "gene_name": "IGHV3-9", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0M8Q6-1", "protein_name": "Immunoglobulin lambda constant 7", "gene_name": "IGLC7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01834-1", "protein_name": "Immunoglobulin kappa constant", "gene_name": "IGKC", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01859-2", "protein_name": "Immunoglobulin heavy constant gamma 2", "gene_name": "IGHG2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG04-1", "protein_name": "Immunoglobulin lambda constant 1", "gene_name": "IGLC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DOY3-1", "protein_name": "Immunoglobulin lambda constant 3", "gene_name": "IGLC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8IV08-1", "protein_name": "5'-3' exonuclease PLD3", "gene_name": "PLD3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01743-1", "protein_name": "Immunoglobulin heavy variable 1-46", "gene_name": "IGHV1-46", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14573-1", "protein_name": "Inositol 1,4,5-trisphosphate-gated calcium channel ITPR3", "gene_name": "ITPR3", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0C4DH73-1", "protein_name": "Immunoglobulin kappa variable 1-12", "gene_name": "IGKV1-12", "tax_name": "Human" }, { "uniprot_canonical_ac": "A2NJV5-1", "protein_name": "Immunoglobulin kappa variable 2-29", "gene_name": "IGKV2-29", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01594-1", "protein_name": "Immunoglobulin kappa variable 1-33", "gene_name": "IGKV1-33", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04430-1", "protein_name": "Immunoglobulin kappa variable 1-16", "gene_name": "IGKV1-16", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01857-2", "protein_name": "Immunoglobulin heavy constant gamma 1", "gene_name": "IGHG1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P12318-1", "protein_name": "Low affinity immunoglobulin gamma Fc region receptor II-a", "gene_name": "FCGR2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27986-1", "protein_name": "Phosphatidylinositol 3-kinase regulatory subunit alpha", "gene_name": "PIK3R1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P19174-1", "protein_name": "1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-1", "gene_name": "PLCG1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P01700", "url": "https://www.uniprot.org/uniprotkb/P01700" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.11749377", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 88 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Expression of Fc alpha/mu receptor by human mesangial cells: a candidate receptor for immune complex deposition in IgA nephropathy.", "journal": "Biochemical and biophysical research communications", "date": "2002", "authors": "McDonald KJ, Cameron AJ, Allen JM, Jardine AG", "reference": { "type": "PubMed", "id": "11779189", "url": "https://pubmed.ncbi.nlm.nih.gov/11779189" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P01700-1", "protein_name": "Immunoglobulin lambda variable 1-47", "gene_name": "IGLV1-47", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01714-1", "protein_name": "Immunoglobulin lambda variable 3-19", "gene_name": "IGLV3-19", "tax_name": "Human" }, { "uniprot_canonical_ac": "P80748-1", "protein_name": "Immunoglobulin lambda variable 3-21", "gene_name": "IGLV3-21", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A075B6P5-1", "protein_name": "Immunoglobulin kappa variable 2-28", "gene_name": "IGKV2-28", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A075B6S6-1", "protein_name": "Immunoglobulin kappa variable 2D-30", "gene_name": "IGKV2D-30", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0C4DH25-1", "protein_name": "Immunoglobulin kappa variable 3D-20", "gene_name": "IGKV3D-20", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01593-1", "protein_name": "Immunoglobulin kappa variable 1D-33", "gene_name": "IGKV1D-33", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01599-1", "protein_name": "Immunoglobulin kappa variable 1-17", "gene_name": "IGKV1-17", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01601-1", "protein_name": "Immunoglobulin kappa variable 1D-16", "gene_name": "IGKV1D-16", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01611-1", "protein_name": "Immunoglobulin kappa variable 1D-12", "gene_name": "IGKV1D-12", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01615-1", "protein_name": "Immunoglobulin kappa variable 2D-28", "gene_name": "IGKV2D-28", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01619-1", "protein_name": "Immunoglobulin kappa variable 3-20", "gene_name": "IGKV3-20", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01624-1", "protein_name": "Immunoglobulin kappa variable 3-15", "gene_name": "IGKV3-15", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04433-1", "protein_name": "Immunoglobulin kappa variable 3-11", "gene_name": "IGKV3-11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01602-1", "protein_name": "Immunoglobulin kappa variable 1-5", "gene_name": "IGKV1-5", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75056-1", "protein_name": "Syndecan-3", "gene_name": "SDC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P07204-1", "protein_name": "Thrombomodulin", "gene_name": "THBD", "tax_name": "Human" }, { "uniprot_canonical_ac": "P00734-1", "protein_name": "Prothrombin", "gene_name": "F2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P02452-1", "protein_name": "Collagen alpha-1(I) chain", "gene_name": "COL1A1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04114-1", "protein_name": "Apolipoprotein B-100", "gene_name": "APOB", "tax_name": "Human" }, { "uniprot_canonical_ac": "P02751-15", "protein_name": "Fibronectin", "gene_name": "FN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00220-1", "protein_name": "Tumor necrosis factor receptor superfamily member 10A", "gene_name": "TNFRSF10A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P14209-1", "protein_name": "CD99 antigen", "gene_name": "CD99", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9P1W8-1", "protein_name": "Signal-regulatory protein gamma", "gene_name": "SIRPG", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q08722-1", "protein_name": "Leukocyte surface antigen CD47", "gene_name": "CD47", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01871-2", "protein_name": "Immunoglobulin heavy constant mu", "gene_name": "IGHM", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UNN8-1", "protein_name": "Endothelial protein C receptor", "gene_name": "PROCR", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8WWV6-1", "protein_name": "High affinity immunoglobulin alpha and immunoglobulin mu Fc receptor", "gene_name": "FCAMR", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96AP7-1", "protein_name": "Endothelial cell-selective adhesion molecule", "gene_name": "ESAM", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14393-2", "protein_name": "Growth arrest-specific protein 6", "gene_name": "GAS6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P30273-1", "protein_name": "High affinity immunoglobulin epsilon receptor subunit gamma", "gene_name": "FCER1G", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92896-1", "protein_name": "Golgi apparatus protein 1", "gene_name": "GLG1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P20701-1", "protein_name": "Integrin alpha-L", "gene_name": "ITGAL", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01767-1", "protein_name": "Immunoglobulin heavy variable 3-53", "gene_name": "IGHV3-53", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06331-1", "protein_name": "Immunoglobulin heavy variable 4-34", "gene_name": "IGHV4-34", "tax_name": "Human" }, { "uniprot_canonical_ac": "P19256-1", "protein_name": "Lymphocyte function-associated antigen 3", "gene_name": "CD58", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y624-1", "protein_name": "Junctional adhesion molecule A", "gene_name": "F11R", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01597-1", "protein_name": "Immunoglobulin kappa variable 1-39", "gene_name": "IGKV1-39", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06310-1", "protein_name": "Immunoglobulin kappa variable 2-30", "gene_name": "IGKV2-30", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06312-1", "protein_name": "Immunoglobulin kappa variable 4-1", "gene_name": "IGKV4-1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01614-1", "protein_name": "Immunoglobulin kappa variable 2D-40", "gene_name": "IGKV2D-40", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DOY2-1", "protein_name": "Immunoglobulin lambda constant 2", "gene_name": "IGLC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P78380-1", "protein_name": "Oxidized low-density lipoprotein receptor 1", "gene_name": "OLR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P11464-1", "protein_name": "Pregnancy-specific beta-1-glycoprotein 1", "gene_name": "PSG1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q00887-1", "protein_name": "Pregnancy-specific beta-1-glycoprotein 9", "gene_name": "PSG9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UQ72-1", "protein_name": "Pregnancy-specific beta-1-glycoprotein 11", "gene_name": "PSG11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06731-1", "protein_name": "Cell adhesion molecule CEACAM5", "gene_name": "CEACAM5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P18827-1", "protein_name": "Syndecan-1", "gene_name": "SDC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UIB8-1", "protein_name": "SLAM family member 5", "gene_name": "CD84", "tax_name": "Human" }, { "uniprot_canonical_ac": "P09326-1", "protein_name": "CD48 antigen", "gene_name": "CD48", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TCZ2-1", "protein_name": "CD99 antigen-like protein 2", "gene_name": "CD99L2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P02724-1", "protein_name": "Glycophorin-A", "gene_name": "GYPA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P14174-1", "protein_name": "Macrophage migration inhibitory factor", "gene_name": "MIF", "tax_name": "Human" }, { "uniprot_canonical_ac": "P13688-1", "protein_name": "Cell adhesion molecule CEACAM1", "gene_name": "CEACAM1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06729-1", "protein_name": "T-cell surface antigen CD2", "gene_name": "CD2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P40199-1", "protein_name": "Cell adhesion molecule CEACAM6", "gene_name": "CEACAM6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BZW8-1", "protein_name": "Natural killer cell receptor 2B4", "gene_name": "CD244", "tax_name": "Human" }, { "uniprot_canonical_ac": "P16070-1", "protein_name": "CD44 antigen", "gene_name": "CD44", "tax_name": "Human" }, { "uniprot_canonical_ac": "P31997-1", "protein_name": "Cell adhesion molecule CEACAM8", "gene_name": "CEACAM8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P40198-1", "protein_name": "Cell adhesion molecule CEACAM3", "gene_name": "CEACAM3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N6Q3-1", "protein_name": "CD177 antigen", "gene_name": "CD177", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04233-1", "protein_name": "HLA class II histocompatibility antigen gamma chain", "gene_name": "CD74", "tax_name": "Human" }, { "uniprot_canonical_ac": "P16284-1", "protein_name": "Platelet endothelial cell adhesion molecule", "gene_name": "PECAM1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P31431-1", "protein_name": "Syndecan-4", "gene_name": "SDC4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04432-1", "protein_name": "Immunoglobulin kappa variable 1D-39", "gene_name": "IGKV1D-39", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06315-1", "protein_name": "Immunoglobulin kappa variable 5-2", "gene_name": "IGKV5-2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01699-1", "protein_name": "Immunoglobulin lambda variable 1-44", "gene_name": "IGLV1-44", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01701-1", "protein_name": "Immunoglobulin lambda variable 1-51", "gene_name": "IGLV1-51", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01704-1", "protein_name": "Immunoglobulin lambda variable 2-14", "gene_name": "IGLV2-14", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01706-1", "protein_name": "Immunoglobulin lambda variable 2-11", "gene_name": "IGLV2-11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01709-1", "protein_name": "Immunoglobulin lambda variable 2-8", "gene_name": "IGLV2-8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01717-1", "protein_name": "Immunoglobulin lambda variable 3-25", "gene_name": "IGLV3-25", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01721-1", "protein_name": "Immunoglobulin lambda variable 6-57", "gene_name": "IGLV6-57", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01703-1", "protein_name": "Immunoglobulin lambda variable 1-40", "gene_name": "IGLV1-40", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01705-1", "protein_name": "Immunoglobulin lambda variable 2-23", "gene_name": "IGLV2-23", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01715-1", "protein_name": "Immunoglobulin lambda variable 3-1", "gene_name": "IGLV3-1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01718-1", "protein_name": "Immunoglobulin lambda variable 3-27", "gene_name": "IGLV3-27", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04211-1", "protein_name": "Immunoglobulin lambda variable 7-43", "gene_name": "IGLV7-43", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06028-1", "protein_name": "Glycophorin-B", "gene_name": "GYPB", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04921-1", "protein_name": "Glycophorin-C", "gene_name": "GYPC", "tax_name": "Human" }, { "uniprot_canonical_ac": "P15814-1", "protein_name": "Immunoglobulin lambda-like polypeptide 1", "gene_name": "IGLL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P11215-1", "protein_name": "Integrin alpha-M", "gene_name": "ITGAM", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01876-2", "protein_name": "Immunoglobulin heavy constant alpha 1", "gene_name": "IGHA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CF74-1", "protein_name": "Immunoglobulin lambda constant 6", "gene_name": "IGLC6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P08648-1", "protein_name": "Integrin alpha-5", "gene_name": "ITGA5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P13612-1", "protein_name": "Integrin alpha-4", "gene_name": "ITGA4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P02776-1", "protein_name": "Platelet factor 4", "gene_name": "PF4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P07948-1", "protein_name": "Tyrosine-protein kinase Lyn", "gene_name": "LYN", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05556-1", "protein_name": "Integrin beta-1", "gene_name": "ITGB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NRD5-1", "protein_name": "PRKCA-binding protein", "gene_name": "PICK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P08123-1", "protein_name": "Collagen alpha-2(I) chain", "gene_name": "COL1A2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04070-1", "protein_name": "Vitamin K-dependent protein C", "gene_name": "PROC", "tax_name": "Human" }, { "uniprot_canonical_ac": "P34741-1", "protein_name": "Syndecan-2", "gene_name": "SDC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P78310-1", "protein_name": "Coxsackievirus and adenovirus receptor", "gene_name": "CXADR", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HCN6-1", "protein_name": "Platelet glycoprotein