[ { "title": "Seven novel methylation guide small nucleolar RNAs are processed from a common polycistronic transcript by Rat1p and RNase III in yeast.", "journal": "Molecular and cellular biology", "date": "1999-02", "authors": "Qu L H, Henras A, Lu Y J, Zhou H, Zhou W X, Zhu Y Q, Zhao J, Henry Y, Caizergues-Ferrer M, Bachellerie J P", "reference": { "type": "PubMed", "id": "9891049", "url": "https://pubmed.ncbi.nlm.nih.gov/9891049" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q02792-1", "protein_name": "5'-3' exoribonuclease 2", "gene_name": "RAT1", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "Q02792", "url": "https://www.uniprot.org/uniprotkb/Q02792" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.9891049", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Rod1, an arrestin-related protein, is phosphorylated by Snf1-kinase in Saccharomyces cerevisiae.", "journal": "Biochemical and biophysical research communications", "date": "2007-12-14", "authors": "Shinoda Junro, Kikuchi Yoshiko", "reference": { "type": "PubMed", "id": "17949685", "url": "https://pubmed.ncbi.nlm.nih.gov/17949685" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q02805-1", "protein_name": "Protein ROD1", "gene_name": "ROD1", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "Q02805", "url": "https://www.uniprot.org/uniprotkb/Q02805" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "phosphorylation": [ { "start_pos": 447, "end_pos": 447, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q02805", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q02805" }, { "database": "PubMed", "id": "17949685", "url": "https://pubmed.ncbi.nlm.nih.gov/17949685" }, { "database": "PubMed", "id": "26920760", "url": "https://pubmed.ncbi.nlm.nih.gov/26920760" }, { "database": "SGD", "id": "S000005544", "url": "https://www.yeastgenome.org/locus/S000005544" } ], "site_lbl": "Ser447", "uniprot_canonical_ac": "Q02805-1" } ], "record_id": "pubmed.17949685", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Differential Phosphorylation Provides a Switch to Control How \u03b1-Arrestin Rod1 Down-regulates Mating Pheromone Response in Saccharomyces cerevisiae.", "journal": "Genetics", "date": "2016-05", "authors": "Alvaro Christopher G, Aindow Ann, Thorner Jeremy", "reference": { "type": "PubMed", "id": "26920760", "url": "https://pubmed.ncbi.nlm.nih.gov/26920760" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q02805-1", "protein_name": "Protein ROD1", "gene_name": "ROD1", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "Q02805", "url": "https://www.uniprot.org/uniprotkb/Q02805" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "phosphorylation": [ { "start_pos": 138, "end_pos": 138, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "Q02805", "url": "https://www.uniprot.org/uniprotkb/Q02805" }, { "database": "PubMed", "id": "19779198", "url": "https://pubmed.ncbi.nlm.nih.gov/19779198" }, { "database": "iPTMnet", "id": "Q02805", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q02805" }, { "database": "PubMed", "id": "17330950", "url": "https://pubmed.ncbi.nlm.nih.gov/17330950" }, { "database": "PubMed", "id": "18407956", "url": "https://pubmed.ncbi.nlm.nih.gov/18407956" }, { "database": "PubMed", "id": "19684113", "url": "https://pubmed.ncbi.nlm.nih.gov/19684113" }, { "database": "PubMed", "id": "19795423", "url": "https://pubmed.ncbi.nlm.nih.gov/19795423" }, { "database": "PubMed", "id": "19823750", "url": "https://pubmed.ncbi.nlm.nih.gov/19823750" }, { "database": "PubMed", "id": "21126336", "url": "https://pubmed.ncbi.nlm.nih.gov/21126336" }, { "database": "SGD", "id": "S000005544", "url": "https://www.yeastgenome.org/locus/S000005544" }, { "database": "PubMed", "id": "23749301", "url": "https://pubmed.ncbi.nlm.nih.gov/23749301" }, { "database": "PubMed", "id": "26920760", "url": "https://pubmed.ncbi.nlm.nih.gov/26920760" }, { "database": "PubMed", "id": "30610170", "url": "https://pubmed.ncbi.nlm.nih.gov/30610170" }, { "database": "PubMed", "id": "32597660", "url": "https://pubmed.ncbi.nlm.nih.gov/32597660" }, { "database": "PubMed", "id": "33481703", "url": "https://pubmed.ncbi.nlm.nih.gov/33481703" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" } ], "site_lbl": "Ser138", "uniprot_canonical_ac": "Q02805-1" }, { "start_pos": 315, "end_pos": 315, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "SGD", "id": "S000005544", "url": "https://www.yeastgenome.org/locus/S000005544" }, { "database": "iPTMnet", "id": "Q02805", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q02805" }, { "database": "PubMed", "id": "26920760", "url": "https://pubmed.ncbi.nlm.nih.gov/26920760" } ], "site_lbl": "Ser315", "uniprot_canonical_ac": "Q02805-1" }, { "start_pos": 447, "end_pos": 447, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q02805", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q02805" }, { "database": "PubMed", "id": "17949685", "url": "https://pubmed.ncbi.nlm.nih.gov/17949685" }, { "database": "PubMed", "id": "26920760", "url": "https://pubmed.ncbi.nlm.nih.gov/26920760" }, { "database": "SGD", "id": "S000005544", "url": "https://www.yeastgenome.org/locus/S000005544" } ], "site_lbl": "Ser447", "uniprot_canonical_ac": "Q02805-1" }, { "start_pos": 641, "end_pos": 641, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q02805", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q02805" }, { "database": "PubMed", "id": "19779198", "url": "https://pubmed.ncbi.nlm.nih.gov/19779198" }, { "database": "PubMed", "id": "19795423", "url": "https://pubmed.ncbi.nlm.nih.gov/19795423" }, { "database": "PubMed", "id": "19823750", "url": "https://pubmed.ncbi.nlm.nih.gov/19823750" }, { "database": "PubMed", "id": "26920760", "url": "https://pubmed.ncbi.nlm.nih.gov/26920760" }, { "database": "SGD", "id": "S000005544", "url": "https://www.yeastgenome.org/locus/S000005544" }, { "database": "PubMed", "id": "23749301", "url": "https://pubmed.ncbi.nlm.nih.gov/23749301" }, { "database": "PubMed", "id": "32597660", "url": "https://pubmed.ncbi.nlm.nih.gov/32597660" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" } ], "site_lbl": "Ser641", "uniprot_canonical_ac": "Q02805-1" }, { "start_pos": 706, "end_pos": 706, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q02805", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q02805" }, { "database": "PubMed", "id": "26920760", "url": "https://pubmed.ncbi.nlm.nih.gov/26920760" }, { "database": "SGD", "id": "S000005544", "url": "https://www.yeastgenome.org/locus/S000005544" }, { "database": "PubMed", "id": "23749301", "url": "https://pubmed.ncbi.nlm.nih.gov/23749301" } ], "site_lbl": "Ser706", "uniprot_canonical_ac": "Q02805-1" }, { "start_pos": 720, "end_pos": 720, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "Q02805", "url": "https://www.uniprot.org/uniprotkb/Q02805" }, { "database": "PubMed", "id": "17330950", "url": "https://pubmed.ncbi.nlm.nih.gov/17330950" }, { "database": "PubMed", "id": "18407956", "url": "https://pubmed.ncbi.nlm.nih.gov/18407956" }, { "database": "PubMed", "id": "19779198", "url": "https://pubmed.ncbi.nlm.nih.gov/19779198" }, { "database": "iPTMnet", "id": "Q02805", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q02805" }, { "database": "PubMed", "id": "19684113", "url": "https://pubmed.ncbi.nlm.nih.gov/19684113" }, { "database": "PubMed", "id": "21126336", "url": "https://pubmed.ncbi.nlm.nih.gov/21126336" }, { "database": "PubMed", "id": "21177495", "url": "https://pubmed.ncbi.nlm.nih.gov/21177495" }, { "database": "PubMed", "id": "26920760", "url": "https://pubmed.ncbi.nlm.nih.gov/26920760" }, { "database": "SGD", "id": "S000005544", "url": "https://www.yeastgenome.org/locus/S000005544" }, { "database": "PubMed", "id": "23749301", "url": "https://pubmed.ncbi.nlm.nih.gov/23749301" }, { "database": "PubMed", "id": "30610170", "url": "https://pubmed.ncbi.nlm.nih.gov/30610170" }, { "database": "PubMed", "id": "32597660", "url": "https://pubmed.ncbi.nlm.nih.gov/32597660" }, { "database": "PubMed", "id": "33481703", "url": "https://pubmed.ncbi.nlm.nih.gov/33481703" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" } ], "site_lbl": "Ser720", "uniprot_canonical_ac": "Q02805-1" }, { "start_pos": 781, "end_pos": 781, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "SGD", "id": "S000005544", "url": "https://www.yeastgenome.org/locus/S000005544" }, { "database": "iPTMnet", "id": "Q02805", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q02805" }, { "database": "PubMed", "id": "26920760", "url": "https://pubmed.ncbi.nlm.nih.gov/26920760" } ], "site_lbl": "Ser781", "uniprot_canonical_ac": "Q02805-1" }, { "start_pos": 807, "end_pos": 807, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "SGD", "id": "S000005544", "url": "https://www.yeastgenome.org/locus/S000005544" }, { "database": "iPTMnet", "id": "Q02805", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q02805" }, { "database": "PubMed", "id": "23749301", "url": "https://pubmed.ncbi.nlm.nih.gov/23749301" }, { "database": "PubMed", "id": "26920760", "url": "https://pubmed.ncbi.nlm.nih.gov/26920760" }, { "database": "PubMed", "id": "33481703", "url": "https://pubmed.ncbi.nlm.nih.gov/33481703" } ], "site_lbl": "Ser807", "uniprot_canonical_ac": "Q02805-1" } ], "record_id": "pubmed.26920760", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 8 }, { "field": "total_sites", "count": 8 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "ROD1, a novel gene conferring multiple resistance phenotypes in Saccharomyces cerevisiae.", "journal": "The Journal of biological chemistry", "date": "1996-02-09", "authors": "Wu A L, Hallstrom T C, Moye-Rowley W S", "reference": { "type": "PubMed", "id": "8621680", "url": "https://pubmed.ncbi.nlm.nih.gov/8621680" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q02805-1", "protein_name": "Protein ROD1", "gene_name": "ROD1", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "Q02805", "url": "https://www.uniprot.org/uniprotkb/Q02805" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.8621680", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Two distinct Vps34 phosphatidylinositol 3-kinase complexes function in autophagy and carboxypeptidase Y sorting in Saccharomyces cerevisiae.", "journal": "The Journal of cell biology", "date": "2001-02-05", "authors": "Kihara A, Noda T, Ishihara N, Ohsumi Y", "reference": { "type": "PubMed", "id": "11157979", "url": "https://pubmed.ncbi.nlm.nih.gov/11157979" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q02948-1", "protein_name": "Vacuolar protein sorting-associated protein 30", "gene_name": "VPS30", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q05919-1", "protein_name": "Vacuolar protein sorting-associated protein 38", "gene_name": "VPS38", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P38270-1", "protein_name": "Autophagy-related protein 14", "gene_name": "ATG14", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P22219-1", "protein_name": "Serine/threonine-protein kinase