VI", "gene_name": "GP6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35052-1", "protein_name": "Glypican-1", "gene_name": "GPC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NP99-1", "protein_name": "Triggering receptor expressed on myeloid cells 1", "gene_name": "TREM1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01825-1", "protein_name": "Immunoglobulin heavy variable 4-59", "gene_name": "IGHV4-59", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01817-1", "protein_name": "Immunoglobulin heavy variable 2-5", "gene_name": "IGHV2-5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01824-1", "protein_name": "Immunoglobulin heavy variable 4-39", "gene_name": "IGHV4-39", "tax_name": "Human" }, { "uniprot_canonical_ac": "P23083-1", "protein_name": "Immunoglobulin heavy variable 1-2", "gene_name": "IGHV1-2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P10720-1", "protein_name": "Platelet factor 4 variant", "gene_name": "PF4V1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q00888-1", "protein_name": "Pregnancy-specific beta-1-glycoprotein 4", "gene_name": "PSG4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13046-1", "protein_name": "Pregnancy-specific beta-1-glycoprotein 7", "gene_name": "PSG7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q00889-1", "protein_name": "Pregnancy-specific beta-1-glycoprotein 6", "gene_name": "PSG6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P07225-1", "protein_name": "Vitamin K-dependent protein S", "gene_name": "PROS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P11465-1", "protein_name": "Pregnancy-specific beta-1-glycoprotein 2", "gene_name": "PSG2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01742-1", "protein_name": "Immunoglobulin heavy variable 1-69", "gene_name": "IGHV1-69", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01768-1", "protein_name": "Immunoglobulin heavy variable 3-30", "gene_name": "IGHV3-30", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01814-1", "protein_name": "Immunoglobulin heavy variable 2-70", "gene_name": "IGHV2-70", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01772-1", "protein_name": "Immunoglobulin heavy variable 3-33", "gene_name": "IGHV3-33", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01762-1", "protein_name": "Immunoglobulin heavy variable 3-11", "gene_name": "IGHV3-11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01763-1", "protein_name": "Immunoglobulin heavy variable 3-48", "gene_name": "IGHV3-48", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01764-1", "protein_name": "Immunoglobulin heavy variable 3-23", "gene_name": "IGHV3-23", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01766-1", "protein_name": "Immunoglobulin heavy variable 3-13", "gene_name": "IGHV3-13", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01780-1", "protein_name": "Immunoglobulin heavy variable 3-7", "gene_name": "IGHV3-7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01782-1", "protein_name": "Immunoglobulin heavy variable 3-9", "gene_name": "IGHV3-9", "tax_name": "Human" }, { "uniprot_canonical_ac": "P20702-1", "protein_name": "Integrin alpha-X", "gene_name": "ITGAX", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86YT9-1", "protein_name": "Junctional adhesion molecule-like", "gene_name": "JAML", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01877-2", "protein_name": "Immunoglobulin heavy constant alpha 2", "gene_name": "IGHA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BX67-1", "protein_name": "Junctional adhesion molecule C", "gene_name": "JAM3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01591-1", "protein_name": "Immunoglobulin J chain", "gene_name": "JCHAIN", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UQ74-1", "protein_name": "Pregnancy-specific beta-1-glycoprotein 8", "gene_name": "PSG8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16557-1", "protein_name": "Pregnancy-specific beta-1-glycoprotein 3", "gene_name": "PSG3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15238-1", "protein_name": "Pregnancy-specific beta-1-glycoprotein 5", "gene_name": "PSG5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P57087-1", "protein_name": "Junctional adhesion molecule B", "gene_name": "JAM2", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0M8Q6-1", "protein_name": "Immunoglobulin lambda constant 7", "gene_name": "IGLC7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01834-1", "protein_name": "Immunoglobulin kappa constant", "gene_name": "IGKC", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG04-1", "protein_name": "Immunoglobulin lambda constant 1", "gene_name": "IGLC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DOY3-1", "protein_name": "Immunoglobulin lambda constant 3", "gene_name": "IGLC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P78324-1", "protein_name": "Tyrosine-protein phosphatase non-receptor type substrate 1", "gene_name": "SIRPA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UKI3-1", "protein_name": "Pre-B lymphocyte protein 3", "gene_name": "VPREB3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P12018-1", "protein_name": "Immunoglobulin iota chain", "gene_name": "VPREB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01743-1", "protein_name": "Immunoglobulin heavy variable 1-46", "gene_name": "IGHV1-46", "tax_name": "Human" }, { "uniprot_canonical_ac": "P16109-1", "protein_name": "P-selectin", "gene_name": "SELP", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14242-1", "protein_name": "P-selectin glycoprotein ligand 1", "gene_name": "SELPLG", "tax_name": "Human" }, { "uniprot_canonical_ac": "P16581-1", "protein_name": "E-selectin", "gene_name": "SELE", "tax_name": "Human" }, { "uniprot_canonical_ac": "P16150-1", "protein_name": "Leukosialin", "gene_name": "SPN", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0C4DH73-1", "protein_name": "Immunoglobulin kappa variable 1-12", "gene_name": "IGKV1-12", "tax_name": "Human" }, { "uniprot_canonical_ac": "A2NJV5-1", "protein_name": "Immunoglobulin kappa variable 2-29", "gene_name": "IGKV2-29", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01594-1", "protein_name": "Immunoglobulin kappa variable 1-33", "gene_name": "IGKV1-33", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04430-1", "protein_name": "Immunoglobulin kappa variable 1-16", "gene_name": "IGKV1-16", "tax_name": "Human" }, { "uniprot_canonical_ac": "P14151-1", "protein_name": "L-selectin", "gene_name": "SELL", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12866-1", "protein_name": "Tyrosine-protein kinase Mer", "gene_name": "MERTK", "tax_name": "Human" }, { "uniprot_canonical_ac": "P16422-1", "protein_name": "Epithelial cell adhesion molecule", "gene_name": "EPCAM", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UBN6-1", "protein_name": "Tumor necrosis factor receptor superfamily member 10D", "gene_name": "TNFRSF10D", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14763-1", "protein_name": "Tumor necrosis factor receptor superfamily member 10B", "gene_name": "TNFRSF10B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P41732-1", "protein_name": "Tetraspanin-7", "gene_name": "TSPAN7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01137-1", "protein_name": "Transforming growth factor beta-1 proprotein", "gene_name": "TGFB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06241-1", "protein_name": "Tyrosine-protein kinase Fyn", "gene_name": "FYN", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05107-1", "protein_name": "Integrin beta-2", "gene_name": "ITGB2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P01700", "url": "https://www.uniprot.org/uniprotkb/P01700" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.11779189", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 151 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "JAM-1 is a ligand of the beta(2) integrin LFA-1 involved in transendothelial migration of leukocytes.", "journal": "Nature immunology", "date": "2002", "authors": "Ostermann G, Weber KS, Zernecke A, Schroder A, Weber C", "reference": { "type": "PubMed", "id": "11812992", "url": "https://pubmed.ncbi.nlm.nih.gov/11812992" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P01700-1", "protein_name": "Immunoglobulin lambda variable 1-47", "gene_name": "IGLV1-47", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01714-1", "protein_name": "Immunoglobulin lambda variable 3-19", "gene_name": "IGLV3-19", "tax_name": "Human" }, { "uniprot_canonical_ac": "P80748-1", "protein_name": "Immunoglobulin lambda variable 3-21", "gene_name": "IGLV3-21", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A075B6P5-1", "protein_name": "Immunoglobulin kappa variable 2-28", "gene_name": "IGKV2-28", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A075B6S6-1", "protein_name": "Immunoglobulin kappa variable 2D-30", "gene_name": "IGKV2D-30", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0C4DH25-1", "protein_name": "Immunoglobulin kappa variable 3D-20", "gene_name": "IGKV3D-20", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01593-1", "protein_name": "Immunoglobulin kappa variable 1D-33", "gene_name": "IGKV1D-33", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01599-1", "protein_name": "Immunoglobulin kappa variable 1-17", "gene_name": "IGKV1-17", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01601-1", "protein_name": "Immunoglobulin kappa variable 1D-16", "gene_name": "IGKV1D-16", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01611-1", "protein_name": "Immunoglobulin kappa variable 1D-12", "gene_name": "IGKV1D-12", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01615-1", "protein_name": "Immunoglobulin kappa variable 2D-28", "gene_name": "IGKV2D-28", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01619-1", "protein_name": "Immunoglobulin kappa variable 3-20", "gene_name": "IGKV3-20", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01624-1", "protein_name": "Immunoglobulin kappa variable 3-15", "gene_name": "IGKV3-15", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04433-1", "protein_name": "Immunoglobulin kappa variable 3-11", "gene_name": "IGKV3-11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01602-1", "protein_name": "Immunoglobulin kappa variable 1-5", "gene_name": "IGKV1-5", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75056-1", "protein_name": "Syndecan-3", "gene_name": "SDC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P07204-1", "protein_name": "Thrombomodulin", "gene_name": "THBD", "tax_name": "Human" }, { "uniprot_canonical_ac": "P00734-1", "protein_name": "Prothrombin", "gene_name": "F2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P02452-1", "protein_name": "Collagen alpha-1(I) chain", "gene_name": "COL1A1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04114-1", "protein_name": "Apolipoprotein B-100", "gene_name": "APOB", "tax_name": "Human" }, { "uniprot_canonical_ac": "P02751-15", "protein_name": "Fibronectin", "gene_name": "FN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00220-1", "protein_name": "Tumor necrosis factor receptor superfamily member 10A", "gene_name": "TNFRSF10A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P14209-1", "protein_name": "CD99 antigen", "gene_name": "CD99", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9P1W8-1", "protein_name": "Signal-regulatory protein gamma", "gene_name": "SIRPG", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q08722-1", "protein_name": "Leukocyte surface antigen CD47", "gene_name": "CD47", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01871-2", "protein_name": "Immunoglobulin heavy constant mu", "gene_name": "IGHM", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UNN8-1", "protein_name": "Endothelial protein C receptor", "gene_name": "PROCR", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8WWV6-1", "protein_name": "High affinity immunoglobulin alpha and immunoglobulin mu Fc receptor", "gene_name": "FCAMR", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96AP7-1", "protein_name": "Endothelial cell-selective adhesion molecule", "gene_name": "ESAM", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14393-2", "protein_name": "Growth arrest-specific protein 6", "gene_name": "GAS6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P30273-1", "protein_name": "High affinity immunoglobulin epsilon receptor subunit gamma", "gene_name": "FCER1G", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92896-1", "protein_name": "Golgi apparatus protein 1", "gene_name": "GLG1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P20701-1", "protein_name": "Integrin alpha-L", "gene_name": "ITGAL", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01767-1", "protein_name": "Immunoglobulin heavy variable 3-53", "gene_name": "IGHV3-53", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06331-1", "protein_name": "Immunoglobulin heavy variable 4-34", "gene_name": "IGHV4-34", "tax_name": "Human" }, { "uniprot_canonical_ac": "P19256-1", "protein_name": "Lymphocyte function-associated antigen 3", "gene_name": "CD58", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y624-1", "protein_name": "Junctional adhesion molecule A", "gene_name": "F11R", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01597-1", "protein_name": "Immunoglobulin kappa variable 1-39", "gene_name": "IGKV1-39", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06310-1", "protein_name": "Immunoglobulin kappa variable 2-30", "gene_name": "IGKV2-30", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06312-1", "protein_name": "Immunoglobulin kappa variable 4-1", "gene_name": "IGKV4-1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01614-1", "protein_name": "Immunoglobulin kappa variable 2D-40", "gene_name": "IGKV2D-40", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DOY2-1", "protein_name": "Immunoglobulin lambda constant 2", "gene_name": "IGLC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P78380-1", "protein_name": "Oxidized low-density lipoprotein receptor 1", "gene_name": "OLR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P11464-1", "protein_name": "Pregnancy-specific beta-1-glycoprotein 1", "gene_name": "PSG1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q00887-1", "protein_name": "Pregnancy-specific beta-1-glycoprotein 9", "gene_name": "PSG9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UQ72-1", "protein_name": "Pregnancy-specific beta-1-glycoprotein 11", "gene_name": "PSG11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06731-1", "protein_name": "Cell adhesion molecule CEACAM5", "gene_name": "CEACAM5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P18827-1", "protein_name": "Syndecan-1", "gene_name": "SDC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UIB8-1", "protein_name": "SLAM family member 5", "gene_name": "CD84", "tax_name": "Human" }, { "uniprot_canonical_ac": "P09326-1", "protein_name": "CD48 antigen", "gene_name": "CD48", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TCZ2-1", "protein_name": "CD99 antigen-like protein 2", "gene_name": "CD99L2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P02724-1", "protein_name": "Glycophorin-A", "gene_name": "GYPA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P14174-1", "protein_name": "Macrophage migration inhibitory factor", "gene_name": "MIF", "tax_name": "Human" }, { "uniprot_canonical_ac": "P13688-1", "protein_name": "Cell adhesion molecule CEACAM1", "gene_name": "CEACAM1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06729-1", "protein_name": "T-cell surface antigen