VPS15", "gene_name": "VPS15", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P22543-1", "protein_name": "Phosphatidylinositol 3-kinase VPS34", "gene_name": "VPS34", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "Q02948", "url": "https://www.uniprot.org/uniprotkb/Q02948" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.11157979", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 5 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The pre-autophagosomal structure organized by concerted functions of APG genes is essential for autophagosome formation.", "journal": "The EMBO journal", "date": "2001-11-01", "authors": "Suzuki K, Kirisako T, Kamada Y, Mizushima N, Noda T, Ohsumi Y", "reference": { "type": "PubMed", "id": "11689437", "url": "https://pubmed.ncbi.nlm.nih.gov/11689437" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q02948-1", "protein_name": "Vacuolar protein sorting-associated protein 30", "gene_name": "VPS30", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q03818-1", "protein_name": "Autophagy protein 16", "gene_name": "ATG16", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q07879-1", "protein_name": "Ubiquitin-like-conjugating enzyme ATG10", "gene_name": "ATG10", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q12380-1", "protein_name": "Autophagy protein 5", "gene_name": "ATG5", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q12142-1", "protein_name": "Autophagy-related protein 9", "gene_name": "ATG9", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P38270-1", "protein_name": "Autophagy-related protein 14", "gene_name": "ATG14", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P38316-1", "protein_name": "Ubiquitin-like protein ATG12", "gene_name": "ATG12", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P53104-1", "protein_name": "Serine/threonine-protein kinase ATG1", "gene_name": "ATG1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P40344-1", "protein_name": "Autophagy-related protein 3", "gene_name": "ATG3", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P38182-1", "protein_name": "Autophagy-related protein 8", "gene_name": "ATG8", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "Q02948", "url": "https://www.uniprot.org/uniprotkb/Q02948" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.11689437", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 10 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Retromer function in endosome-to-Golgi retrograde transport is regulated by the yeast Vps34 PtdIns 3-kinase.", "journal": "Journal of cell science", "date": "2002-10-15", "authors": "Burda Patricie, Padilla Steven M, Sarkar Srimonti, Emr Scott D", "reference": { "type": "PubMed", "id": "12244127", "url": "https://pubmed.ncbi.nlm.nih.gov/12244127" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q02948-1", "protein_name": "Vacuolar protein sorting-associated protein 30", "gene_name": "VPS30", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q05919-1", "protein_name": "Vacuolar protein sorting-associated protein 38", "gene_name": "VPS38", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P22219-1", "protein_name": "Serine/threonine-protein kinase VPS15", "gene_name": "VPS15", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P22543-1", "protein_name": "Phosphatidylinositol 3-kinase VPS34", "gene_name": "VPS34", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "Q02948", "url": "https://www.uniprot.org/uniprotkb/Q02948" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.12244127", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 4 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Characterization of an ERAD gene as VPS30/ATG6 reveals two alternative and functionally distinct protein quality control pathways: one for soluble Z variant of human alpha-1 proteinase inhibitor (A1PiZ) and another for aggregates of A1PiZ.", "journal": "Molecular biology of the cell", "date": "2006-01", "authors": "Kruse Kristina B, Brodsky Jeffrey L, McCracken Ardythe A", "reference": { "type": "PubMed", "id": "16267277", "url": "https://pubmed.ncbi.nlm.nih.gov/16267277" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q02948-1", "protein_name": "Vacuolar protein sorting-associated protein 30", "gene_name": "VPS30", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P38270-1", "protein_name": "Autophagy-related protein 14", "gene_name": "ATG14", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "Q02948", "url": "https://www.uniprot.org/uniprotkb/Q02948" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.16267277", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Assortment of phosphatidylinositol 3-kinase complexes--Atg14p directs association of complex I to the pre-autophagosomal structure in Saccharomyces cerevisiae.", "journal": "Mol. Biol. Cell", "date": "2006", "authors": "Obara Keisuke, Sekito Takayuki, Ohsumi Yoshinori", "reference": { "type": "PubMed", "id": "16421251", "url": "https://pubmed.ncbi.nlm.nih.gov/16421251" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q02948-1", "protein_name": "Vacuolar protein sorting-associated protein 30", "gene_name": "VPS30", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P38270-1", "protein_name": "Autophagy-related protein 14", "gene_name": "ATG14", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "Q02948", "url": "https://www.uniprot.org/uniprotkb/Q02948" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.16421251", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The role of autophagy in mitochondria maintenance: characterization of mitochondrial functions in autophagy-deficient S. cerevisiae strains.", "journal": "Autophagy", "date": "2007", "authors": "Zhang Yong, Qi Haiyan, Taylor Robert, Xu Weihong, Liu Leroy F, Jin Shengkan", "reference": { "type": "PubMed", "id": "17404498", "url": "https://pubmed.ncbi.nlm.nih.gov/17404498" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q02948-1", "protein_name": "Vacuolar protein sorting-associated protein 30", "gene_name": "VPS30", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P38316-1", "protein_name": "Ubiquitin-like protein ATG12", "gene_name": "ATG12", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P38182-1", "protein_name": "Autophagy-related protein 8", "gene_name": "ATG8", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "Q02948", "url": "https://www.uniprot.org/uniprotkb/Q02948" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.17404498", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Overexpression of autophagy-related genes inhibits yeast filamentous growth.", "journal": "Autophagy", "date": "2007", "authors": "Ma Jun, Jin Rui, Dobry Craig J, Lawson Sarah K, Kumar Anuj", "reference": { "type": "PubMed", "id": "17700056", "url": "https://pubmed.ncbi.nlm.nih.gov/17700056" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q02948-1", "protein_name": "Vacuolar protein sorting-associated protein 30", "gene_name": "VPS30", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q06410-1", "protein_name": "Autophagy-related protein 17", "gene_name": "ATG17", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q06671-1", "protein_name": "Autophagy-related protein 23", "gene_name": "ATG23", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q12092-1", "protein_name": "Autophagy-related protein 29", "gene_name": "ATG29", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P53104-1", "protein_name": "Serine/threonine-protein kinase ATG1", "gene_name": "ATG1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P35193-1", "protein_name": "Autophagy-related protein 19", "gene_name": "ATG19", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P38182-1", "protein_name": "Autophagy-related protein 8", "gene_name": "ATG8", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "Q02948", "url": "https://www.uniprot.org/uniprotkb/Q02948" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.17700056", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 7 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "O-mannosylation is required for degradation of the endoplasmic reticulum-associated degradation substrate Gas1*p via the ubiquitin/proteasome pathway in Saccharomyces cerevisiae.", "journal": "Journal of biochemistry", "date": "2008-04", "authors": "Hirayama Hiroto, Fujita Morihisa, Yoko-o Takehiko, Jigami Yoshifumi", "reference": { "type": "PubMed", "id": "18182384", "url": "https://pubmed.ncbi.nlm.nih.gov/18182384" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q02948-1", "protein_name": "Vacuolar protein sorting-associated protein 30", "gene_name": "VPS30", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P31382-1", "protein_name": "Dolichyl-phosphate-mannose--protein mannosyltransferase 2", "gene_name": "PMT2", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P33775-1", "protein_name": "Dolichyl-phosphate-mannose--protein mannosyltransferase 1", "gene_name": "PMT1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P42934-1", "protein_name": "Dolichyl-phosphate-mannose--protein mannosyltransferase 6", "gene_name": "PMT6", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "Q02948", "url": "https://www.uniprot.org/uniprotkb/Q02948" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.18182384", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 4 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The yeast vacuolar membrane proteome.", "journal": "Mol. Cell. Proteomics", "date": "2009", "authors": "Wiederhold Elena, Gandhi Tejas, Permentier Hjalmar P, Breitling Rainer, Poolman Bert, Slotboom Dirk J", "reference": { "type": "PubMed", "id": "19001347", "url": "https://pubmed.ncbi.nlm.nih.gov/19001347" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q02948-1", "protein_name": "Vacuolar protein sorting-associated protein 30", "gene_name": "VPS30", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q04602-1", "protein_name": "Vacuolar basic amino acid transporter 4", "gene_name": "VBA4", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "Q02948", "url": "https://www.uniprot.org/uniprotkb/Q02948" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.19001347", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "ER-associated complexes (ERACs) containing aggregated cystic fibrosis transmembrane conductance regulator (CFTR) are degraded by autophagy.", "journal": "European journal of cell biology", "date": "2009-04", "authors": "Fu Lianwu, Sztul Elizabeth", "reference": { "type": "PubMed", "id": "19131141", "url": "https://pubmed.ncbi.nlm.nih.gov/19131141" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q02948-1", "protein_name": "Vacuolar protein sorting-associated protein 30", "gene_name": "VPS30", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "Q02948", "url": "https://www.uniprot.org/uniprotkb/Q02948" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.19131141", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Structure of the novel C-terminal domain of vacuolar protein sorting 30/autophagy-related protein 6 and its specific role in autophagy.", "journal": "The