CD2", "gene_name": "CD2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P40199-1", "protein_name": "Cell adhesion molecule CEACAM6", "gene_name": "CEACAM6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BZW8-1", "protein_name": "Natural killer cell receptor 2B4", "gene_name": "CD244", "tax_name": "Human" }, { "uniprot_canonical_ac": "P16070-1", "protein_name": "CD44 antigen", "gene_name": "CD44", "tax_name": "Human" }, { "uniprot_canonical_ac": "P31997-1", "protein_name": "Cell adhesion molecule CEACAM8", "gene_name": "CEACAM8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P40198-1", "protein_name": "Cell adhesion molecule CEACAM3", "gene_name": "CEACAM3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N6Q3-1", "protein_name": "CD177 antigen", "gene_name": "CD177", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04233-1", "protein_name": "HLA class II histocompatibility antigen gamma chain", "gene_name": "CD74", "tax_name": "Human" }, { "uniprot_canonical_ac": "P16284-1", "protein_name": "Platelet endothelial cell adhesion molecule", "gene_name": "PECAM1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P31431-1", "protein_name": "Syndecan-4", "gene_name": "SDC4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04432-1", "protein_name": "Immunoglobulin kappa variable 1D-39", "gene_name": "IGKV1D-39", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06315-1", "protein_name": "Immunoglobulin kappa variable 5-2", "gene_name": "IGKV5-2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01699-1", "protein_name": "Immunoglobulin lambda variable 1-44", "gene_name": "IGLV1-44", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01701-1", "protein_name": "Immunoglobulin lambda variable 1-51", "gene_name": "IGLV1-51", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01704-1", "protein_name": "Immunoglobulin lambda variable 2-14", "gene_name": "IGLV2-14", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01706-1", "protein_name": "Immunoglobulin lambda variable 2-11", "gene_name": "IGLV2-11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01709-1", "protein_name": "Immunoglobulin lambda variable 2-8", "gene_name": "IGLV2-8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01717-1", "protein_name": "Immunoglobulin lambda variable 3-25", "gene_name": "IGLV3-25", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01721-1", "protein_name": "Immunoglobulin lambda variable 6-57", "gene_name": "IGLV6-57", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01703-1", "protein_name": "Immunoglobulin lambda variable 1-40", "gene_name": "IGLV1-40", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01705-1", "protein_name": "Immunoglobulin lambda variable 2-23", "gene_name": "IGLV2-23", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01715-1", "protein_name": "Immunoglobulin lambda variable 3-1", "gene_name": "IGLV3-1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01718-1", "protein_name": "Immunoglobulin lambda variable 3-27", "gene_name": "IGLV3-27", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04211-1", "protein_name": "Immunoglobulin lambda variable 7-43", "gene_name": "IGLV7-43", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06028-1", "protein_name": "Glycophorin-B", "gene_name": "GYPB", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04921-1", "protein_name": "Glycophorin-C", "gene_name": "GYPC", "tax_name": "Human" }, { "uniprot_canonical_ac": "P15814-1", "protein_name": "Immunoglobulin lambda-like polypeptide 1", "gene_name": "IGLL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P11215-1", "protein_name": "Integrin alpha-M", "gene_name": "ITGAM", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01876-2", "protein_name": "Immunoglobulin heavy constant alpha 1", "gene_name": "IGHA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CF74-1", "protein_name": "Immunoglobulin lambda constant 6", "gene_name": "IGLC6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P08648-1", "protein_name": "Integrin alpha-5", "gene_name": "ITGA5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P13612-1", "protein_name": "Integrin alpha-4", "gene_name": "ITGA4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P02776-1", "protein_name": "Platelet factor 4", "gene_name": "PF4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P07948-1", "protein_name": "Tyrosine-protein kinase Lyn", "gene_name": "LYN", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05556-1", "protein_name": "Integrin beta-1", "gene_name": "ITGB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NRD5-1", "protein_name": "PRKCA-binding protein", "gene_name": "PICK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P08123-1", "protein_name": "Collagen alpha-2(I) chain", "gene_name": "COL1A2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04070-1", "protein_name": "Vitamin K-dependent protein C", "gene_name": "PROC", "tax_name": "Human" }, { "uniprot_canonical_ac": "P34741-1", "protein_name": "Syndecan-2", "gene_name": "SDC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P78310-1", "protein_name": "Coxsackievirus and adenovirus receptor", "gene_name": "CXADR", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HCN6-1", "protein_name": "Platelet glycoprotein VI", "gene_name": "GP6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35052-1", "protein_name": "Glypican-1", "gene_name": "GPC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NP99-1", "protein_name": "Triggering receptor expressed on myeloid cells 1", "gene_name": "TREM1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01825-1", "protein_name": "Immunoglobulin heavy variable 4-59", "gene_name": "IGHV4-59", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01817-1", "protein_name": "Immunoglobulin heavy variable 2-5", "gene_name": "IGHV2-5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01824-1", "protein_name": "Immunoglobulin heavy variable 4-39", "gene_name": "IGHV4-39", "tax_name": "Human" }, { "uniprot_canonical_ac": "P23083-1", "protein_name": "Immunoglobulin heavy variable 1-2", "gene_name": "IGHV1-2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P10720-1", "protein_name": "Platelet factor 4 variant", "gene_name": "PF4V1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q00888-1", "protein_name": "Pregnancy-specific beta-1-glycoprotein 4", "gene_name": "PSG4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13046-1", "protein_name": "Pregnancy-specific beta-1-glycoprotein 7", "gene_name": "PSG7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q00889-1", "protein_name": "Pregnancy-specific beta-1-glycoprotein 6", "gene_name": "PSG6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P07225-1", "protein_name": "Vitamin K-dependent protein S", "gene_name": "PROS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P11465-1", "protein_name": "Pregnancy-specific beta-1-glycoprotein 2", "gene_name": "PSG2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01742-1", "protein_name": "Immunoglobulin heavy variable 1-69", "gene_name": "IGHV1-69", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01768-1", "protein_name": "Immunoglobulin heavy variable 3-30", "gene_name": "IGHV3-30", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01814-1", "protein_name": "Immunoglobulin heavy variable 2-70", "gene_name": "IGHV2-70", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01772-1", "protein_name": "Immunoglobulin heavy variable 3-33", "gene_name": "IGHV3-33", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01762-1", "protein_name": "Immunoglobulin heavy variable 3-11", "gene_name": "IGHV3-11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01763-1", "protein_name": "Immunoglobulin heavy variable 3-48", "gene_name": "IGHV3-48", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01764-1", "protein_name": "Immunoglobulin heavy variable 3-23", "gene_name": "IGHV3-23", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01766-1", "protein_name": "Immunoglobulin heavy variable 3-13", "gene_name": "IGHV3-13", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01780-1", "protein_name": "Immunoglobulin heavy variable 3-7", "gene_name": "IGHV3-7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01782-1", "protein_name": "Immunoglobulin heavy variable 3-9", "gene_name": "IGHV3-9", "tax_name": "Human" }, { "uniprot_canonical_ac": "P20702-1", "protein_name": "Integrin alpha-X", "gene_name": "ITGAX", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86YT9-1", "protein_name": "Junctional adhesion molecule-like", "gene_name": "JAML", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01877-2", "protein_name": "Immunoglobulin heavy constant alpha 2", "gene_name": "IGHA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BX67-1", "protein_name": "Junctional adhesion molecule C", "gene_name": "JAM3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01591-1", "protein_name": "Immunoglobulin J chain", "gene_name": "JCHAIN", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UQ74-1", "protein_name": "Pregnancy-specific beta-1-glycoprotein 8", "gene_name": "PSG8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16557-1", "protein_name": "Pregnancy-specific beta-1-glycoprotein 3", "gene_name": "PSG3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15238-1", "protein_name": "Pregnancy-specific beta-1-glycoprotein 5", "gene_name": "PSG5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P57087-1", "protein_name": "Junctional adhesion molecule B", "gene_name": "JAM2", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0M8Q6-1", "protein_name": "Immunoglobulin lambda constant 7", "gene_name": "IGLC7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01834-1", "protein_name": "Immunoglobulin kappa constant", "gene_name": "IGKC", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG04-1", "protein_name": "Immunoglobulin lambda constant 1", "gene_name": "IGLC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DOY3-1", "protein_name": "Immunoglobulin lambda constant 3", "gene_name": "IGLC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P78324-1", "protein_name": "Tyrosine-protein phosphatase non-receptor type substrate 1", "gene_name": "SIRPA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UKI3-1", "protein_name": "Pre-B lymphocyte protein 3", "gene_name": "VPREB3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P12018-1", "protein_name": "Immunoglobulin iota chain", "gene_name": "VPREB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01743-1", "protein_name": "Immunoglobulin heavy variable 1-46", "gene_name": "IGHV1-46", "tax_name": "Human" }, { "uniprot_canonical_ac": "P16109-1", "protein_name": "P-selectin", "gene_name": "SELP", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14242-1", "protein_name": "P-selectin glycoprotein ligand 1", "gene_name": "SELPLG", "tax_name": "Human" }, { "uniprot_canonical_ac": "P16581-1", "protein_name": "E-selectin", "gene_name": "SELE", "tax_name": "Human" }, { "uniprot_canonical_ac": "P16150-1", "protein_name": "Leukosialin", "gene_name": "SPN", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0C4DH73-1", "protein_name": "Immunoglobulin kappa variable 1-12", "gene_name": "IGKV1-12", "tax_name": "Human" }, { "uniprot_canonical_ac": "A2NJV5-1", "protein_name": "Immunoglobulin kappa variable 2-29", "gene_name": "IGKV2-29", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01594-1", "protein_name": "Immunoglobulin kappa variable 1-33", "gene_name": "IGKV1-33", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04430-1", "protein_name": "Immunoglobulin kappa variable 1-16", "gene_name": "IGKV1-16", "tax_name": "Human" }, { "uniprot_canonical_ac": "P14151-1", "protein_name": "L-selectin", "gene_name": "SELL", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12866-1", "protein_name": "Tyrosine-protein kinase Mer", "gene_name": "MERTK", "tax_name": "Human" }, { "uniprot_canonical_ac": "P16422-1", "protein_name": "Epithelial cell adhesion molecule", "gene_name": "EPCAM", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UBN6-1", "protein_name": "Tumor necrosis factor receptor superfamily member 10D", "gene_name": "TNFRSF10D", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14763-1", "protein_name": "Tumor necrosis factor receptor superfamily member 10B", "gene_name": "TNFRSF10B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P41732-1", "protein_name": "Tetraspanin-7", "gene_name": "TSPAN7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01137-1", "protein_name": "Transforming growth factor beta-1 proprotein", "gene_name": "TGFB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06241-1", "protein_name": "Tyrosine-protein kinase Fyn", "gene_name": "FYN", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05107-1", "protein_name": "Integrin beta-2", "gene_name": "ITGB2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P01700", "url": "https://www.uniprot.org/uniprotkb/P01700" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.11812992", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 151 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Processing of the lipocalin alpha(1)-microglobulin by hemoglobin induces heme-binding and heme-degradation properties.", "journal": "Blood", "date": "2002", "authors": "Allhorn M, Berggard T, Nordberg J, Olsson ML, Akerstrom B", "reference": { "type": "PubMed", "id": "11877257", "url": "https://pubmed.ncbi.nlm.nih.gov/11877257" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P01700-1", "protein_name": "Immunoglobulin lambda variable 1-47", "gene_name": "IGLV1-47", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01714-1", "protein_name": "Immunoglobulin lambda variable 3-19", "gene_name": "IGLV3-19", "tax_name": "Human" }, { "uniprot_canonical_ac": "P80748-1", "protein_name": "Immunoglobulin lambda variable 3-21", "gene_name": "IGLV3-21", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A075B6P5-1", "protein_name": "Immunoglobulin kappa variable 2-28", "gene_name": "IGKV2-28", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A075B6S6-1", "protein_name": "Immunoglobulin kappa variable 2D-30", "gene_name": "IGKV2D-30", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0C4DH25-1", "protein_name": "Immunoglobulin kappa variable 3D-20", "gene_name": "IGKV3D-20", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01593-1", "protein_name": "Immunoglobulin kappa variable 1D-33", "gene_name": "IGKV1D-33", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01599-1", "protein_name": "Immunoglobulin kappa variable 1-17", "gene_name": "IGKV1-17", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01601-1", "protein_name": "Immunoglobulin kappa variable 1D-16", "gene_name": "IGKV1D-16", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01611-1", "protein_name": "Immunoglobulin kappa variable 1D-12", "gene_name": "IGKV1D-12", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01615-1", "protein_name": "Immunoglobulin kappa variable 2D-28", "gene_name": "IGKV2D-28", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01619-1", "protein_name": "Immunoglobulin kappa variable 3-20", "gene_name": "IGKV3-20", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01624-1", "protein_name": "Immunoglobulin kappa variable 3-15", "gene_name": "IGKV3-15", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04433-1", "protein_name": "Immunoglobulin kappa variable 3-11", "gene_name": "IGKV3-11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01602-1", "protein_name": "Immunoglobulin kappa variable 1-5", "gene_name": "IGKV1-5", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14791-1", "protein_name": "Apolipoprotein L1", "gene_name": "APOL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P02760-1", "protein_name": "Protein AMBP", "gene_name": "AMBP", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q07954-1", "protein_name": "Prolow-density lipoprotein receptor-related protein 1", "gene_name": "LRP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P00739-1", "protein_name": "Haptoglobin-related protein", "gene_name": "HPR", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01767-1", "protein_name": "Immunoglobulin heavy variable 3-53", "gene_name": "IGHV3-53", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06331-1", "protein_name": "Immunoglobulin heavy variable 4-34", "gene_name": "IGHV4-34", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01597-1", "protein_name": "Immunoglobulin kappa variable 1-39", "gene_name": "IGKV1-39", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06310-1", "protein_name": "Immunoglobulin kappa variable 2-30", "gene_name": "IGKV2-30", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06312-1", "protein_name": "Immunoglobulin kappa variable 4-1", "gene_name": "IGKV4-1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01614-1", "protein_name": "Immunoglobulin kappa variable 2D-40", "gene_name": "IGKV2D-40", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DOY2-1", "protein_name": "Immunoglobulin lambda constant 2", "gene_name": "IGLC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86VB7-1", "protein_name": "Scavenger receptor cysteine-rich type 1 protein M130", "gene_name": "CD163", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04432-1", "protein_name": "Immunoglobulin kappa variable 1D-39", "gene_name": "IGKV1D-39", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06315-1", "protein_name": "Immunoglobulin kappa variable 5-2", "gene_name": "IGKV5-2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01699-1", "protein_name": "Immunoglobulin lambda variable 1-44", "gene_name": "IGLV1-44", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01701-1", "protein_name": "Immunoglobulin lambda variable 1-51", "gene_name": "IGLV1-51", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01704-1", "protein_name": "Immunoglobulin lambda variable 2-14", "gene_name": "IGLV2-14", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01706-1", "protein_name": "Immunoglobulin lambda variable 2-11", "gene_name": "IGLV2-11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01709-1", "protein_name": "Immunoglobulin lambda variable 2-8", "gene_name": "IGLV2-8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01717-1", "protein_name": "Immunoglobulin lambda variable 3-25", "gene_name": "IGLV3-25", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01721-1", "protein_name": "Immunoglobulin lambda variable 6-57", "gene_name": "IGLV6-57", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01703-1", "protein_name": "Immunoglobulin lambda variable 1-40", "gene_name": "IGLV1-40", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01705-1", "protein_name": "Immunoglobulin lambda variable 2-23", "gene_name": "IGLV2-23", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01715-1", "protein_name": "Immunoglobulin lambda variable 3-1", "gene_name": "IGLV3-1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01718-1", "protein_name": "Immunoglobulin lambda variable 3-27", "gene_name": "IGLV3-27", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04211-1", "protein_name": "Immunoglobulin lambda variable 7-43", "gene_name": "IGLV7-43", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01876-2", "protein_name": "Immunoglobulin heavy constant alpha 1", "gene_name": "IGHA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CF74-1", "protein_name": "Immunoglobulin lambda constant 6", "gene_name": "IGLC6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P69905-1", "protein_name": "Hemoglobin subunit alpha", "gene_name": "HBA1; HBA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P02768-1", "protein_name": "Albumin", "gene_name": "ALB", "tax_name": "Human" }, { "uniprot_canonical_ac": "P00738-1", "protein_name": "Haptoglobin", "gene_name": "HP", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01825-1", "protein_name": "Immunoglobulin heavy variable 4-59", "gene_name": "IGHV4-59", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01817-1", "protein_name": "Immunoglobulin heavy variable 2-5", "gene_name": "IGHV2-5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01824-1", "protein_name": "Immunoglobulin heavy variable 4-39", "gene_name": "IGHV4-39", "tax_name": "Human" }, { "uniprot_canonical_ac": "P23083-1", "protein_name": "Immunoglobulin heavy variable 1-2", "gene_name": "IGHV1-2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68871-1", "protein_name": "Hemoglobin subunit beta", "gene_name": "HBB", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01742-1", "protein_name": "Immunoglobulin heavy variable 1-69", "gene_name": "IGHV1-69", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01768-1", "protein_name": "Immunoglobulin heavy variable 3-30", "gene_name": "IGHV3-30", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01814-1", "protein_name": "Immunoglobulin heavy variable 2-70", "gene_name": "IGHV2-70", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01772-1", "protein_name": "Immunoglobulin heavy variable 3-33", "gene_name": "IGHV3-33", "tax_name": "Human" }, { "uniprot_canonical_ac": "P02790-1", "protein_name": "Hemopexin", "gene_name": "HPX", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01762-1", "protein_name": "Immunoglobulin heavy variable 3-11", "gene_name": "IGHV3-11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01763-1", "protein_name": "Immunoglobulin heavy variable 3-48", "gene_name": "IGHV3-48", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01764-1", "protein_name": "Immunoglobulin heavy variable 3-23", "gene_name": "IGHV3-23", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01766-1", "protein_name": "Immunoglobulin heavy variable 3-13", "gene_name": "IGHV3-13", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01780-1", "protein_name": "Immunoglobulin heavy variable 3-7", "gene_name": "IGHV3-7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01782-1", "protein_name": "Immunoglobulin heavy variable 3-9", "gene_name": "IGHV3-9", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01877-2", "protein_name": "Immunoglobulin heavy constant alpha 2", "gene_name": "IGHA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01591-1", "protein_name": "Immunoglobulin J chain", "gene_name": "JCHAIN", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0M8Q6-1", "protein_name": "Immunoglobulin lambda constant 7", "gene_name": "IGLC7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01834-1", "protein_name": "Immunoglobulin kappa constant", "gene_name": "IGKC", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG04-1", "protein_name": "Immunoglobulin lambda constant 1", "gene_name": "IGLC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DOY3-1", "protein_name": "Immunoglobulin lambda constant 3", "gene_name": "IGLC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01743-1", "protein_name": "Immunoglobulin heavy variable 1-46", "gene_name": "IGHV1-46", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0C4DH73-1", "protein_name": "Immunoglobulin kappa variable 1-12", "gene_name": "IGKV1-12", "tax_name": "Human" }, { "uniprot_canonical_ac": "A2NJV5-1", "protein_name": "Immunoglobulin kappa variable 2-29", "gene_name": "IGKV2-29", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01594-1", "protein_name": "Immunoglobulin kappa variable 1-33", "gene_name": "IGKV1-33", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04430-1", "protein_name": "Immunoglobulin kappa variable 1-16", "gene_name": "IGKV1-16", "tax_name": "Human" }, { "uniprot_canonical_ac": "P02647-1", "protein_name": "Apolipoprotein A-I", "gene_name": "APOA1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P01700", "url": "https://www.uniprot.org/uniprotkb/P01700" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.11877257", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 74 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Transient receptor potential 1 regulates capacitative Ca(2+) entry and Ca(2+) release from endoplasmic reticulum in B lymphocytes.", "journal": "The Journal of experimental medicine", "date": "2002", "authors": "Mori Y, Wakamori M, Miyakawa T, Hermosura M, Hara Y, Nishida M, Hirose K, Mizushima A, Kurosaki M, Mori E, Gotoh K, Okada T, Fleig A, Penner R, Iino M, Kurosaki T", "reference": { "type": "PubMed", "id": "11901194", "url": "https://pubmed.ncbi.nlm.nih.gov/11901194" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P01700-1", "protein_name": "Immunoglobulin lambda variable 1-47", "gene_name": "IGLV1-47", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01714-1", "protein_name": "Immunoglobulin lambda variable 3-19", "gene_name": "IGLV3-19", "tax_name": "Human" }, { "uniprot_canonical_ac": "P80748-1", "protein_name": "Immunoglobulin lambda variable 3-21", "gene_name": "IGLV3-21", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A075B6P5-1", "protein_name": "Immunoglobulin kappa variable 2-28", "gene_name": "IGKV2-28", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A075B6S6-1", "protein_name": "Immunoglobulin kappa variable 2D-30", "gene_name": "IGKV2D-30", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0C4DH25-1", "protein_name": "Immunoglobulin kappa variable 3D-20", "gene_name": "IGKV3D-20", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01593-1", "protein_name": "Immunoglobulin kappa variable 1D-33", "gene_name": "IGKV1D-33", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01599-1", "protein_name": "Immunoglobulin kappa variable 1-17", "gene_name": "IGKV1-17", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01601-1", "protein_name": "Immunoglobulin kappa variable 1D-16", "gene_name": "IGKV1D-16", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01611-1", "protein_name": "Immunoglobulin kappa variable 1D-12", "gene_name": "IGKV1D-12", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01615-1", "protein_name": "Immunoglobulin kappa variable 2D-28", "gene_name": "IGKV2D-28", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01619-1", "protein_name": "Immunoglobulin kappa variable 3-20", "gene_name": "IGKV3-20", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01624-1", "protein_name": "Immunoglobulin kappa variable 3-15", "gene_name": "IGKV3-15", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04433-1", "protein_name": "Immunoglobulin kappa variable 3-11", "gene_name": "IGKV3-11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01602-1", "protein_name": "Immunoglobulin kappa variable 1-5", "gene_name": "IGKV1-5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8WV28-1", "protein_name": "B-cell linker protein", "gene_name": "BLNK", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14643-1", "protein_name": "Inositol 1,4,5-trisphosphate-gated calcium channel ITPR1", "gene_name": "ITPR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UN19-1", "protein_name": "Dual adapter for phosphotyrosine and 3-phosphotyrosine and 3-phosphoinositide", "gene_name": "DAPP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P43405-1", "protein_name": "Tyrosine-protein kinase SYK", "gene_name": "SYK", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96SN7-1", "protein_name": "Protein orai-2", "gene_name": "ORAI2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P15391-1", "protein_name": "B-lymphocyte antigen CD19", "gene_name": "CD19", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01871-2", "protein_name": "Immunoglobulin heavy constant mu", "gene_name": "IGHM", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13586-1", "protein_name": "Stromal interaction molecule 1", "gene_name": "STIM1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01767-1", "protein_name": "Immunoglobulin heavy variable 3-53", "gene_name": "IGHV3-53", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06331-1", "protein_name": "Immunoglobulin heavy variable 4-34", "gene_name": "IGHV4-34", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14571-1", "protein_name": "Inositol 1,4,5-trisphosphate-gated calcium channel ITPR2", "gene_name": "ITPR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01597-1", "protein_name": "Immunoglobulin kappa variable 1-39", "gene_name": "IGKV1-39", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06310-1", "protein_name": "Immunoglobulin kappa variable 2-30", "gene_name": "IGKV2-30", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06312-1", "protein_name": "Immunoglobulin kappa variable 4-1", "gene_name": "IGKV4-1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01614-1", "protein_name": "Immunoglobulin kappa variable 2D-40", "gene_name": "IGKV2D-40", "tax_name": "Human" }, { "uniprot_canonical_ac": "P48995-1", "protein_name": "Short transient receptor potential channel 1", "gene_name": "TRPC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DOY2-1", "protein_name": "Immunoglobulin lambda constant 2", "gene_name": "IGLC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6ZUJ8-1", "protein_name": "Phosphoinositide 3-kinase adapter protein 1", "gene_name": "PIK3AP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96D31-1", "protein_name": "Calcium release-activated calcium channel protein 1", "gene_name": "ORAI1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DP23-1", "protein_name": "Calmodulin-1", "gene_name": "CALM1; CALM2; CALM3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P29350-1", "protein_name": "Tyrosine-protein phosphatase non-receptor type 6", "gene_name": "PTPN6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P20273-1", "protein_name": "B-cell receptor CD22", "gene_name": "CD22", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04432-1", "protein_name": "Immunoglobulin kappa variable 1D-39", "gene_name": "IGKV1D-39", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06315-1", "protein_name": "Immunoglobulin kappa variable 5-2", "gene_name": "IGKV5-2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01699-1", "protein_name": "Immunoglobulin lambda variable 1-44", "gene_name": "IGLV1-44", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01701-1", "protein_name": "Immunoglobulin lambda variable 1-51", "gene_name": "IGLV1-51", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01704-1", "protein_name": "Immunoglobulin lambda variable 2-14", "gene_name": "IGLV2-14", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01706-1", "protein_name": "Immunoglobulin lambda variable 2-11", "gene_name": "IGLV2-11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01709-1", "protein_name": "Immunoglobulin lambda variable 2-8", "gene_name": "IGLV2-8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01717-1", "protein_name": "Immunoglobulin lambda variable 3-25", "gene_name": "IGLV3-25", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01721-1", "protein_name": "Immunoglobulin lambda variable 6-57", "gene_name": "IGLV6-57", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01703-1", "protein_name": "Immunoglobulin lambda variable 1-40", "gene_name": "IGLV1-40", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01705-1", "protein_name": "Immunoglobulin lambda variable 2-23", "gene_name": "IGLV2-23", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01715-1", "protein_name": "Immunoglobulin lambda variable 