Journal of biological chemistry", "date": "2012-05-11", "authors": "Noda Nobuo N, Kobayashi Takafumi, Adachi Wakana, Fujioka Yuko, Ohsumi Yoshinori, Inagaki Fuyuhiko", "reference": { "type": "PubMed", "id": "22437838", "url": "https://pubmed.ncbi.nlm.nih.gov/22437838" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q02948-1", "protein_name": "Vacuolar protein sorting-associated protein 30", "gene_name": "VPS30", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "Q02948", "url": "https://www.uniprot.org/uniprotkb/Q02948" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.22437838", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Atg38 is required for autophagy-specific phosphatidylinositol 3-kinase complex integrity.", "journal": "J. Cell Biol.", "date": "2013", "authors": "Araki Yasuhiro, Ku Wei-Chi, Akioka Manami, May Alexander I, Hayashi Yu, Arisaka Fumio, Ishihama Yasushi, Ohsumi Yoshinori", "reference": { "type": "PubMed", "id": "24165940", "url": "https://pubmed.ncbi.nlm.nih.gov/24165940" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q02948-1", "protein_name": "Vacuolar protein sorting-associated protein 30", "gene_name": "VPS30", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P38270-1", "protein_name": "Autophagy-related protein 14", "gene_name": "ATG14", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q05789-1", "protein_name": "PtdIns3K complex I subunit atg38", "gene_name": "ATG38", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P22219-1", "protein_name": "Serine/threonine-protein kinase VPS15", "gene_name": "VPS15", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P22543-1", "protein_name": "Phosphatidylinositol 3-kinase VPS34", "gene_name": "VPS34", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "Q02948", "url": "https://www.uniprot.org/uniprotkb/Q02948" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.24165940", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 5 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Structure and flexibility of the endosomal Vps34 complex reveals the basis of its function on membranes.", "journal": "Science", "date": "2015", "authors": "Rostislavleva Ksenia, Soler Nicolas, Ohashi Yohei, Zhang Lufei, Pardon Els, Burke John E, Masson Glenn R, Johnson Chris, Steyaert Jan, Ktistakis Nicholas T, Williams Roger L", "reference": { "type": "PubMed", "id": "26450213", "url": "https://pubmed.ncbi.nlm.nih.gov/26450213" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q02948-1", "protein_name": "Vacuolar protein sorting-associated protein 30", "gene_name": "VPS30", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q05919-1", "protein_name": "Vacuolar protein sorting-associated protein 38", "gene_name": "VPS38", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P22219-1", "protein_name": "Serine/threonine-protein kinase VPS15", "gene_name": "VPS15", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P22543-1", "protein_name": "Phosphatidylinositol 3-kinase VPS34", "gene_name": "VPS34", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "Q02948", "url": "https://www.uniprot.org/uniprotkb/Q02948" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.26450213", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 4 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Endosome to Golgi retrieval of the vacuolar protein sorting receptor, Vps10p, requires the function of the VPS29, VPS30, and VPS35 gene products.", "journal": "The Journal of cell biology", "date": "1997-04-07", "authors": "Seaman M N, Marcusson E G, Cereghino J L, Emr S D", "reference": { "type": "PubMed", "id": "9105038", "url": "https://pubmed.ncbi.nlm.nih.gov/9105038" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q02948-1", "protein_name": "Vacuolar protein sorting-associated protein 30", "gene_name": "VPS30", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "Q02948", "url": "https://www.uniprot.org/uniprotkb/Q02948" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.9105038", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Apg14p and Apg6/Vps30p form a protein complex essential for autophagy in the yeast, Saccharomyces cerevisiae.", "journal": "The Journal of biological chemistry", "date": "1998-08-28", "authors": "Kametaka S, Okano T, Ohsumi M, Ohsumi Y", "reference": { "type": "PubMed", "id": "9712845", "url": "https://pubmed.ncbi.nlm.nih.gov/9712845" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q02948-1", "protein_name": "Vacuolar protein sorting-associated protein 30", "gene_name": "VPS30", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P38270-1", "protein_name": "Autophagy-related protein 14", "gene_name": "ATG14", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "Q02948", "url": "https://www.uniprot.org/uniprotkb/Q02948" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.9712845", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Sister-chromatid separation at anaphase onset is promoted by cleavage of the cohesin subunit Scc1.", "journal": "Nature", "date": "1999-07-01", "authors": "Uhlmann F, Lottspeich F, Nasmyth K", "reference": { "type": "PubMed", "id": "10403247", "url": "https://pubmed.ncbi.nlm.nih.gov/10403247" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q03018-1", "protein_name": "Separin", "gene_name": "ESP1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q12158-1", "protein_name": "Sister chromatid cohesion protein 1", "gene_name": "MCD1", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "Q03018", "url": "https://www.uniprot.org/uniprotkb/Q03018" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "mutagenesis": [ { "start_pos": 180, "end_pos": 180, "sequence_org": "R", "sequence_mut": "D", "comment": "Abolishes cleavage by ESP1; when associated with D-268.", "evidence": [ { "database": "UniProtKB", "id": "Q12158", "url": "https://www.uniprot.org/uniprotkb/Q12158" }, { "database": "PubMed", "id": "10403247", "url": "https://pubmed.ncbi.nlm.nih.gov/10403247" } ], "uniprot_canonical_ac": "Q12158-1" }, { "start_pos": 268, "end_pos": 268, "sequence_org": "R", "sequence_mut": "D", "comment": "Abolishes first cleavage by ESP1. Abolishes all cleavage by ESP1; when associated with D-180.", "evidence": [ { "database": "UniProtKB", "id": "Q12158", "url": "https://www.uniprot.org/uniprotkb/Q12158" }, { "database": "PubMed", "id": "10403247", "url": "https://pubmed.ncbi.nlm.nih.gov/10403247" } ], "uniprot_canonical_ac": "Q12158-1" } ], "record_id": "pubmed.10403247", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "A novel role of the budding yeast separin Esp1 in anaphase spindle elongation: evidence that proper spindle association of Esp1 is regulated by Pds1.", "journal": "The Journal of cell biology", "date": "2001-01-08", "authors": "Jensen S, Segal M, Clarke D J, Reed S I", "reference": { "type": "PubMed", "id": "11149918", "url": "https://pubmed.ncbi.nlm.nih.gov/11149918" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q03018-1", "protein_name": "Separin", "gene_name": "ESP1", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "Q03018", "url": "https://www.uniprot.org/uniprotkb/Q03018" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "mutagenesis": [ { "start_pos": 1568, "end_pos": 1570, "sequence_org": "DKD", "sequence_mut": "AKA", "comment": "Reduces function. Loss of function.", "evidence": [ { "database": "UniProtKB", "id": "Q03018", "url": "https://www.uniprot.org/uniprotkb/Q03018" }, { "database": "PubMed", "id": "11149918", "url": "https://pubmed.ncbi.nlm.nih.gov/11149918" } ], "uniprot_canonical_ac": "Q03018-1" } ], "record_id": "pubmed.11149918", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Separase, polo kinase, the kinetochore protein Slk19, and Spo12 function in a network that controls Cdc14 localization during early anaphase.", "journal": "Cell", "date": "2002-01-25", "authors": "Stegmeier Frank, Visintin Rosella, Amon Angelika", "reference": { "type": "PubMed", "id": "11832211", "url": "https://pubmed.ncbi.nlm.nih.gov/11832211" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q03018-1", "protein_name": "Separin", "gene_name": "ESP1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q08581-1", "protein_name": "Kinetochore protein SLK19", "gene_name": "SLK19", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P17123-1", "protein_name": "Sporulation-specific protein 12", "gene_name": "SPO12", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P32562-1", "protein_name": "Cell cycle serine/threonine-protein kinase CDC5/MSD2", "gene_name": "CDC5", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "Q03018", "url": "https://www.uniprot.org/uniprotkb/Q03018" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.11832211", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 4 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Requirement for ESP1 in the nuclear division of Saccharomyces cerevisiae.", "journal": "Mol. Biol. Cell", "date": "1992", "authors": "McGrew J T, Goetsch L, Byers B, Baum P", "reference": { "type": "PubMed", "id": "1493337", "url": "https://pubmed.ncbi.nlm.nih.gov/1493337" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q03018-1", "protein_name": "Separin", "gene_name": "ESP1", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "Q03018", "url": "https://www.uniprot.org/uniprotkb/Q03018" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.1493337", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "An ESP1/PDS1 complex regulates loss of sister chromatid cohesion at the metaphase to anaphase transition in yeast.", "journal": "Cell", "date": "1998-06-12", "authors": "Ciosk R, Zachariae W, Michaelis C, Shevchenko A, Mann M, Nasmyth K", "reference": { "type": "PubMed", "id": "9635435", "url": "https://pubmed.ncbi.nlm.nih.gov/9635435" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q03018-1", "protein_name": "Separin", "gene_name": "ESP1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P40316-1", "protein_name": "Securin", "gene_name": "PDS1", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "Q03018", "url": "https://www.uniprot.org/uniprotkb/Q03018" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.9635435", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Cooperation of two actin-binding proteins, cofilin and Aip1, in Saccharomyces cerevisiae.", "journal": "Genes to cells : devoted to molecular & cellular mechanisms", "date": "1999-01", "authors": "Iida K, Yahara I", "reference": { "type": "PubMed", "id": "10231390", "url": "https://pubmed.ncbi.nlm.nih.gov/10231390" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q03048-1", "protein_name": "Cofilin", "gene_name": "COF1", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "Q03048", "url": "https://www.uniprot.org/uniprotkb/Q03048" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.10231390", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Identification of yeast cofilin residues specific for actin monomer and PIP2 binding.", "journal": "Biochemistry", "date": "2001", "authors": "Ojala PJ, Paavilainen V, Lappalainen P", "reference": { "type": "PubMed", "id": "11747431", "url": "https://pubmed.ncbi.nlm.nih.gov/11747431" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q03048-1", "protein_name": "Cofilin", "gene_name": "COF1", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "Q03048", "url": "https://www.uniprot.org/uniprotkb/Q03048" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "mutagenesis": [ { "start_pos": 105, "end_pos": 106, "sequence_org": "KD", "sequence_mut": "AA", "comment": "Reduced interaction with PIP2.", "evidence": [ { "database": "UniProtKB", "id": "Q03048", "url": "https://www.uniprot.org/uniprotkb/Q03048" }, { "database": "PubMed", "id": "11747431", "url": "https://pubmed.ncbi.nlm.nih.gov/11747431" } ], "uniprot_canonical_ac": "Q03048-1" }, { "start_pos": 109, "end_pos": 110, "sequence_org": "RR", "sequence_mut": "AA", "comment": "Defects in actin monomer interaction.", "evidence": [ { "database": "UniProtKB", "id": "Q03048", "url": "https://www.uniprot.org/uniprotkb/Q03048" }, { "database": "PubMed", "id": "11747431", "url": "https://pubmed.ncbi.nlm.nih.gov/11747431" } ], "uniprot_canonical_ac": "Q03048-1" } ], "record_id": "pubmed.11747431", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Cofilin is an essential component of the yeast cortical cytoskeleton.", "journal": "J. Cell Biol.", "date": "1993", "authors": "Moon A L, Janmey P A, Louie K A, Drubin D G", "reference": { "type": "PubMed", "id": "8421056", "url": "https://pubmed.ncbi.nlm.nih.gov/8421056" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q03048-1", "protein_name": "Cofilin", "gene_name": "COF1", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "Q03048", "url": "https://www.uniprot.org/uniprotkb/Q03048" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.8421056", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Isolation of a yeast essential gene, COF1, that encodes a homologue of mammalian cofilin, a low-M(r) actin-binding and depolymerizing protein.", "journal": "Gene", "date": "1993", "authors": "Iida K, Moriyama K, Matsumoto S, Kawasaki H, Nishida E, Yahara I", "reference": { "type": "PubMed", "id": "8440472", "url": "https://pubmed.ncbi.nlm.nih.gov/8440472" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q03048-1", "protein_name": "Cofilin", "gene_name": "COF1", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "Q03048", "url": "https://www.uniprot.org/uniprotkb/Q03048" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.8440472", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Structure determination of yeast cofilin.", "journal": "Nat. Struct. Biol.", "date": "1997", "authors": "Fedorov A A, Lappalainen P, Fedorov E V, Drubin D G, Almo S C", "reference": { "type": "PubMed", "id": "9145106", "url": "https://pubmed.ncbi.nlm.nih.gov/9145106" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q03048-1", "protein_name": "Cofilin", "gene_name": "COF1", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "Q03048", "url": "https://www.uniprot.org/uniprotkb/Q03048" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.9145106", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Cofilin and gelsolin segment-1: molecular dynamics simulation and biochemical analysis predict a similar actin binding mode.", "journal": "Journal of molecular biology", "date": "1998-10-09", "authors": "Wriggers W, Tang J X, Azuma T, Marks P W, Janmey P A", "reference": { "type": "PubMed", "id": "9753544", "url": "https://pubmed.ncbi.nlm.nih.gov/9753544" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q03048-1", "protein_name": "Cofilin", "gene_name": "COF1", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "Q03048", "url": "https://www.uniprot.org/uniprotkb/Q03048" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "phosphorylation": [ { "start_pos": 4, "end_pos": 4, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "Q03048", "url": "https://www.uniprot.org/uniprotkb/Q03048" }, { "database": "PubMed", "id": "18407956", "url": "https://pubmed.ncbi.nlm.nih.gov/18407956" }, { "database": "PubMed", "id": "19779198", "url": "https://pubmed.ncbi.nlm.nih.gov/19779198" }, { "database": "iPTMnet", "id": "Q03048", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q03048" }, { "database": "PubMed", "id": "9753544", "url": "https://pubmed.ncbi.nlm.nih.gov/9753544" }, { "database": "SGD", "id": "S000003973", "url": "https://www.yeastgenome.org/locus/S000003973" }, { "database": "PubMed", "id": "33481703", "url": "https://pubmed.ncbi.nlm.nih.gov/33481703" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" } ], "site_lbl": "Ser4", "uniprot_canonical_ac": "Q03048-1" } ], "record_id": "pubmed.9753544", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Karyopherin-mediated import of integral inner nuclear membrane proteins.", "journal": "Nature", "date": "2006-08-31", "authors": "King Megan C, Lusk C Patrick, Blobel G\u00fcnter", "reference": { "type": "PubMed", "id": "16929305", "url": "https://pubmed.ncbi.nlm.nih.gov/16929305" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q03281-1", "protein_name": "Inner nuclear membrane protein HEH2", "gene_name": "HEH2", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q03707-1", "protein_name": "Inner nuclear membrane protein SRC1", "gene_name": "SRC1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q02821-1", "protein_name": "Importin subunit alpha", "gene_name": "SRP1", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "Q03281", "url": "https://www.uniprot.org/uniprotkb/Q03281" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "mutagenesis": [ { "start_pos": 124, "end_pos": 137, "sequence_org": "PKKKRKKRSSKANK", "sequence_mut": "", "comment": "No interaction with SRP1; when associated with missing 309-I--E-663. Mislocalized to the endoplasmic reticulum.", "evidence": [ { "database": "UniProtKB", "id": "Q03281", "url": "https://www.uniprot.org/uniprotkb/Q03281" }, { "database": "PubMed", "id": "16929305", "url": "https://pubmed.ncbi.nlm.nih.gov/16929305" } ], "uniprot_canonical_ac": "Q03281-1" }, { "start_pos": 126, "end_pos": 126, "sequence_org": "K", "sequence_mut": "T", "comment": "Mislocalized to the endoplasmic reticulum.", "evidence": [ { "database": "UniProtKB", "id": "Q03281", "url": "https://www.uniprot.org/uniprotkb/Q03281" }, { "database": "PubMed", "id": "16929305", "url": "https://pubmed.ncbi.nlm.nih.gov/16929305" } ], "uniprot_canonical_ac": "Q03281-1" }, { "start_pos": 1, "end_pos": 133, "sequence_org": "MDHRNLDPKTLKVSQLRRVLVENDVAFPANARKPVLVKLFEEKVRQRLQSSPEASKVRTSIQKVVKSGAKNADRKKTLKSKKLESSSSESKTVKDENVETNKRKREQISTDNEAKMQIQEEKSPKKKRKKRSS", "sequence_mut": "", "comment": "No interaction with SRP1; when associated with missing 309-I--E-663.", "evidence": [ { "database": "UniProtKB", "id": "Q03281", "url": "https://www.uniprot.org/uniprotkb/Q03281" }, { "database": "PubMed", "id": "16929305", "url": "https://pubmed.ncbi.nlm.nih.gov/16929305" } ], "uniprot_canonical_ac": "Q03281-1" }, { "start_pos": 1, "end_pos": 52, "sequence_org": "MDHRNLDPKTLKVSQLRRVLVENDVAFPANARKPVLVKLFEEKVRQRLQSSP", "sequence_mut": "", "comment": "Interaction with SRP1; when associated with missing 309-I--E-663.", "evidence": [ { "database": "UniProtKB", "id": "Q03281", "url": "https://www.uniprot.org/uniprotkb/Q03281" }, { "database": "PubMed", "id": "16929305", "url": "https://pubmed.ncbi.nlm.nih.gov/16929305" } ], "uniprot_canonical_ac": "Q03281-1" }, { "start_pos": 309, "end_pos": 663, "sequence_org": "IMKPFIAHLFIWLWNGAIFLSIICPILFGLWYREQRIQVGYCGHEKPLKSLAISAFPQTERVDSVLQAYRPNCLECPEHGICSSFMNVECEPGYEPKSSILETYGIIPFPKYCAKDESKEKEVDELVWKVNEYLKKKNAQHECGEGENLFESGETETKLYDIFSHSRPSWESQREFNDHWKNVLEILKKKDDIIWLPLDFETNGKREKSKSNNTNYIYRSTSKKWVTLQCHLEGDIQEYITKYGGSLFITLGVLFLIKKIQSTLDNYVQGEQIIEKLVKEAIDKLKDVKKNKGEEPFLTTVQLRATLLSDIPNIKEQNNLWAQTKEKIMKEQSENIELYLLEENGEIMTCWEWKE", "sequence_mut": "", "comment": "Interaction with SRP1.", "evidence": [ { "database": "UniProtKB", "id": "Q03281", "url": "https://www.uniprot.org/uniprotkb/Q03281" }, { "database": "PubMed", "id": "16929305", "url": "https://pubmed.ncbi.nlm.nih.gov/16929305" } ], "uniprot_canonical_ac": "Q03281-1" } ], "record_id": "pubmed.16929305", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "GINS, a novel multiprotein complex required for chromosomal DNA replication in budding yeast.", "journal": "Genes & development", "date": "2003", "authors": "Takayama Y, Kamimura Y, Okawa M, Muramatsu S, Sugino A, Araki H", "reference": { "type": "PubMed", "id": "12730134", "url": "https://pubmed.ncbi.nlm.nih.gov/12730134" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q03406-1", "protein_name": "DNA replication complex GINS protein SLD5", "gene_name": "SLD5", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q12146-1", "protein_name": "DNA replication complex GINS protein PSF3", "gene_name": "PSF3", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P40359-1", "protein_name": "DNA replication complex GINS protein PSF2", "gene_name": "PSF2", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q12488-1", "protein_name": "DNA replication complex GINS protein PSF1", "gene_name": "PSF1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q9BRX5-1", "protein_name": "DNA replication complex GINS protein PSF3", "gene_name": "GINS3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P47027-1", "protein_name": "DNA replication regulator DPB11", "gene_name": "DPB11", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P53135-1", "protein_name": "DNA replication regulator SLD3", "gene_name": "SLD3", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "Q03406", "url": "https://www.uniprot.org/uniprotkb/Q03406" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "mutagenesis": [ { "start_pos": 150, "end_pos": 150, "sequence_org": "K", "sequence_mut": "E", "comment": "In sld5-2; temperature-sensitive mutant. Defective in DNA replication.", "evidence": [ { "database": "UniProtKB", "id": "Q03406", "url": "https://www.uniprot.org/uniprotkb/Q03406" }, { "database": "PubMed", "id": "12730134", "url": "https://pubmed.ncbi.nlm.nih.gov/12730134" } ], "uniprot_canonical_ac": "Q03406-1" }, { "start_pos": 21, "end_pos": 21, "sequence_org": "S", "sequence_mut": "P", "comment": "In sld5-8; temperature-sensitive mutant; in association with P-66. Defective in DNA replication.", "evidence": [ { "database": "UniProtKB", "id": "Q03406", "url": "https://www.uniprot.org/uniprotkb/Q03406" }, { "database": "PubMed", "id": "12730134", "url": "https://pubmed.ncbi.nlm.nih.gov/12730134" } ], "uniprot_canonical_ac": "Q03406-1" }, { "start_pos": 293, "end_pos": 293, "sequence_org": "L", "sequence_mut": "P", "comment": "In sld5-13; temperature-sensitive mutant. Defective in DNA replication.", "evidence": [ { "database": "UniProtKB", "id": "Q03406", "url": "https://www.uniprot.org/uniprotkb/Q03406" }, { "database": "PubMed", "id": "12730134", "url": "https://pubmed.ncbi.nlm.nih.gov/12730134" } ], "uniprot_canonical_ac": "Q03406-1" }, { "start_pos": 66, "end_pos": 66, "sequence_org": "S", "sequence_mut": "P", "comment": "In