3-1", "gene_name": "IGLV3-1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01718-1", "protein_name": "Immunoglobulin lambda variable 3-27", "gene_name": "IGLV3-27", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04211-1", "protein_name": "Immunoglobulin lambda variable 7-43", "gene_name": "IGLV7-43", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q07889-1", "protein_name": "Son of sevenless homolog 1", "gene_name": "SOS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01880-2", "protein_name": "Immunoglobulin heavy constant delta", "gene_name": "IGHD", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CF74-1", "protein_name": "Immunoglobulin lambda constant 6", "gene_name": "IGLC6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q06187-1", "protein_name": "Tyrosine-protein kinase BTK", "gene_name": "BTK", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96B97-1", "protein_name": "SH3 domain-containing kinase-binding protein 1", "gene_name": "SH3KBP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P07948-1", "protein_name": "Tyrosine-protein kinase Lyn", "gene_name": "LYN", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51451-1", "protein_name": "Tyrosine-protein kinase Blk", "gene_name": "BLK", "tax_name": "Human" }, { "uniprot_canonical_ac": "P16885-1", "protein_name": "1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-2", "gene_name": "PLCG2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43865-1", "protein_name": "S-adenosylhomocysteine hydrolase-like protein 1", "gene_name": "AHCYL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01825-1", "protein_name": "Immunoglobulin heavy variable 4-59", "gene_name": "IGHV4-59", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01817-1", "protein_name": "Immunoglobulin heavy variable 2-5", "gene_name": "IGHV2-5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01824-1", "protein_name": "Immunoglobulin heavy variable 4-39", "gene_name": "IGHV4-39", "tax_name": "Human" }, { "uniprot_canonical_ac": "P23083-1", "protein_name": "Immunoglobulin heavy variable 1-2", "gene_name": "IGHV1-2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00329-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit delta isoform", "gene_name": "PIK3CD", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01742-1", "protein_name": "Immunoglobulin heavy variable 1-69", "gene_name": "IGHV1-69", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01768-1", "protein_name": "Immunoglobulin heavy variable 3-30", "gene_name": "IGHV3-30", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01814-1", "protein_name": "Immunoglobulin heavy variable 2-70", "gene_name": "IGHV2-70", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01772-1", "protein_name": "Immunoglobulin heavy variable 3-33", "gene_name": "IGHV3-33", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01762-1", "protein_name": "Immunoglobulin heavy variable 3-11", "gene_name": "IGHV3-11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01763-1", "protein_name": "Immunoglobulin heavy variable 3-48", "gene_name": "IGHV3-48", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01764-1", "protein_name": "Immunoglobulin heavy variable 3-23", "gene_name": "IGHV3-23", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01766-1", "protein_name": "Immunoglobulin heavy variable 3-13", "gene_name": "IGHV3-13", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01780-1", "protein_name": "Immunoglobulin heavy variable 3-7", "gene_name": "IGHV3-7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01782-1", "protein_name": "Immunoglobulin heavy variable 3-9", "gene_name": "IGHV3-9", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0M8Q6-1", "protein_name": "Immunoglobulin lambda constant 7", "gene_name": "IGLC7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01834-1", "protein_name": "Immunoglobulin kappa constant", "gene_name": "IGKC", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG04-1", "protein_name": "Immunoglobulin lambda constant 1", "gene_name": "IGLC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DOY3-1", "protein_name": "Immunoglobulin lambda constant 3", "gene_name": "IGLC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P11912-1", "protein_name": "B-cell antigen receptor complex-associated protein alpha chain", "gene_name": "CD79A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P40259-1", "protein_name": "B-cell antigen receptor complex-associated protein beta chain", "gene_name": "CD79B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01743-1", "protein_name": "Immunoglobulin heavy variable 1-46", "gene_name": "IGHV1-46", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14573-1", "protein_name": "Inositol 1,4,5-trisphosphate-gated calcium channel ITPR3", "gene_name": "ITPR3", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0C4DH73-1", "protein_name": "Immunoglobulin kappa variable 1-12", "gene_name": "IGKV1-12", "tax_name": "Human" }, { "uniprot_canonical_ac": "A2NJV5-1", "protein_name": "Immunoglobulin kappa variable 2-29", "gene_name": "IGKV2-29", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01594-1", "protein_name": "Immunoglobulin kappa variable 1-33", "gene_name": "IGKV1-33", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04430-1", "protein_name": "Immunoglobulin kappa variable 1-16", "gene_name": "IGKV1-16", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27986-1", "protein_name": "Phosphatidylinositol 3-kinase regulatory subunit alpha", "gene_name": "PIK3R1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06241-1", "protein_name": "Tyrosine-protein kinase Fyn", "gene_name": "FYN", "tax_name": "Human" }, { "uniprot_canonical_ac": "P16333-1", "protein_name": "SH2/SH3 adapter protein NCK1", "gene_name": "NCK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P15498-1", "protein_name": "Proto-oncogene vav", "gene_name": "VAV1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P01700", "url": "https://www.uniprot.org/uniprotkb/P01700" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.11901194", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 91 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The direct recruitment of BLNK to immunoglobulin alpha couples the B-cell antigen receptor to distal signaling pathways.", "journal": "Molecular and cellular biology", "date": "2002", "authors": "Kabak S, Skaggs BJ, Gold MR, Affolter M, West KL, Foster MS, Siemasko K, Chan AC, Aebersold R, Clark MR", "reference": { "type": "PubMed", "id": "11909947", "url": "https://pubmed.ncbi.nlm.nih.gov/11909947" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P01700-1", "protein_name": "Immunoglobulin lambda variable 1-47", "gene_name": "IGLV1-47", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01714-1", "protein_name": "Immunoglobulin lambda variable 3-19", "gene_name": "IGLV3-19", "tax_name": "Human" }, { "uniprot_canonical_ac": "P80748-1", "protein_name": "Immunoglobulin lambda variable 3-21", "gene_name": "IGLV3-21", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A075B6P5-1", "protein_name": "Immunoglobulin kappa variable 2-28", "gene_name": "IGKV2-28", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A075B6S6-1", "protein_name": "Immunoglobulin kappa variable 2D-30", "gene_name": "IGKV2D-30", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0C4DH25-1", "protein_name": "Immunoglobulin kappa variable 3D-20", "gene_name": "IGKV3D-20", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01593-1", "protein_name": "Immunoglobulin kappa variable 1D-33", "gene_name": "IGKV1D-33", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01599-1", "protein_name": "Immunoglobulin kappa variable 1-17", "gene_name": "IGKV1-17", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01601-1", "protein_name": "Immunoglobulin kappa variable 1D-16", "gene_name": "IGKV1D-16", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01611-1", "protein_name": "Immunoglobulin kappa variable 1D-12", "gene_name": "IGKV1D-12", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01615-1", "protein_name": "Immunoglobulin kappa variable 2D-28", "gene_name": "IGKV2D-28", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01619-1", "protein_name": "Immunoglobulin kappa variable 3-20", "gene_name": "IGKV3-20", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01624-1", "protein_name": "Immunoglobulin kappa variable 3-15", "gene_name": "IGKV3-15", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04433-1", "protein_name": "Immunoglobulin kappa variable 3-11", "gene_name": "IGKV3-11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01602-1", "protein_name": "Immunoglobulin kappa variable 1-5", "gene_name": "IGKV1-5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8WV28-1", "protein_name": "B-cell linker protein", "gene_name": "BLNK", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14643-1", "protein_name": "Inositol 1,4,5-trisphosphate-gated calcium channel ITPR1", "gene_name": "ITPR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UN19-1", "protein_name": "Dual adapter for phosphotyrosine and 3-phosphotyrosine and 3-phosphoinositide", "gene_name": "DAPP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P43405-1", "protein_name": "Tyrosine-protein kinase SYK", "gene_name": "SYK", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96SN7-1", "protein_name": "Protein orai-2", "gene_name": "ORAI2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P15391-1", "protein_name": "B-lymphocyte antigen CD19", "gene_name": "CD19", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01871-2", "protein_name": "Immunoglobulin heavy constant mu", "gene_name": "IGHM", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13586-1", "protein_name": "Stromal interaction molecule 1", "gene_name": "STIM1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01767-1", "protein_name": "Immunoglobulin heavy variable 3-53", "gene_name": "IGHV3-53", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06331-1", "protein_name": "Immunoglobulin heavy variable 4-34", "gene_name": "IGHV4-34", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14571-1", "protein_name": "Inositol 1,4,5-trisphosphate-gated calcium channel ITPR2", "gene_name": "ITPR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01597-1", "protein_name": "Immunoglobulin kappa variable 1-39", "gene_name": "IGKV1-39", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06310-1", "protein_name": "Immunoglobulin kappa variable 2-30", "gene_name": "IGKV2-30", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06312-1", "protein_name": "Immunoglobulin kappa variable 4-1", "gene_name": "IGKV4-1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01614-1", "protein_name": "Immunoglobulin kappa variable 2D-40", "gene_name": "IGKV2D-40", "tax_name": "Human" }, { "uniprot_canonical_ac": "P48995-1", "protein_name": "Short transient receptor potential channel 1", "gene_name": "TRPC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DOY2-1", "protein_name": "Immunoglobulin lambda constant 2", "gene_name": "IGLC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6ZUJ8-1", "protein_name": "Phosphoinositide 3-kinase adapter protein 1", "gene_name": "PIK3AP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96D31-1", "protein_name": "Calcium release-activated calcium channel protein 1", "gene_name": "ORAI1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DP23-1", "protein_name": "Calmodulin-1", "gene_name": "CALM1; CALM2; CALM3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P29350-1", "protein_name": "Tyrosine-protein phosphatase non-receptor type 6", "gene_name": "PTPN6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P20273-1", "protein_name": "B-cell receptor CD22", "gene_name": "CD22", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04432-1", "protein_name": "Immunoglobulin kappa variable 1D-39", "gene_name": "IGKV1D-39", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06315-1", "protein_name": "Immunoglobulin kappa variable 5-2", "gene_name": "IGKV5-2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01699-1", "protein_name": "Immunoglobulin lambda variable 1-44", "gene_name": "IGLV1-44", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01701-1", "protein_name": "Immunoglobulin lambda variable 1-51", "gene_name": "IGLV1-51", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01704-1", "protein_name": "Immunoglobulin lambda variable 2-14", "gene_name": "IGLV2-14", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01706-1", "protein_name": "Immunoglobulin lambda variable 2-11", "gene_name": "IGLV2-11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01709-1", "protein_name": "Immunoglobulin lambda variable 2-8", "gene_name": "IGLV2-8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01717-1", "protein_name": "Immunoglobulin lambda variable 3-25", "gene_name": "IGLV3-25", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01721-1", "protein_name": "Immunoglobulin lambda variable 6-57", "gene_name": "IGLV6-57", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01703-1", "protein_name": "Immunoglobulin lambda variable 1-40", "gene_name": "IGLV1-40", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01705-1", "protein_name": "Immunoglobulin lambda variable 2-23", "gene_name": "IGLV2-23", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01715-1", "protein_name": "Immunoglobulin lambda variable 3-1", "gene_name": "IGLV3-1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01718-1", "protein_name": "Immunoglobulin lambda variable 3-27", "gene_name": "IGLV3-27", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04211-1", "protein_name": "Immunoglobulin lambda variable 7-43", "gene_name": "IGLV7-43", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q07889-1", "protein_name": "Son of sevenless homolog 1", "gene_name": "SOS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01880-2", "protein_name": "Immunoglobulin heavy constant delta", "gene_name": "IGHD", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CF74-1", "protein_name": "Immunoglobulin lambda constant 6", "gene_name": "IGLC6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q06187-1", "protein_name": "Tyrosine-protein kinase BTK", "gene_name": "BTK", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96B97-1", "protein_name": "SH3 domain-containing kinase-binding protein 1", "gene_name": "SH3KBP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P07948-1", "protein_name": "Tyrosine-protein kinase Lyn", "gene_name": "LYN", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51451-1", "protein_name": "Tyrosine-protein kinase Blk", "gene_name": "BLK", "tax_name": "Human" }, { "uniprot_canonical_ac": "P16885-1", "protein_name": "1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-2", "gene_name": "PLCG2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43865-1", "protein_name": "S-adenosylhomocysteine hydrolase-like protein 1", "gene_name": "AHCYL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01825-1", "protein_name": "Immunoglobulin heavy variable 4-59", "gene_name": "IGHV4-59", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01817-1", "protein_name": "Immunoglobulin heavy variable 2-5", "gene_name": "IGHV2-5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01824-1", "protein_name": "Immunoglobulin heavy variable 4-39", "gene_name": "IGHV4-39", "tax_name": "Human" }, { "uniprot_canonical_ac": "P23083-1", "protein_name": "Immunoglobulin heavy variable 1-2", "gene_name": "IGHV1-2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00329-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit delta