sld5-8; temperature-sensitive mutant; in association with P-21. Defective in DNA replication.", "evidence": [ { "database": "UniProtKB", "id": "Q03406", "url": "https://www.uniprot.org/uniprotkb/Q03406" }, { "database": "PubMed", "id": "12730134", "url": "https://pubmed.ncbi.nlm.nih.gov/12730134" } ], "uniprot_canonical_ac": "Q03406-1" }, { "start_pos": 67, "end_pos": 67, "sequence_org": "W", "sequence_mut": "R", "comment": "In sld5-12; temperature-sensitive mutant. Defective in DNA replication.", "evidence": [ { "database": "UniProtKB", "id": "Q03406", "url": "https://www.uniprot.org/uniprotkb/Q03406" }, { "database": "PubMed", "id": "12730134", "url": "https://pubmed.ncbi.nlm.nih.gov/12730134" } ], "uniprot_canonical_ac": "Q03406-1" }, { "start_pos": 84, "end_pos": 84, "sequence_org": "R", "sequence_mut": "G", "comment": "In PSF1-1; temperature-sensitive mutant. Defective in DNA replication. Impaired chromatin binding of CDC45.", "evidence": [ { "database": "UniProtKB", "id": "Q12488", "url": "https://www.uniprot.org/uniprotkb/Q12488" }, { "database": "PubMed", "id": "12730134", "url": "https://pubmed.ncbi.nlm.nih.gov/12730134" } ], "uniprot_canonical_ac": "Q12488-1" } ], "record_id": "pubmed.12730134", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 7 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Characterization of a high mobility group 1/2 homolog in yeast.", "journal": "J. Biol. Chem.", "date": "1996", "authors": "Lu J, Kobayashi R, Brill S J", "reference": { "type": "PubMed", "id": "8969238", "url": "https://pubmed.ncbi.nlm.nih.gov/8969238" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q03435-1", "protein_name": "Non-histone protein 10", "gene_name": "NHP10", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q03973-1", "protein_name": "High mobility group protein 1", "gene_name": "HMO1", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "Q03435", "url": "https://www.uniprot.org/uniprotkb/Q03435" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.8969238", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "A genome-wide screen identifies the evolutionarily conserved KEOPS complex as a telomere regulator.", "journal": "Cell", "date": "2006-03-24", "authors": "Downey Michael, Houlsworth Rebecca, Maringele Laura, Rollie Adrienne, Brehme Marc, Galicia Sarah, Guillard Sandrine, Partington Melanie, Zubko Mikhajlo K, Krogan Nevan J, Emili Andrew, Greenblatt Jack F, Harrington Lea, Lydall David, Durocher Daniel", "reference": { "type": "PubMed", "id": "16564010", "url": "https://pubmed.ncbi.nlm.nih.gov/16564010" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q03705-1", "protein_name": "EKC/KEOPS complex subunit CGI121", "gene_name": "CGI121", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P36132-1", "protein_name": "tRNA N6-adenosine threonylcarbamoyltransferase", "gene_name": "KAE1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P46984-1", "protein_name": "EKC/KEOPS complex subunit GON7", "gene_name": "GON7", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P53323-1", "protein_name": "EKC/KEOPS complex subunit BUD32", "gene_name": "BUD32", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "Q03705", "url": "https://www.uniprot.org/uniprotkb/Q03705" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.16564010", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 4 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Yeast homolog of a cancer-testis antigen defines a new transcription complex.", "journal": "The EMBO journal", "date": "2006-08-09", "authors": "Kisseleva-Romanova Elena, Lopreiato Raffaele, Baudin-Baillieu Agn\u00e8s, Rousselle Jean-Claude, Ilan Laila, Hofmann Kay, Namane Abdelkader, Mann Carl, Libri Domenico", "reference": { "type": "PubMed", "id": "16874308", "url": "https://pubmed.ncbi.nlm.nih.gov/16874308" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q03705-1", "protein_name": "EKC/KEOPS complex subunit CGI121", "gene_name": "CGI121", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P36132-1", "protein_name": "tRNA N6-adenosine threonylcarbamoyltransferase", "gene_name": "KAE1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q3E833-1", "protein_name": "EKC/KEOPS complex subunit PCC1", "gene_name": "PCC1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P46984-1", "protein_name": "EKC/KEOPS complex subunit GON7", "gene_name": "GON7", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P53323-1", "protein_name": "EKC/KEOPS complex subunit BUD32", "gene_name": "BUD32", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "Q03705", "url": "https://www.uniprot.org/uniprotkb/Q03705" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.16874308", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 5 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "A large-scale full-length cDNA analysis to explore the budding yeast transcriptome.", "journal": "Proc. Natl. Acad. Sci. U.S.A.", "date": "2006", "authors": "Miura Fumihito, Kawaguchi Noriko, Sese Jun, Toyoda Atsushi, Hattori Masahira, Morishita Shinichi, Ito Takashi", "reference": { "type": "PubMed", "id": "17101987", "url": "https://pubmed.ncbi.nlm.nih.gov/17101987" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q03705-1", "protein_name": "EKC/KEOPS complex subunit CGI121", "gene_name": "CGI121", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "A5Z2X5-1", "protein_name": "UPF0495 protein YPR010C-A", "gene_name": "", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P43617-1", "protein_name": "Uncharacterized mitochondrial carrier YFR045W", "gene_name": "", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q02203-1", "protein_name": "Uncharacterized protein YKR005C", "gene_name": "YK104", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q06537-1", "protein_name": "Uncharacterized protein YPR153W", "gene_name": "", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q01532-1", "protein_name": "Cysteine proteinase 1, mitochondrial", "gene_name": "LAP3", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q07532-1", "protein_name": "RNA polymerase II nuclear localization protein IWR1", "gene_name": "IWR1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P40005-1", "protein_name": "Prefoldin subunit 2", "gene_name": "GIM4", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q99278-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 11", "gene_name": "MED11", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P0CX24-1", "protein_name": "Large ribosomal subunit protein eL20B", "gene_name": "RPL20B", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P53221-1", "protein_name": "Large ribosomal subunit protein uL24B", "gene_name": "RPL26B", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P53905-1", "protein_name": "LSM complex subunit LSM7", "gene_name": "LSM7", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P0CX23-1", "protein_name": "Large ribosomal subunit protein eL20A", "gene_name": "RPL20A", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "Q03705", "url": "https://www.uniprot.org/uniprotkb/Q03705" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.17101987", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 13 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Gcn4 misregulation reveals a direct role for the evolutionary conserved EKC/KEOPS in the t6A modification of tRNAs.", "journal": "Nucleic acids research", "date": "2011-08", "authors": "Daugeron Marie-Claire, Lenstra Tineke L, Frizzarin Martina, El Yacoubi Basma, Liu Xipeng, Baudin-Baillieu Agn\u00e8s, Lijnzaad Philip, Decourty Laurence, Saveanu Cosmin, Jacquier Alain, Holstege Frank C P, de Cr\u00e9cy-Lagard Val\u00e9rie, van Tilbeurgh Herman, Libri Domenico", "reference": { "type": "PubMed", "id": "21459853", "url": "https://pubmed.ncbi.nlm.nih.gov/21459853" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q03705-1", "protein_name": "EKC/KEOPS complex subunit CGI121", "gene_name": "CGI121", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P36132-1", "protein_name": "tRNA N6-adenosine threonylcarbamoyltransferase", "gene_name": "KAE1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q3E833-1", "protein_name": "EKC/KEOPS complex subunit PCC1", "gene_name": "PCC1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P46984-1", "protein_name": "EKC/KEOPS complex subunit GON7", "gene_name": "GON7", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P53323-1", "protein_name": "EKC/KEOPS complex subunit BUD32", "gene_name": "BUD32", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "Q03705", "url": "https://www.uniprot.org/uniprotkb/Q03705" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.21459853", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 5 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "In vitro biosynthesis of a universal t6A tRNA modification in Archaea and Eukarya.", "journal": "Nucleic acids research", "date": "2013-02-01", "authors": "Perrochia Ludovic, Crozat Estelle, Hecker Arnaud, Zhang Wenhua, Bareille Joseph, Collinet Bruno, van Tilbeurgh Herman, Forterre Patrick, Basta Tamara", "reference": { "type": "PubMed", "id": "23258706", "url": "https://pubmed.ncbi.nlm.nih.gov/23258706" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q03705-1", "protein_name": "EKC/KEOPS complex subunit CGI121", "gene_name": "CGI121", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P32579-1", "protein_name": "Threonylcarbamoyl-AMP synthase", "gene_name": "SUA5", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P36132-1", "protein_name": "tRNA N6-adenosine threonylcarbamoyltransferase", "gene_name": "KAE1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q3E833-1", "protein_name": "EKC/KEOPS complex subunit PCC1", "gene_name": "PCC1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P46984-1", "protein_name": "EKC/KEOPS complex subunit GON7", "gene_name": "GON7", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P53323-1", "protein_name": "EKC/KEOPS complex subunit BUD32", "gene_name": "BUD32", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "Q03705", "url": "https://www.uniprot.org/uniprotkb/Q03705" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.23258706", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 6 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Distinct ubiquitin-ligase complexes define convergent pathways for the degradation of ER proteins.", "journal": "Cell", "date": "2006-07-28", "authors": "Carvalho Pedro, Goder Veit, Rapoport Tom A", "reference": { "type": "PubMed", "id": "16873066", "url": "https://pubmed.ncbi.nlm.nih.gov/16873066" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q03714-1", "protein_name": "U1 SNP1-associating protein 1", "gene_name": "USA1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q02159-1", "protein_name": "Ubiquitin-conjugating enzyme E2 7", "gene_name": "UBC7", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P38428-1", "protein_name": "Coupling of ubiquitin conjugation to ER degradation protein 1", "gene_name": "CUE1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P33755-1", "protein_name": "Nuclear protein localization protein 4", "gene_name": "NPL4", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q04228-1", "protein_name": "UBX domain-containing protein 2", "gene_name": "UBX2", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P25694-1", "protein_name": "AAA family ATPase involved in ubiquitin-mediated protein degradation CDC48", "gene_name": "CDC48", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P38307-1", "protein_name": "Degradation in the endoplasmic reticulum protein 1", "gene_name": "DER1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P40318-1", "protein_name": "ERAD-associated E3 ubiquitin-protein ligase DOA10", "gene_name": "SSM4", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P53044-1", "protein_name": "Ubiquitin fusion degradation protein 1", "gene_name": "UFD1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q05787-1", "protein_name": "ERAD-associated E3 ubiquitin-protein ligase component HRD3", "gene_name": "HRD3", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q08109-1", "protein_name": "ERAD-associated E3 ubiquitin-protein ligase HRD1", "gene_name": "HRD1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q99220-1", "protein_name": "Protein OS-9 homolog", "gene_name": "YOS9", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "Q03714", "url": "https://www.uniprot.org/uniprotkb/Q03714" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.16873066", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 12 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Usa1 protein facilitates substrate ubiquitylation through two separate domains.", "journal": "PloS one", "date": "2009-10-29", "authors": "Kim Ikjin, Li Yue, Muniz Paulina, Rao Hai", "reference": { "type": "PubMed", "id": "19898607", "url": "https://pubmed.ncbi.nlm.nih.gov/19898607" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q03714-1", "protein_name": "U1 SNP1-associating protein 1", "gene_name": "USA1", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "Q03714", "url": "https://www.uniprot.org/uniprotkb/Q03714" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.19898607", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Usa1p is required for optimal function and regulation of the Hrd1p endoplasmic reticulum-associated degradation ubiquitin ligase.", "journal": "The Journal of biological chemistry", "date": "2010-02-19", "authors": "Carroll Sarah M, Hampton Randolph Y", "reference": { "type": "PubMed", "id": "19940128", "url": "https://pubmed.ncbi.nlm.nih.gov/19940128" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q03714-1", "protein_name": "U1 SNP1-associating protein 1", "gene_name": "USA1", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "Q03714", "url": "https://www.uniprot.org/uniprotkb/Q03714" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.19940128", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Usa1 functions as a scaffold of the HRD-ubiquitin ligase.", "journal": "Molecular cell", "date": "2009-12-11", "authors": "Horn Sabine C, Hanna Jennifer, Hirsch Christian, Volkwein Corinna, Sch\u00fctz Anja, Heinemann Udo, Sommer Thomas, Jarosch Ernst", "reference": { "type": "PubMed", "id": "20005842", "url": "https://pubmed.ncbi.nlm.nih.gov/20005842" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q03714-1", "protein_name": "U1 SNP1-associating protein 1", "gene_name": "USA1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P38307-1", "protein_name": "Degradation in the endoplasmic reticulum protein 1", "gene_name": "DER1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q08109-1", "protein_name": "ERAD-associated E3 ubiquitin-protein ligase HRD1", "gene_name": "HRD1", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "Q03714", "url": "https://www.uniprot.org/uniprotkb/Q03714" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "mutagenesis": [ { "start_pos": 399, "end_pos": 399, "sequence_org": "C", "sequence_mut": "S", "comment": "Stabilizes HRD1. Reduced interaction with substrate. Formation of oligomer with or without USA1.", "evidence": [ { "database": "UniProtKB", "id": "Q08109", "url": "https://www.uniprot.org/uniprotkb/Q08109" }, { "database": "PubMed", "id": "21074049", "url": "https://pubmed.ncbi.nlm.nih.gov/21074049" }, { "database": "PubMed", "id": "11146622", "url": "https://pubmed.ncbi.nlm.nih.gov/11146622" }, { "database": "PubMed", "id": "11018054", "url": "https://pubmed.ncbi.nlm.nih.gov/11018054" }, { "database": "PubMed", "id": "20005842", "url": "https://pubmed.ncbi.nlm.nih.gov/20005842" }, { "database": "PubMed", "id": "11139575", "url": "https://pubmed.ncbi.nlm.nih.gov/11139575" } ], "uniprot_canonical_ac": "Q08109-1" } ], "record_id": "pubmed.20005842", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Retrotranslocation of a misfolded luminal ER protein by the ubiquitin-ligase Hrd1p.", "journal": "Cell", "date": "2010-11-12", "authors": "Carvalho Pedro, Stanley Ann Marie, Rapoport Tom A", "reference": { "type": "PubMed", "id": "21074049", "url": "https://pubmed.ncbi.nlm.nih.gov/21074049" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q03714-1", "protein_name": "U1 SNP1-associating protein 1", "gene_name": "USA1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q08109-1", "protein_name": "ERAD-associated E3 ubiquitin-protein ligase HRD1", "gene_name": "HRD1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q99220-1", "protein_name": "Protein OS-9 homolog", "gene_name": "YOS9", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "Q03714", "url": "https://www.uniprot.org/uniprotkb/Q03714" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "mutagenesis": [ { "start_pos": 399, "end_pos": 399, "sequence_org": "C", "sequence_mut": "S", "comment": "Stabilizes HRD1. Reduced interaction with substrate. Formation of oligomer with or without USA1.", "evidence": [ { "database": "UniProtKB", "id": "Q08109", "url": "https://www.uniprot.org/uniprotkb/Q08109" }, { "database": "PubMed", "id": "21074049", "url": "https://pubmed.ncbi.nlm.nih.gov/21074049" }, { "database": "PubMed", "id": "11146622", "url": "https://pubmed.ncbi.nlm.nih.gov/11146622" }, { "database": "PubMed", "id": "11018054", "url": "https://pubmed.ncbi.nlm.nih.gov/11018054" }, { "database": "PubMed", "id": "20005842", "url": "https://pubmed.ncbi.nlm.nih.gov/20005842" }, { "database": "PubMed", "id": "11139575", "url": "https://pubmed.ncbi.nlm.nih.gov/11139575" } ], "uniprot_canonical_ac": "Q08109-1" } ], "record_id": "pubmed.21074049", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Apg16p is required for the function of the Apg12p-Apg5p conjugate in the yeast autophagy pathway.", "journal": "The EMBO journal", "date": "1999-07-15", "authors": "Mizushima N, Noda T, Ohsumi Y", "reference": { "type": "PubMed", "id": "10406794", "url": "https://pubmed.ncbi.nlm.nih.gov/10406794" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q03818-1", "protein_name": "Autophagy protein 16", "gene_name": "ATG16", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q12380-1", "protein_name": "Autophagy protein 5", "gene_name": "ATG5", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "Q03818", "url": "https://www.uniprot.org/uniprotkb/Q03818" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.10406794", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Formation of the approximately 350-kDa Apg12-Apg5.Apg16 multimeric complex, mediated by Apg16 oligomerization, is essential for autophagy in yeast.", "journal": "The Journal of biological chemistry", "date": "2002-05-24", "authors": "Kuma Akiko, Mizushima Noboru, Ishihara Naotada, Ohsumi Yoshinori", "reference": { "type": "PubMed", "id": "11897782", "url": "https://pubmed.ncbi.nlm.nih.gov/11897782" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q03818-1", "protein_name": "Autophagy protein 16", "gene_name": "ATG16", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q12380-1", "protein_name": "Autophagy protein 5", "gene_name": "ATG5", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P38316-1", "protein_name": "Ubiquitin-like protein ATG12", "gene_name": "ATG12", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "Q03818", "url": "https://www.uniprot.org/uniprotkb/Q03818" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.11897782", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "apg15-1, a UGA mutant allele in the Saccharomyces cerevisiae APG16 gene, and its suppression by a cytoplasmic factor.", "journal": "Biosci. Biotechnol. Biochem.", "date": "2004", "authors": "Okazaki Hiroshi, Ono Bun-Ichiro, Ohsumi Yoshinori, Ohsumi Mariko", "reference": { "type": "PubMed", "id": "15277759", "url": "https://pubmed.ncbi.nlm.nih.gov/15277759" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q03818-1", "protein_name": "Autophagy protein 16", "gene_name": "ATG16", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "Q03818", "url": "https://www.uniprot.org/uniprotkb/Q03818" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.15277759", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Starvation triggers the delivery of the endoplasmic reticulum to the vacuole via autophagy in yeast.", "journal": "Traffic (Copenhagen, Denmark)", "date": "2005-01", "authors": "Hamasaki Maho, Noda Takeshi, Baba Misuzu, Ohsumi Yoshinori", "reference": { "type": "PubMed", "id": "15569245", "url": "https://pubmed.ncbi.nlm.nih.gov/15569245" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q03818-1", "protein_name": "Autophagy protein 16", "gene_name": "ATG16", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "Q03818", "url": "https://www.uniprot.org/uniprotkb/Q03818" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.15569245", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Structure-function relationship of Atg12, a ubiquitin-like modifier essential for autophagy.", "journal": "Autophagy", "date": "2005", "authors": "Hanada Takao, Ohsumi Yoshinori", "reference": { "type": "PubMed", "id": "16874032", "url": "https://pubmed.ncbi.nlm.nih.gov/16874032" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q03818-1", "protein_name": "Autophagy protein 16", "gene_name": "ATG16", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q07879-1", "protein_name": "Ubiquitin-like-conjugating enzyme ATG10", "gene_name": "ATG10", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q12380-1", "protein_name": "Autophagy protein 5", "gene_name": "ATG5", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P38316-1", "protein_name": "Ubiquitin-like protein ATG12", "gene_name": "ATG12", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P38862-1", "protein_name": "Ubiquitin-like modifier-activating enzyme ATG7", "gene_name": "ATG7", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "Q03818", "url": "https://www.uniprot.org/uniprotkb/Q03818" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "mutagenesis": [ { "start_pos": 106, "end_pos": 106, "sequence_org": "I", "sequence_mut": "A", "comment": "Decreases protein