isoform", "gene_name": "PIK3CD", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01742-1", "protein_name": "Immunoglobulin heavy variable 1-69", "gene_name": "IGHV1-69", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01768-1", "protein_name": "Immunoglobulin heavy variable 3-30", "gene_name": "IGHV3-30", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01814-1", "protein_name": "Immunoglobulin heavy variable 2-70", "gene_name": "IGHV2-70", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01772-1", "protein_name": "Immunoglobulin heavy variable 3-33", "gene_name": "IGHV3-33", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01762-1", "protein_name": "Immunoglobulin heavy variable 3-11", "gene_name": "IGHV3-11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01763-1", "protein_name": "Immunoglobulin heavy variable 3-48", "gene_name": "IGHV3-48", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01764-1", "protein_name": "Immunoglobulin heavy variable 3-23", "gene_name": "IGHV3-23", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01766-1", "protein_name": "Immunoglobulin heavy variable 3-13", "gene_name": "IGHV3-13", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01780-1", "protein_name": "Immunoglobulin heavy variable 3-7", "gene_name": "IGHV3-7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01782-1", "protein_name": "Immunoglobulin heavy variable 3-9", "gene_name": "IGHV3-9", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0M8Q6-1", "protein_name": "Immunoglobulin lambda constant 7", "gene_name": "IGLC7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01834-1", "protein_name": "Immunoglobulin kappa constant", "gene_name": "IGKC", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG04-1", "protein_name": "Immunoglobulin lambda constant 1", "gene_name": "IGLC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DOY3-1", "protein_name": "Immunoglobulin lambda constant 3", "gene_name": "IGLC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P11911-1", "protein_name": "B-cell antigen receptor complex-associated protein alpha chain", "gene_name": "Cd79a", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "P11912-1", "protein_name": "B-cell antigen receptor complex-associated protein alpha chain", "gene_name": "CD79A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P40259-1", "protein_name": "B-cell antigen receptor complex-associated protein beta chain", "gene_name": "CD79B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01743-1", "protein_name": "Immunoglobulin heavy variable 1-46", "gene_name": "IGHV1-46", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14573-1", "protein_name": "Inositol 1,4,5-trisphosphate-gated calcium channel ITPR3", "gene_name": "ITPR3", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0C4DH73-1", "protein_name": "Immunoglobulin kappa variable 1-12", "gene_name": "IGKV1-12", "tax_name": "Human" }, { "uniprot_canonical_ac": "A2NJV5-1", "protein_name": "Immunoglobulin kappa variable 2-29", "gene_name": "IGKV2-29", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01594-1", "protein_name": "Immunoglobulin kappa variable 1-33", "gene_name": "IGKV1-33", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04430-1", "protein_name": "Immunoglobulin kappa variable 1-16", "gene_name": "IGKV1-16", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9QUN3-1", "protein_name": "B-cell linker protein", "gene_name": "Blnk", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "P27986-1", "protein_name": "Phosphatidylinositol 3-kinase regulatory subunit alpha", "gene_name": "PIK3R1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06241-1", "protein_name": "Tyrosine-protein kinase Fyn", "gene_name": "FYN", "tax_name": "Human" }, { "uniprot_canonical_ac": "P16333-1", "protein_name": "SH2/SH3 adapter protein NCK1", "gene_name": "NCK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P15498-1", "protein_name": "Proto-oncogene vav", "gene_name": "VAV1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P01700", "url": "https://www.uniprot.org/uniprotkb/P01700" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 176, "end_pos": 176, "sequence_org": "Y", "sequence_mut": "F", "comment": "Increases tyrosine phosphorylation. Inhibits phosphorylation of BLNK. Impaired antigen presentation; when associated with F-204.", "evidence": [ { "database": "UniProtKB", "id": "P11911", "url": "https://www.uniprot.org/uniprotkb/P11911" }, { "database": "PubMed", "id": "16860757", "url": "https://pubmed.ncbi.nlm.nih.gov/16860757" }, { "database": "PubMed", "id": "17163454", "url": "https://pubmed.ncbi.nlm.nih.gov/17163454" }, { "database": "PubMed", "id": "11859098", "url": "https://pubmed.ncbi.nlm.nih.gov/11859098" }, { "database": "PubMed", "id": "8306975", "url": "https://pubmed.ncbi.nlm.nih.gov/8306975" }, { "database": "PubMed", "id": "11909947", "url": "https://pubmed.ncbi.nlm.nih.gov/11909947" } ], "uniprot_canonical_ac": "P11911-1" }, { "start_pos": 204, "end_pos": 204, "sequence_org": "Y", "sequence_mut": "F", "comment": "Has little effect on tyrosine phosphorylation. Reduces pre-B-cell differentiation. Abolishes binding to BLNK. Inhibits phosphorylation of BLNK. No effect on cap formation or BCR internalization. Impaired antigen presentation; when associated with F-176.", "evidence": [ { "database": "UniProtKB", "id": "P11911", "url": "https://www.uniprot.org/uniprotkb/P11911" }, { "database": "PubMed", "id": "16860757", "url": "https://pubmed.ncbi.nlm.nih.gov/16860757" }, { "database": "PubMed", "id": "11449366", "url": "https://pubmed.ncbi.nlm.nih.gov/11449366" }, { "database": "PubMed", "id": "17163454", "url": "https://pubmed.ncbi.nlm.nih.gov/17163454" }, { "database": "PubMed", "id": "11859098", "url": "https://pubmed.ncbi.nlm.nih.gov/11859098" }, { "database": "PubMed", "id": "11909947", "url": "https://pubmed.ncbi.nlm.nih.gov/11909947" } ], "uniprot_canonical_ac": "P11911-1" } ], "record_id": "pubmed.11909947", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 93 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Inactivation of C3a and C5a octapeptides by carboxypeptidase R and carboxypeptidase N.", "journal": "Microbiology and immunology", "date": "2002", "authors": "Campbell WD, Lazoura E, Okada N, Okada H", "reference": { "type": "PubMed", "id": "11939578", "url": "https://pubmed.ncbi.nlm.nih.gov/11939578" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P01700-1", "protein_name": "Immunoglobulin lambda variable 1-47", "gene_name": "IGLV1-47", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01714-1", "protein_name": "Immunoglobulin lambda variable 3-19", "gene_name": "IGLV3-19", "tax_name": "Human" }, { "uniprot_canonical_ac": "P80748-1", "protein_name": "Immunoglobulin lambda variable 3-21", "gene_name": "IGLV3-21", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A075B6P5-1", "protein_name": "Immunoglobulin kappa variable 2-28", "gene_name": "IGKV2-28", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A075B6S6-1", "protein_name": "Immunoglobulin kappa variable 2D-30", "gene_name": "IGKV2D-30", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0C4DH25-1", "protein_name": "Immunoglobulin kappa variable 3D-20", "gene_name": "IGKV3D-20", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01593-1", "protein_name": "Immunoglobulin kappa variable 1D-33", "gene_name": "IGKV1D-33", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01599-1", "protein_name": "Immunoglobulin kappa variable 1-17", "gene_name": "IGKV1-17", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01601-1", "protein_name": "Immunoglobulin kappa variable 1D-16", "gene_name": "IGKV1D-16", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01611-1", "protein_name": "Immunoglobulin kappa variable 1D-12", "gene_name": "IGKV1D-12", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01615-1", "protein_name": "Immunoglobulin kappa variable 2D-28", "gene_name": "IGKV2D-28", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01619-1", "protein_name": "Immunoglobulin kappa variable 3-20", "gene_name": "IGKV3-20", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01624-1", "protein_name": "Immunoglobulin kappa variable 3-15", "gene_name": "IGKV3-15", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04433-1", "protein_name": "Immunoglobulin kappa variable 3-11", "gene_name": "IGKV3-11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01602-1", "protein_name": "Immunoglobulin kappa variable 1-5", "gene_name": "IGKV1-5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P00734-1", "protein_name": "Prothrombin", "gene_name": "F2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P10909-1", "protein_name": "Clusterin", "gene_name": "CLU", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06681-1", "protein_name": "Complement C2", "gene_name": "C2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P15391-1", "protein_name": "B-lymphocyte antigen CD19", "gene_name": "CD19", "tax_name": "Human" }, { "uniprot_canonical_ac": "P08246-1", "protein_name": "Neutrophil elastase", "gene_name": "ELANE", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01767-1", "protein_name": "Immunoglobulin heavy variable 3-53", "gene_name": "IGHV3-53", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06331-1", "protein_name": "Immunoglobulin heavy variable 4-34", "gene_name": "IGHV4-34", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01597-1", "protein_name": "Immunoglobulin kappa variable 1-39", "gene_name": "IGKV1-39", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06310-1", "protein_name": "Immunoglobulin kappa variable 2-30", "gene_name": "IGKV2-30", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06312-1", "protein_name": "Immunoglobulin kappa variable 4-1", "gene_name": "IGKV4-1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01614-1", "protein_name": "Immunoglobulin kappa variable 2D-40", "gene_name": "IGKV2D-40", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DOY2-1", "protein_name": "Immunoglobulin lambda constant 2", "gene_name": "IGLC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P08603-1", "protein_name": "Complement factor H", "gene_name": "CFH", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05156-1", "protein_name": "Complement factor I", "gene_name": "CFI", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16581-1", "protein_name": "C3a anaphylatoxin chemotactic receptor", "gene_name": "C3AR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P00736-1", "protein_name": "Complement C1r subcomponent", "gene_name": "C1R", "tax_name": "Human" }, { "uniprot_canonical_ac": "P09871-1", "protein_name": "Complement C1s subcomponent", "gene_name": "C1S", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04003-1", "protein_name": "C4b-binding protein alpha chain", "gene_name": "C4BPA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P02747-1", "protein_name": "Complement C1q subcomponent subunit C", "gene_name": "C1QC", "tax_name": "Human" }, { "uniprot_canonical_ac": "P20851-1", "protein_name": "C4b-binding protein beta chain", "gene_name": "C4BPB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96IY4-1", "protein_name": "Carboxypeptidase B2", "gene_name": "CPB2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0C0L5-1", "protein_name": "Complement C4-B", "gene_name": "C4B_2; C4B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0C0L4-1", "protein_name": "Complement C4-A", "gene_name": "C4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P07360-1", "protein_name": "Complement component C8 gamma chain", "gene_name": "C8G", "tax_name": "Human" }, { "uniprot_canonical_ac": "P13671-1", "protein_name": "Complement component C6", "gene_name": "C6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01031-1", "protein_name": "Complement C5", "gene_name": "C5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P02748-1", "protein_name": "Complement component C9", "gene_name": "C9", "tax_name": "Human" }, { "uniprot_canonical_ac": "P07357-1", "protein_name": "Complement component C8 alpha chain", "gene_name": "C8A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P08174-1", "protein_name": "Complement decay-accelerating factor", "gene_name": "CD55", "tax_name": "Human" }, { "uniprot_canonical_ac": "P15529-1", "protein_name": "Membrane cofactor protein", "gene_name": "CD46", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04432-1", "protein_name": "Immunoglobulin kappa variable 1D-39", "gene_name": "IGKV1D-39", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06315-1", "protein_name": "Immunoglobulin kappa variable 5-2", "gene_name": "IGKV5-2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01699-1", "protein_name": "Immunoglobulin lambda variable 1-44", "gene_name": "IGLV1-44", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01701-1", "protein_name": "Immunoglobulin lambda variable 1-51", "gene_name": "IGLV1-51", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01704-1", "protein_name": "Immunoglobulin lambda variable 2-14", "gene_name": "IGLV2-14", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01706-1", "protein_name": "Immunoglobulin lambda variable 2-11", "gene_name": "IGLV2-11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01709-1", "protein_name": "Immunoglobulin lambda variable 2-8", "gene_name": "IGLV2-8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01717-1", "protein_name": "Immunoglobulin lambda variable 3-25", "gene_name": "IGLV3-25", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01721-1", "protein_name": "Immunoglobulin lambda variable 6-57", "gene_name": "IGLV6-57", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01703-1", "protein_name": "Immunoglobulin lambda variable 1-40", "gene_name": "IGLV1-40", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01705-1", "protein_name": "Immunoglobulin lambda variable 2-23", "gene_name": "IGLV2-23", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01715-1", "protein_name": "Immunoglobulin lambda variable 3-1", "gene_name": "IGLV3-1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01718-1", "protein_name": "Immunoglobulin lambda variable 3-27", "gene_name": "IGLV3-27", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04211-1", "protein_name": "Immunoglobulin lambda variable 7-43", "gene_name": "IGLV7-43", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05155-1", "protein_name": "Plasma protease C1 inhibitor", "gene_name": "SERPING1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P22792-1", "protein_name": "Carboxypeptidase N subunit 2", "gene_name": "CPN2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P20023-1", "protein_name": "Complement receptor type 2", "gene_name": "CR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01860-2", "protein_name": "Immunoglobulin heavy constant gamma 3", "gene_name": "IGHG3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01861-2", "protein_name": "Immunoglobulin heavy constant gamma 4", "gene_name": "IGHG4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CF74-1", "protein_name": "Immunoglobulin lambda constant 6", "gene_name": "IGLC6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P17927-1", "protein_name": "Complement receptor type 1", "gene_name": "CR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P10643-1", "protein_name": "Complement component C7", "gene_name": "C7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P07358-1", "protein_name": "Complement component C8 beta chain", "gene_name": "C8B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BXR6-1", "protein_name": "Complement factor H-related protein 5", "gene_name": "CFHR5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P36980-1", "protein_name": "Complement factor H-related protein 2", "gene_name": "CFHR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q02985-1", "protein_name": "Complement factor H-related protein 3", "gene_name": "CFHR3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P02746-1", "protein_name": "Complement C1q subcomponent subunit B", "gene_name": "C1QB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9P296-1", "protein_name": "C5a anaphylatoxin chemotactic receptor 2", "gene_name": "C5AR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P02745-1", "protein_name": "Complement C1q subcomponent subunit A", "gene_name": "C1QA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04004-1", "protein_name": "Vitronectin", "gene_name": "VTN", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01825-1", "protein_name": "Immunoglobulin heavy variable 4-59", "gene_name": "IGHV4-59", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01817-1", "protein_name": "Immunoglobulin heavy variable 2-5", "gene_name": "IGHV2-5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01824-1", "protein_name": "Immunoglobulin heavy variable 4-39", "gene_name": "IGHV4-39", "tax_name": "Human" }, { "uniprot_canonical_ac": "P23083-1", "protein_name": "Immunoglobulin heavy variable 1-2", "gene_name": "IGHV1-2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P07225-1", "protein_name": "Vitamin K-dependent protein S", "gene_name": "PROS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01742-1", "protein_name": "Immunoglobulin heavy variable 1-69", "gene_name": "IGHV1-69", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01768-1", "protein_name": "Immunoglobulin heavy variable 3-30", "gene_name": "IGHV3-30", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01814-1", "protein_name": "Immunoglobulin heavy variable 2-70", "gene_name": "IGHV2-70", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92496-1", "protein_name": "Complement factor H-related protein 4", "gene_name": "CFHR4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01772-1", "protein_name": "Immunoglobulin heavy variable 3-33", "gene_name": "IGHV3-33", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01762-1", "protein_name": "Immunoglobulin heavy variable 3-11", "gene_name": "IGHV3-11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01763-1", "protein_name": "Immunoglobulin heavy variable 3-48", "gene_name": "IGHV3-48", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01764-1", "protein_name": "Immunoglobulin heavy variable 3-23", "gene_name": "IGHV3-23", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01766-1", "protein_name": "Immunoglobulin heavy variable 3-13", "gene_name": "IGHV3-13", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01780-1", "protein_name": "Immunoglobulin heavy variable 3-7", "gene_name": "IGHV3-7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01782-1", "protein_name": "Immunoglobulin heavy variable 3-9", "gene_name": "IGHV3-9", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0M8Q6-1", "protein_name": "Immunoglobulin lambda constant 7", "gene_name": "IGLC7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01834-1", "protein_name": "Immunoglobulin kappa constant", "gene_name": "IGKC", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01859-2", "protein_name": "Immunoglobulin heavy constant gamma 2", "gene_name": "IGHG2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG04-1", "protein_name": "Immunoglobulin lambda constant 1", "gene_name": "IGLC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DOY3-1", "protein_name": "Immunoglobulin lambda constant 3", "gene_name": "IGLC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P13987-1", "protein_name": "CD59 glycoprotein", "gene_name": "CD59", "tax_name": "Human" }, { "uniprot_canonical_ac": "P60033-1", "protein_name": "CD81 antigen", "gene_name": "CD81", "tax_name": "Human" }, { "uniprot_canonical_ac": "P21730-1", "protein_name": "C5a anaphylatoxin chemotactic receptor 1", "gene_name": "C5AR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P15169-1", "protein_name": "Carboxypeptidase N catalytic chain", "gene_name": "CPN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01024-1", "protein_name": "Complement C3", "gene_name": "C3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P00751-1", "protein_name": "Complement factor B", "gene_name": "CFB", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01743-1", "protein_name": "Immunoglobulin heavy variable 1-46", "gene_name": "IGHV1-46", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27918-1", "protein_name": "Properdin", "gene_name": "CFP", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0C4DH73-1", "protein_name": "Immunoglobulin kappa variable 1-12", "gene_name": "IGKV1-12", "tax_name": "Human" }, { "uniprot_canonical_ac": "A2NJV5-1", "protein_name": "Immunoglobulin kappa variable 2-29", "gene_name": "IGKV2-29", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01594-1", "protein_name": "Immunoglobulin kappa variable 1-33", "gene_name": "IGKV1-33", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04430-1", "protein_name": "Immunoglobulin kappa variable 1-16", "gene_name": "IGKV1-16", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01857-2", "protein_name": "Immunoglobulin heavy constant gamma 1", "gene_name": "IGHG1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q03591-1", "protein_name": "Complement factor H-related protein 1", "gene_name": "CFHR1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P01700", "url": "https://www.uniprot.org/uniprotkb/P01700" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.11939578", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 110 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Sialic acid binding domains of CD22 are required for negative regulation of B cell receptor signaling.", "journal": "The Journal of experimental medicine", "date": "2002", "authors": "Jin L, McLean PA, Neel BG, Wortis HH", "reference": { "type": "PubMed", "id": "11994425", "url": "https://pubmed.ncbi.nlm.nih.gov/11994425" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P01700-1", "protein_name": "Immunoglobulin lambda variable 1-47", "gene_name": "IGLV1-47", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01714-1", "protein_name": "Immunoglobulin lambda variable 3-19", "gene_name": "IGLV3-19", "tax_name": "Human" }, { "uniprot_canonical_ac": "P80748-1", "protein_name": "Immunoglobulin lambda variable 3-21", "gene_name": "IGLV3-21", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A075B6P5-1", "protein_name": "Immunoglobulin kappa variable 2-28", "gene_name": "IGKV2-28", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A075B6S6-1", "protein_name": "Immunoglobulin kappa variable 2D-30", "gene_name": "IGKV2D-30", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0C4DH25-1", "protein_name": "Immunoglobulin kappa variable 3D-20", "gene_name": "IGKV3D-20", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01593-1", "protein_name": "Immunoglobulin kappa variable 1D-33", "gene_name": "IGKV1D-33", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01599-1", "protein_name": "Immunoglobulin kappa variable 1-17", "gene_name": "IGKV1-17", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01601-1", "protein_name": "Immunoglobulin kappa variable 1D-16", "gene_name": "IGKV1D-16", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01611-1", "protein_name": "Immunoglobulin kappa variable 1D-12", "gene_name": "IGKV1D-12", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01615-1", "protein_name": "Immunoglobulin kappa variable 2D-28", "gene_name": "IGKV2D-28", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01619-1", "protein_name": "Immunoglobulin kappa variable 3-20", "gene_name": "IGKV3-20", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01624-1", "protein_name": "Immunoglobulin kappa variable 3-15", "gene_name": "IGKV3-15", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04433-1", "protein_name": "Immunoglobulin kappa variable 3-11", "gene_name": "IGKV3-11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01602-1", "protein_name": "Immunoglobulin kappa variable 1-5", "gene_name": "IGKV1-5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01871-2", "protein_name": "Immunoglobulin heavy constant mu", "gene_name": "IGHM", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01767-1", "protein_name": "Immunoglobulin heavy variable 3-53", "gene_name": "IGHV3-53", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06331-1", "protein_name": "Immunoglobulin heavy variable 4-34", "gene_name": "IGHV4-34", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01597-1", "protein_name": "Immunoglobulin kappa variable 1-39", "gene_name": "IGKV1-39", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06310-1", "protein_name": "Immunoglobulin kappa variable 2-30", "gene_name": "IGKV2-30", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06312-1", "protein_name": "Immunoglobulin kappa variable 4-1", "gene_name": "IGKV4-1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01614-1", "protein_name": "Immunoglobulin kappa variable 2D-40", "gene_name": "IGKV2D-40", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DOY2-1", "protein_name": "Immunoglobulin lambda constant 2", "gene_name": "IGLC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P29350-1", "protein_name": "Tyrosine-protein phosphatase non-receptor type 6", "gene_name": "PTPN6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P20273-1", "protein_name": "B-cell receptor CD22", "gene_name": "CD22", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04432-1", "protein_name": "Immunoglobulin kappa variable 1D-39", "gene_name": "IGKV1D-39", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06315-1", "protein_name": "Immunoglobulin kappa variable 5-2", "gene_name": "IGKV5-2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01699-1", "protein_name": "Immunoglobulin lambda variable 1-44", "gene_name": "IGLV1-44", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01701-1", "protein_name": "Immunoglobulin lambda variable 1-51", "gene_name": "IGLV1-51", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01704-1", "protein_name": "Immunoglobulin lambda variable 2-14", "gene_name": "IGLV2-14", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01706-1", "protein_name": "Immunoglobulin lambda variable 2-11", "gene_name": "IGLV2-11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01709-1", "protein_name": "Immunoglobulin lambda variable 2-8", "gene_name": "IGLV2-8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01717-1", "protein_name": "Immunoglobulin lambda variable 3-25", "gene_name": "IGLV3-25", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01721-1", "protein_name": "Immunoglobulin lambda variable 6-57", "gene_name": "IGLV6-57", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01703-1", "protein_name": "Immunoglobulin lambda variable 1-40", "gene_name": "IGLV1-40", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01705-1", "protein_name": "Immunoglobulin lambda variable 2-23", "gene_name": "IGLV2-23", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01715-1", "protein_name": "Immunoglobulin lambda variable 3-1", "gene_name": "IGLV3-1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01718-1", "protein_name": "Immunoglobulin lambda variable 3-27", "gene_name": "IGLV3-27", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04211-1", "protein_name": "Immunoglobulin lambda variable 7-43", "gene_name": "IGLV7-43", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01880-2", "protein_name": "Immunoglobulin heavy constant delta", "gene_name": "IGHD", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CF74-1", "protein_name": "Immunoglobulin lambda constant 6", "gene_name": "IGLC6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P07948-1", "protein_name": "Tyrosine-protein kinase Lyn", "gene_name": "LYN", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01825-1", "protein_name": "Immunoglobulin heavy variable 4-59", "gene_name": "IGHV4-59", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01817-1", "protein_name": "Immunoglobulin heavy variable 2-5", "gene_name": "IGHV2-5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01824-1", "protein_name": "Immunoglobulin heavy variable 4-39", "gene_name": "IGHV4-39", "tax_name": "Human" }, { "uniprot_canonical_ac": "P23083-1", "protein_name": "Immunoglobulin heavy variable 1-2", "gene_name": "IGHV1-2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01742-1", "protein_name": "Immunoglobulin heavy variable 1-69", "gene_name": "IGHV1-69", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01768-1", "protein_name": "Immunoglobulin heavy variable 3-30", "gene_name": "IGHV3-30", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01814-1", "protein_name": "Immunoglobulin heavy variable 2-70", "gene_name": "IGHV2-70", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01772-1", "protein_name": "Immunoglobulin heavy variable 3-33", "gene_name": "IGHV3-33", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01762-1", "protein_name": "Immunoglobulin heavy variable 3-11", "gene_name": "IGHV3-11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01763-1", "protein_name": "Immunoglobulin heavy variable 3-48", "gene_name": "IGHV3-48", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01764-1", "protein_name": "Immunoglobulin heavy variable 3-23", "gene_name": "IGHV3-23", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01766-1", "protein_name": "Immunoglobulin heavy variable 3-13", "gene_name": "IGHV3-13", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01780-1", "protein_name": "Immunoglobulin heavy variable 3-7", "gene_name": "IGHV3-7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01782-1", "protein_name": "Immunoglobulin heavy variable 3-9", "gene_name": "IGHV3-9", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0M8Q6-1", "protein_name": "Immunoglobulin lambda constant 7", "gene_name": "IGLC7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01834-1", "protein_name": "Immunoglobulin kappa constant", "gene_name": "IGKC", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG04-1", "protein_name": "Immunoglobulin lambda constant 1", "gene_name": "IGLC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DOY3-1", "protein_name": "Immunoglobulin lambda constant 3", "gene_name": "IGLC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P11912-1", "protein_name": "B-cell antigen receptor complex-associated protein alpha chain", "gene_name": "CD79A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P40259-1", "protein_name": "B-cell antigen receptor complex-associated protein beta chain", "gene_name": "CD79B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01743-1", "protein_name": "Immunoglobulin heavy variable 1-46", "gene_name": "IGHV1-46", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0C4DH73-1", "protein_name": "Immunoglobulin kappa variable 1-12", "gene_name": "IGKV1-12", "tax_name": "Human" }, { "uniprot_canonical_ac": "A2NJV5-1", "protein_name": "Immunoglobulin kappa variable 2-29", "gene_name": "IGKV2-29", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01594-1", "protein_name": "Immunoglobulin kappa variable 1-33", "gene_name": "IGKV1-33", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04430-1", "protein_name": "Immunoglobulin kappa variable 1-16", "gene_name": "IGKV1-16", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P01700", "url": "https://www.uniprot.org/uniprotkb/P01700" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.11994425", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 67 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Role of membrane cofactor protein (CD46) in regulation of C4b and C3b deposited on cells.