stability.", "evidence": [ { "database": "UniProtKB", "id": "P38316", "url": "https://www.uniprot.org/uniprotkb/P38316" }, { "database": "PubMed", "id": "16874032", "url": "https://pubmed.ncbi.nlm.nih.gov/16874032" } ], "uniprot_canonical_ac": "P38316-1" }, { "start_pos": 108, "end_pos": 108, "sequence_org": "F", "sequence_mut": "A", "comment": "Decreases protein stability.", "evidence": [ { "database": "UniProtKB", "id": "P38316", "url": "https://www.uniprot.org/uniprotkb/P38316" }, { "database": "PubMed", "id": "16874032", "url": "https://pubmed.ncbi.nlm.nih.gov/16874032" } ], "uniprot_canonical_ac": "P38316-1" }, { "start_pos": 149, "end_pos": 149, "sequence_org": "Y", "sequence_mut": "A", "comment": "Impairs conjugation to ATG5 and autophagic activity.", "evidence": [ { "database": "UniProtKB", "id": "P38316", "url": "https://www.uniprot.org/uniprotkb/P38316" }, { "database": "PubMed", "id": "16874032", "url": "https://pubmed.ncbi.nlm.nih.gov/16874032" } ], "uniprot_canonical_ac": "P38316-1" }, { "start_pos": 154, "end_pos": 154, "sequence_org": "F", "sequence_mut": "A", "comment": "Impairs conjugation to ATG5 and autophagic activity.", "evidence": [ { "database": "UniProtKB", "id": "P38316", "url": "https://www.uniprot.org/uniprotkb/P38316" }, { "database": "PubMed", "id": "16874032", "url": "https://pubmed.ncbi.nlm.nih.gov/16874032" } ], "uniprot_canonical_ac": "P38316-1" } ], "record_id": "pubmed.16874032", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 5 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Autophagy counterbalances endoplasmic reticulum expansion during the unfolded protein response.", "journal": "PLoS biology", "date": "2006-11", "authors": "Bernales Sebasti\u00e1n, McDonald Kent L, Walter Peter", "reference": { "type": "PubMed", "id": "17132049", "url": "https://pubmed.ncbi.nlm.nih.gov/17132049" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q03818-1", "protein_name": "Autophagy protein 16", "gene_name": "ATG16", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q07528-1", "protein_name": "Autophagy-related protein 20", "gene_name": "ATG20", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q12142-1", "protein_name": "Autophagy-related protein 9", "gene_name": "ATG9", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P35193-1", "protein_name": "Autophagy-related protein 19", "gene_name": "ATG19", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P38182-1", "protein_name": "Autophagy-related protein 8", "gene_name": "ATG8", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "Q03818", "url": "https://www.uniprot.org/uniprotkb/Q03818" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.17132049", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 5 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Structure of Atg5.Atg16, a complex essential for autophagy.", "journal": "The Journal of biological chemistry", "date": "2007-03-02", "authors": "Matsushita Minako, Suzuki Nobuo N, Obara Keisuke, Fujioka Yuko, Ohsumi Yoshinori, Inagaki Fuyuhiko", "reference": { "type": "PubMed", "id": "17192262", "url": "https://pubmed.ncbi.nlm.nih.gov/17192262" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q03818-1", "protein_name": "Autophagy protein 16", "gene_name": "ATG16", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q12380-1", "protein_name": "Autophagy protein 5", "gene_name": "ATG5", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "Q03818", "url": "https://www.uniprot.org/uniprotkb/Q03818" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "mutagenesis": [ { "start_pos": 35, "end_pos": 35, "sequence_org": "R", "sequence_mut": "A", "comment": "Impairs interaction with ATG5and autophagy.", "evidence": [ { "database": "UniProtKB", "id": "Q03818", "url": "https://www.uniprot.org/uniprotkb/Q03818" }, { "database": "PubMed", "id": "17192262", "url": "https://pubmed.ncbi.nlm.nih.gov/17192262" } ], "uniprot_canonical_ac": "Q03818-1" }, { "start_pos": 46, "end_pos": 46, "sequence_org": "F", "sequence_mut": "A", "comment": "Impairs interaction with ATG5and autophagy.", "evidence": [ { "database": "UniProtKB", "id": "Q03818", "url": "https://www.uniprot.org/uniprotkb/Q03818" }, { "database": "PubMed", "id": "17192262", "url": "https://pubmed.ncbi.nlm.nih.gov/17192262" } ], "uniprot_canonical_ac": "Q03818-1" } ], "record_id": "pubmed.17192262", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The Atg1 kinase complex is involved in the regulation of protein recruitment to initiate sequestering vesicle formation for nonspecific autophagy in Saccharomyces cerevisiae.", "journal": "Mol. Biol. Cell", "date": "2008", "authors": "Cheong Heesun, Nair Usha, Geng Jiefei, Klionsky Daniel J", "reference": { "type": "PubMed", "id": "18077553", "url": "https://pubmed.ncbi.nlm.nih.gov/18077553" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q03818-1", "protein_name": "Autophagy protein 16", "gene_name": "ATG16", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q06410-1", "protein_name": "Autophagy-related protein 17", "gene_name": "ATG17", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q06628-1", "protein_name": "Autophagy-related protein 13", "gene_name": "ATG13", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P38270-1", "protein_name": "Autophagy-related protein 14", "gene_name": "ATG14", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P53104-1", "protein_name": "Serine/threonine-protein kinase ATG1", "gene_name": "ATG1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q12527-1", "protein_name": "Autophagy-related protein 11", "gene_name": "ATG11", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P38182-1", "protein_name": "Autophagy-related protein 8", "gene_name": "ATG8", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "Q03818", "url": "https://www.uniprot.org/uniprotkb/Q03818" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.18077553", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 7 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Dimeric coiled-coil structure of Saccharomyces cerevisiae Atg16 and its functional significance in autophagy.", "journal": "The Journal of biological chemistry", "date": "2010-01-08", "authors": "Fujioka Yuko, Noda Nobuo N, Nakatogawa Hitoshi, Ohsumi Yoshinori, Inagaki Fuyuhiko", "reference": { "type": "PubMed", "id": "19889643", "url": "https://pubmed.ncbi.nlm.nih.gov/19889643" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q03818-1", "protein_name": "Autophagy protein 16", "gene_name": "ATG16", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "Q03818", "url": "https://www.uniprot.org/uniprotkb/Q03818" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "mutagenesis": [ { "start_pos": 101, "end_pos": 101, "sequence_org": "D", "sequence_mut": "A", "comment": "Significantly reduces autophagic activity; when associated with A-102.", "evidence": [ { "database": "UniProtKB", "id": "Q03818", "url": "https://www.uniprot.org/uniprotkb/Q03818" }, { "database": "PubMed", "id": "19889643", "url": "https://pubmed.ncbi.nlm.nih.gov/19889643" } ], "uniprot_canonical_ac": "Q03818-1" }, { "start_pos": 102, "end_pos": 102, "sequence_org": "E", "sequence_mut": "A", "comment": "Significantly reduces autophagic activity; when associated with A-101.", "evidence": [ { "database": "UniProtKB", "id": "Q03818", "url": "https://www.uniprot.org/uniprotkb/Q03818" }, { "database": "PubMed", "id": "19889643", "url": "https://pubmed.ncbi.nlm.nih.gov/19889643" } ], "uniprot_canonical_ac": "Q03818-1" }, { "start_pos": 104, "end_pos": 104, "sequence_org": "I", "sequence_mut": "A", "comment": "Significantly reduces autophagic activity; when associated with A-108 and A-112.", "evidence": [ { "database": "UniProtKB", "id": "Q03818", "url": "https://www.uniprot.org/uniprotkb/Q03818" }, { "database": "PubMed", "id": "19889643", "url": "https://pubmed.ncbi.nlm.nih.gov/19889643" } ], "uniprot_canonical_ac": "Q03818-1" }, { "start_pos": 108, "end_pos": 108, "sequence_org": "I", "sequence_mut": "A", "comment": "Significantly reduces autophagic activity; when associated with A-104 and A-112.", "evidence": [ { "database": "UniProtKB", "id": "Q03818", "url": "https://www.uniprot.org/uniprotkb/Q03818" }, { "database": "PubMed", "id": "19889643", "url": "https://pubmed.ncbi.nlm.nih.gov/19889643" } ], "uniprot_canonical_ac": "Q03818-1" }, { "start_pos": 112, "end_pos": 112, "sequence_org": "V", "sequence_mut": "A", "comment": "Significantly reduces autophagic activity; when associated with A-104 and A-108.", "evidence": [ { "database": "UniProtKB", "id": "Q03818", "url": "https://www.uniprot.org/uniprotkb/Q03818" }, { "database": "PubMed", "id": "19889643", "url": "https://pubmed.ncbi.nlm.nih.gov/19889643" } ], "uniprot_canonical_ac": "Q03818-1" } ], "record_id": "pubmed.19889643", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Mechanism and functions of membrane binding by the Atg5-Atg12/Atg16 complex during autophagosome formation.", "journal": "The EMBO journal", "date": "2012-11-14", "authors": "Romanov Julia, Walczak Marta, Ibiricu Iosune, Sch\u00fcchner Stefan, Ogris Egon, Kraft Claudine, Martens Sascha", "reference": { "type": "PubMed", "id": "23064152", "url": "https://pubmed.ncbi.nlm.nih.gov/23064152" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q03818-1", "protein_name": "Autophagy protein 16", "gene_name": "ATG16", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q12380-1", "protein_name": "Autophagy protein 5", "gene_name": "ATG5", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P38316-1", "protein_name": "Ubiquitin-like protein ATG12", "gene_name": "ATG12", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P38182-1", "protein_name": "Autophagy-related protein 8", "gene_name": "ATG8", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "Q03818", "url": "https://www.uniprot.org/uniprotkb/Q03818" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.23064152", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 4 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Structure of the Atg12-Atg5 conjugate reveals a platform for stimulating Atg8-PE conjugation.", "journal": "EMBO Rep.", "date": "2013", "authors": "Noda Nobuo N, Fujioka Yuko, Hanada Takao, Ohsumi Yoshinori, Inagaki Fuyuhiko", "reference": { "type": "PubMed", "id": "23238393", "url": "https://pubmed.ncbi.nlm.nih.gov/23238393" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q03818-1", "protein_name": "Autophagy protein 16", "gene_name": "ATG16", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q12380-1", "protein_name": "Autophagy protein 5", "gene_name": "ATG5", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P38316-1", "protein_name": "Ubiquitin-like protein ATG12", "gene_name": "ATG12", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "Q03818", "url": "https://www.uniprot.org/uniprotkb/Q03818" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.23238393", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "60S pre-ribosome formation viewed from assembly in the nucleolus until