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "2002", "authors": "Barilla-LaBarca ML, Liszewski MK, Lambris JD, Hourcade D, Atkinson JP", "reference": { "type": "PubMed", "id": "12055245", "url": "https://pubmed.ncbi.nlm.nih.gov/12055245" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P01700-1", "protein_name": "Immunoglobulin lambda variable 1-47", "gene_name": "IGLV1-47", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01714-1", "protein_name": "Immunoglobulin lambda variable 3-19", "gene_name": "IGLV3-19", "tax_name": "Human" }, { "uniprot_canonical_ac": "P80748-1", "protein_name": "Immunoglobulin lambda variable 3-21", "gene_name": "IGLV3-21", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A075B6P5-1", "protein_name": "Immunoglobulin kappa variable 2-28", "gene_name": "IGKV2-28", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A075B6S6-1", "protein_name": "Immunoglobulin kappa variable 2D-30", "gene_name": "IGKV2D-30", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0C4DH25-1", "protein_name": "Immunoglobulin kappa variable 3D-20", "gene_name": "IGKV3D-20", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01593-1", "protein_name": "Immunoglobulin kappa variable 1D-33", "gene_name": "IGKV1D-33", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01599-1", "protein_name": "Immunoglobulin kappa variable 1-17", "gene_name": "IGKV1-17", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01601-1", "protein_name": "Immunoglobulin kappa variable 1D-16", "gene_name": "IGKV1D-16", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01611-1", "protein_name": "Immunoglobulin kappa variable 1D-12", "gene_name": "IGKV1D-12", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01615-1", "protein_name": "Immunoglobulin kappa variable 2D-28", "gene_name": "IGKV2D-28", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01619-1", "protein_name": "Immunoglobulin kappa variable 3-20", "gene_name": "IGKV3-20", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01624-1", "protein_name": "Immunoglobulin kappa variable 3-15", "gene_name": "IGKV3-15", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04433-1", "protein_name": "Immunoglobulin kappa variable 3-11", "gene_name": "IGKV3-11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01602-1", "protein_name": "Immunoglobulin kappa variable 1-5", "gene_name": "IGKV1-5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P00734-1", "protein_name": "Prothrombin", "gene_name": "F2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P10909-1", "protein_name": "Clusterin", "gene_name": "CLU", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06681-1", "protein_name": "Complement C2", "gene_name": "C2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P15391-1", "protein_name": "B-lymphocyte antigen CD19", "gene_name": "CD19", "tax_name": "Human" }, { "uniprot_canonical_ac": "P08246-1", "protein_name": "Neutrophil elastase", "gene_name": "ELANE", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01767-1", "protein_name": "Immunoglobulin heavy variable 3-53", "gene_name": "IGHV3-53", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06331-1", "protein_name": "Immunoglobulin heavy variable 4-34", "gene_name": "IGHV4-34", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01597-1", "protein_name": "Immunoglobulin kappa variable 1-39", "gene_name": "IGKV1-39", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06310-1", "protein_name": "Immunoglobulin kappa variable 2-30", "gene_name": "IGKV2-30", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06312-1", "protein_name": "Immunoglobulin kappa variable 4-1", "gene_name": "IGKV4-1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01614-1", "protein_name": "Immunoglobulin kappa variable 2D-40", "gene_name": "IGKV2D-40", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DOY2-1", "protein_name": "Immunoglobulin lambda constant 2", "gene_name": "IGLC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P08603-1", "protein_name": "Complement factor H", "gene_name": "CFH", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05156-1", "protein_name": "Complement factor I", "gene_name": "CFI", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16581-1", "protein_name": "C3a anaphylatoxin chemotactic receptor", "gene_name": "C3AR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P00736-1", "protein_name": "Complement C1r subcomponent", "gene_name": "C1R", "tax_name": "Human" }, { "uniprot_canonical_ac": "P09871-1", "protein_name": "Complement C1s subcomponent", "gene_name": "C1S", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04003-1", "protein_name": "C4b-binding protein alpha chain", "gene_name": "C4BPA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P02747-1", "protein_name": "Complement C1q subcomponent subunit C", "gene_name": "C1QC", "tax_name": "Human" }, { "uniprot_canonical_ac": "P20851-1", "protein_name": "C4b-binding protein beta chain", "gene_name": "C4BPB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96IY4-1", "protein_name": "Carboxypeptidase B2", "gene_name": "CPB2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0C0L5-1", "protein_name": "Complement C4-B", "gene_name": "C4B_2; C4B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0C0L4-1", "protein_name": "Complement C4-A", "gene_name": "C4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P07360-1", "protein_name": "Complement component C8 gamma chain", "gene_name": "C8G", "tax_name": "Human" }, { "uniprot_canonical_ac": "P13671-1", "protein_name": "Complement component C6", "gene_name": "C6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01031-1", "protein_name": "Complement C5", "gene_name": "C5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P02748-1", "protein_name": "Complement component C9", "gene_name": "C9", "tax_name": "Human" }, { "uniprot_canonical_ac": "P07357-1", "protein_name": "Complement component C8 alpha chain", "gene_name": "C8A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P08174-1", "protein_name": "Complement decay-accelerating factor", "gene_name": "CD55", "tax_name": "Human" }, { "uniprot_canonical_ac": "P15529-1", "protein_name": "Membrane cofactor protein", "gene_name": "CD46", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04432-1", "protein_name": "Immunoglobulin kappa variable 1D-39", "gene_name": "IGKV1D-39", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06315-1", "protein_name": "Immunoglobulin kappa variable 5-2", "gene_name": "IGKV5-2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01699-1", "protein_name": "Immunoglobulin lambda variable 1-44", "gene_name": "IGLV1-44", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01701-1", "protein_name": "Immunoglobulin lambda variable 1-51", "gene_name": "IGLV1-51", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01704-1", "protein_name": "Immunoglobulin lambda variable 2-14", "gene_name": "IGLV2-14", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01706-1", "protein_name": "Immunoglobulin lambda variable 2-11", "gene_name": "IGLV2-11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01709-1", "protein_name": "Immunoglobulin lambda variable 2-8", "gene_name": "IGLV2-8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01717-1", "protein_name": "Immunoglobulin lambda variable 3-25", "gene_name": "IGLV3-25", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01721-1", "protein_name": "Immunoglobulin lambda variable 6-57", "gene_name": "IGLV6-57", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01703-1", "protein_name": "Immunoglobulin lambda variable 1-40", "gene_name": "IGLV1-40", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01705-1", "protein_name": "Immunoglobulin lambda variable 2-23", "gene_name": "IGLV2-23", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01715-1", "protein_name": "Immunoglobulin lambda variable 3-1", "gene_name": "IGLV3-1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01718-1", "protein_name": "Immunoglobulin lambda variable 3-27", "gene_name": "IGLV3-27", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04211-1", "protein_name": "Immunoglobulin lambda variable 7-43", "gene_name": "IGLV7-43", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05155-1", "protein_name": "Plasma protease C1 inhibitor", "gene_name": "SERPING1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P22792-1", "protein_name": "Carboxypeptidase N subunit 2", "gene_name": "CPN2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P20023-1", "protein_name": "Complement receptor type 2", "gene_name": "CR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01860-2", "protein_name": "Immunoglobulin heavy constant gamma 3", "gene_name": "IGHG3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01861-2", "protein_name": "Immunoglobulin heavy constant gamma 4", "gene_name": "IGHG4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CF74-1", "protein_name": "Immunoglobulin lambda constant 6", "gene_name": "IGLC6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P17927-1", "protein_name": "Complement receptor type 1", "gene_name": "CR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P10643-1", "protein_name": "Complement component C7", "gene_name": "C7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P07358-1", "protein_name": "Complement component C8 beta chain", "gene_name": "C8B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BXR6-1", "protein_name": "Complement factor H-related protein 5", "gene_name": "CFHR5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P36980-1", "protein_name": "Complement factor H-related protein 2", "gene_name": "CFHR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q02985-1", "protein_name": "Complement factor H-related protein 3", "gene_name": "CFHR3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P02746-1", "protein_name": "Complement C1q subcomponent subunit B", "gene_name": "C1QB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9P296-1", "protein_name": "C5a anaphylatoxin chemotactic receptor 2", "gene_name": "C5AR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P02745-1", "protein_name": "Complement C1q subcomponent subunit A", "gene_name": "C1QA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04004-1", "protein_name": "Vitronectin", "gene_name": "VTN", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01825-1", "protein_name": "Immunoglobulin heavy variable 4-59", "gene_name": "IGHV4-59", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01817-1", "protein_name": "Immunoglobulin heavy variable 2-5", "gene_name": "IGHV2-5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01824-1", "protein_name": "Immunoglobulin heavy variable 4-39", "gene_name": "IGHV4-39", "tax_name": "Human" }, { "uniprot_canonical_ac": "P23083-1", "protein_name": "Immunoglobulin heavy variable 1-2", "gene_name": "IGHV1-2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P07225-1", "protein_name": "Vitamin K-dependent protein S", "gene_name": "PROS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01742-1", "protein_name": "Immunoglobulin heavy variable 1-69", "gene_name": "IGHV1-69", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01768-1", "protein_name": "Immunoglobulin heavy variable 3-30", "gene_name": "IGHV3-30", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01814-1", "protein_name": "Immunoglobulin heavy variable 2-70", "gene_name": "IGHV2-70", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92496-1", "protein_name": "Complement factor H-related protein 4", "gene_name": "CFHR4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01772-1", "protein_name": "Immunoglobulin heavy variable 3-33", "gene_name": "IGHV3-33", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01762-1", "protein_name": "Immunoglobulin heavy variable 3-11", "gene_name": "IGHV3-11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01763-1", "protein_name": "Immunoglobulin heavy variable 3-48", "gene_name": "IGHV3-48", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01764-1", "protein_name": "Immunoglobulin heavy variable 3-23", "gene_name": "IGHV3-23", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01766-1", "protein_name": "Immunoglobulin heavy variable 3-13", "gene_name": "IGHV3-13", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01780-1", "protein_name": "Immunoglobulin heavy variable 3-7", "gene_name": "IGHV3-7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01782-1", "protein_name": "Immunoglobulin heavy variable 3-9", "gene_name": "IGHV3-9", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0M8Q6-1", "protein_name": "Immunoglobulin lambda constant 7", "gene_name": "IGLC7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01834-1", "protein_name": "Immunoglobulin kappa constant", "gene_name": "IGKC", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01859-2", "protein_name": "Immunoglobulin heavy constant gamma 2", "gene_name": "IGHG2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG04-1", "protein_name": "Immunoglobulin lambda constant 1", "gene_name": "IGLC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DOY3-1", "protein_name": "Immunoglobulin lambda constant 3", "gene_name": "IGLC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P13987-1", "protein_name": "CD59 glycoprotein", "gene_name": "CD59", "tax_name": "Human" }, { "uniprot_canonical_ac": "P60033-1", "protein_name": "CD81 antigen", "gene_name": "CD81", "tax_name": "Human" }, { "uniprot_canonical_ac": "P21730-1", "protein_name": "C5a anaphylatoxin chemotactic receptor 1", "gene_name": "C5AR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P15169-1", "protein_name": "Carboxypeptidase N catalytic chain", "gene_name": "CPN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01024-1", "protein_name": "Complement C3", "gene_name": "C3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P00751-1", "protein_name": "Complement factor B", "gene_name": "CFB", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01743-1", "protein_name": "Immunoglobulin heavy variable 1-46", "gene_name": "IGHV1-46", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27918-1", "protein_name": "Properdin", "gene_name": "CFP", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A0C4DH73-1", "protein_name": "Immunoglobulin kappa variable 1-12", "gene_name": "IGKV1-12", "tax_name": "Human" }, { "uniprot_canonical_ac": "A2NJV5-1", "protein_name": "Immunoglobulin kappa variable 2-29", "gene_name": "IGKV2-29", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01594-1", "protein_name": "Immunoglobulin kappa variable 1-33", "gene_name": "IGKV1-33", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04430-1", "protein_name": "Immunoglobulin kappa variable 1-16", "gene_name": "IGKV1-16", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01857-2", "protein_name": "Immunoglobulin heavy constant gamma 1", "gene_name": "IGHG1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q03591-1", "protein_name": "Complement factor H-related protein 1", "gene_name": "CFHR1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P01700", "url": "https://www.uniprot.org/uniprotkb/P01700" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.12055245", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 110 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] } ]