export to the cytoplasm.", "journal": "The EMBO journal", "date": "2002-10-15", "authors": "Nissan Tracy A, Bassler Jochen, Petfalski Elisabeth, Tollervey David, Hurt Ed", "reference": { "type": "PubMed", "id": "12374754", "url": "https://pubmed.ncbi.nlm.nih.gov/12374754" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q03862-1", "protein_name": "Probable metalloprotease ARX1", "gene_name": "ARX1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P53313-1", "protein_name": "Protein SDA1", "gene_name": "SDA1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P25582-1", "protein_name": "27S pre-rRNA (guanosine(2922)-2'-O)-methyltransferase", "gene_name": "SPB1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P20484-1", "protein_name": "Protein MAK11", "gene_name": "MAK11", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q12019-1", "protein_name": "Midasin", "gene_name": "MDN1", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "Q03862", "url": "https://www.uniprot.org/uniprotkb/Q03862" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.12374754", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 5 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Nuclear recycling of the pre-60S ribosomal subunit-associated factor Arx1 depends on Rei1 in Saccharomyces cerevisiae.", "journal": "Molecular and cellular biology", "date": "2006-05", "authors": "Hung Nai-Jung, Johnson Arlen W", "reference": { "type": "PubMed", "id": "16648468", "url": "https://pubmed.ncbi.nlm.nih.gov/16648468" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q03862-1", "protein_name": "Probable metalloprotease ARX1", "gene_name": "ARX1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P38344-1", "protein_name": "Cytoplasmic 60S subunit biogenesis factor REI1", "gene_name": "REI1", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "Q03862", "url": "https://www.uniprot.org/uniprotkb/Q03862" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.16648468", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Yeast carboxyl-terminal domain kinase I positively and negatively regulates RNA polymerase II carboxyl-terminal domain phosphorylation.", "journal": "The Journal of biological chemistry", "date": "1999-09-24", "authors": "Patturajan M, Conrad N K, Bregman D B, Corden J L", "reference": { "type": "PubMed", "id": "10488128", "url": "https://pubmed.ncbi.nlm.nih.gov/10488128" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q03957-1", "protein_name": "CTD kinase subunit alpha", "gene_name": "CTK1", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "Q03957", "url": "https://www.uniprot.org/uniprotkb/Q03957" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.10488128", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Involvement of yeast carboxy-terminal domain kinase I (CTDK-I) in transcription elongation in vivo.", "journal": "Gene", "date": "2001", "authors": "Jona G, Wittschieben B O, Svejstrup J Q, Gileadi O", "reference": { "type": "PubMed", "id": "11311553", "url": "https://pubmed.ncbi.nlm.nih.gov/11311553" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q03957-1", "protein_name": "CTD kinase subunit alpha", "gene_name": "CTK1", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "Q03957", "url": "https://www.uniprot.org/uniprotkb/Q03957" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.11311553", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Opposing effects of Ctk1 kinase and Fcp1 phosphatase at Ser 2 of the RNA polymerase II C-terminal domain.", "journal": "Genes & development", "date": "2001-12-15", "authors": "Cho E J, Kobor M S, Kim M, Greenblatt J, Buratowski S", "reference": { "type": "PubMed", "id": "11751637", "url": "https://pubmed.ncbi.nlm.nih.gov/11751637" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q03957-1", "protein_name": "CTD kinase subunit alpha", "gene_name": "CTK1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P04050-1", "protein_name": "DNA-directed RNA polymerase II subunit RPB1", "gene_name": "RPO21", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "Q03957", "url": "https://www.uniprot.org/uniprotkb/Q03957" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "phosphorylation": [ { "start_pos": 2, "end_pos": 2, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q03957", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q03957" }, { "database": "PubMed", "id": "11751637", "url": "https://pubmed.ncbi.nlm.nih.gov/11751637" }, { "database": "PubMed", "id": "15870265", "url": "https://pubmed.ncbi.nlm.nih.gov/15870265" } ], "site_lbl": "Ser2", "uniprot_canonical_ac": "Q03957-1" }, { "start_pos": 1543, "end_pos": 1543, "kinase_uniprot_canonical_ac": "P46962-1", "kinase_gene_name": "CTK2", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P04050", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P04050" }, { "database": "PubMed", "id": "10594013", "url": "https://pubmed.ncbi.nlm.nih.gov/10594013" }, { "database": "PubMed", "id": "11018013", "url": "https://pubmed.ncbi.nlm.nih.gov/11018013" }, { "database": "PubMed", "id": "11751637", "url": "https://pubmed.ncbi.nlm.nih.gov/11751637" }, { "database": "PubMed", "id": "12972617", "url": "https://pubmed.ncbi.nlm.nih.gov/12972617" }, { "database": "PubMed", "id": "20818391", "url": "https://pubmed.ncbi.nlm.nih.gov/20818391" }, { "database": "PubMed", "id": "9237170", "url": "https://pubmed.ncbi.nlm.nih.gov/9237170" } ], "site_lbl": "Ser1543", "uniprot_canonical_ac": "P04050-1" }, { "start_pos": 1543, "end_pos": 1543, "kinase_uniprot_canonical_ac": "Q03957-1", "kinase_gene_name": "CTK1", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P04050", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P04050" }, { "database": "PubMed", "id": "10594013", "url": "https://pubmed.ncbi.nlm.nih.gov/10594013" }, { "database": "PubMed", "id": "11018013", "url": "https://pubmed.ncbi.nlm.nih.gov/11018013" }, { "database": "PubMed", "id": "11751637", "url": "https://pubmed.ncbi.nlm.nih.gov/11751637" }, { "database": "PubMed", "id": "12972617", "url": "https://pubmed.ncbi.nlm.nih.gov/12972617" }, { "database": "PubMed", "id": "20818391", "url": "https://pubmed.ncbi.nlm.nih.gov/20818391" }, { "database": "PubMed", "id": "9237170", "url": "https://pubmed.ncbi.nlm.nih.gov/9237170" } ], "site_lbl": "Ser1543", "uniprot_canonical_ac": "P04050-1" }, { "start_pos": 1550, "end_pos": 1550, "kinase_uniprot_canonical_ac": "P46962-1", "kinase_gene_name": "CTK2", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P04050", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P04050" }, { "database": "PubMed", "id": "10594013", "url": "https://pubmed.ncbi.nlm.nih.gov/10594013" }, { "database": "PubMed", "id": "11018013", "url": "https://pubmed.ncbi.nlm.nih.gov/11018013" }, { "database": "PubMed", "id": "11751637", "url": "https://pubmed.ncbi.nlm.nih.gov/11751637" }, { "database": "PubMed", "id": "12972617", "url": "https://pubmed.ncbi.nlm.nih.gov/12972617" }, { "database": "PubMed", "id": "20818391", "url": "https://pubmed.ncbi.nlm.nih.gov/20818391" }, { "database": "PubMed", "id": "9237170", "url": "https://pubmed.ncbi.nlm.nih.gov/9237170" } ], "site_lbl": "Ser1550", "uniprot_canonical_ac": "P04050-1" }, { "start_pos": 1550, "end_pos": 1550, "kinase_uniprot_canonical_ac": "Q03957-1", "kinase_gene_name": "CTK1", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P04050", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P04050" }, { "database": "PubMed", "id": "10594013", "url": "https://pubmed.ncbi.nlm.nih.gov/10594013" }, { "database": "PubMed", "id": "11018013", "url": "https://pubmed.ncbi.nlm.nih.gov/11018013" }, { "database": "PubMed", "id": "11751637", "url": "https://pubmed.ncbi.nlm.nih.gov/11751637" }, { "database": "PubMed", "id": "12972617", "url": "https://pubmed.ncbi.nlm.nih.gov/12972617" }, { "database": "PubMed", "id": "20818391", "url": "https://pubmed.ncbi.nlm.nih.gov/20818391" }, { "database": "PubMed", "id": "9237170", "url": "https://pubmed.ncbi.nlm.nih.gov/9237170" } ], "site_lbl": "Ser1550", "uniprot_canonical_ac": "P04050-1" }, { "start_pos": 1557, "end_pos": 1557, "kinase_uniprot_canonical_ac": "P46962-1", "kinase_gene_name": "CTK2", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P04050", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P04050" }, { "database": "PubMed", "id": "10594013", "url": "https://pubmed.ncbi.nlm.nih.gov/10594013" }, { "database": "PubMed", "id": "11018013", "url": "https://pubmed.ncbi.nlm.nih.gov/11018013" }, { "database": "PubMed", "id": "11751637", "url": "https://pubmed.ncbi.nlm.nih.gov/11751637" }, { "database": "PubMed", "id": "12972617", "url": "https://pubmed.ncbi.nlm.nih.gov/12972617" }, { "database": "PubMed", "id": "20818391", "url": "https://pubmed.ncbi.nlm.nih.gov/20818391" }, { "database": "PubMed", "id": "9237170", "url": "https://pubmed.ncbi.nlm.nih.gov/9237170" } ], "site_lbl": "Ser1557", "uniprot_canonical_ac": "P04050-1" }, { "start_pos": 1557, "end_pos": 1557, "kinase_uniprot_canonical_ac": "Q03957-1", "kinase_gene_name": "CTK1", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P04050", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P04050" }, { "database": "PubMed", "id": "10594013", "url": "https://pubmed.ncbi.nlm.nih.gov/10594013" }, { "database": "PubMed", "id": "11018013", "url": "https://pubmed.ncbi.nlm.nih.gov/11018013" }, { "database": "PubMed", "id": "11751637", "url": "https://pubmed.ncbi.nlm.nih.gov/11751637" }, { "database": "PubMed", "id": "12972617", "url": "https://pubmed.ncbi.nlm.nih.gov/12972617" }, { "database": "PubMed", "id": "20818391", "url": "https://pubmed.ncbi.nlm.nih.gov/20818391" }, { "database": "PubMed", "id": "9237170", "url": "https://pubmed.ncbi.nlm.nih.gov/9237170" } ], "site_lbl": "Ser1557", "uniprot_canonical_ac": "P04050-1" }, { "start_pos": 1564, "end_pos": 1564, "kinase_uniprot_canonical_ac": "P46962-1", "kinase_gene_name": "CTK2", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P04050", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P04050" }, { "database": "PubMed", "id": "10594013", "url": "https://pubmed.ncbi.nlm.nih.gov/10594013" }, { "database": "PubMed", "id": "11018013", "url": "https://pubmed.ncbi.nlm.nih.gov/11018013" }, { "database": "PubMed", "id": "11751637", "url": "https://pubmed.ncbi.nlm.nih.gov/11751637" }, { "database": "PubMed", "id": "12972617", "url": "https://pubmed.ncbi.nlm.nih.gov/12972617" }, { "database": "PubMed", "id": "20818391", "url": "https://pubmed.ncbi.nlm.nih.gov/20818391" }, { "database": "PubMed", "id": "9237170", "url": "https://pubmed.ncbi.nlm.nih.gov/9237170" } ], "site_lbl": "Ser1564", "uniprot_canonical_ac": "P04050-1" }, { "start_pos": 1564, "end_pos": 1564, "kinase_uniprot_canonical_ac": "Q03957-1", "kinase_gene_name": "CTK1", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P04050", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P04050" }, { "database": "PubMed", "id": "10594013", "url": "https://pubmed.ncbi.nlm.nih.gov/10594013" }, { "database": "PubMed", "id": "11018013", "url": "https://pubmed.ncbi.nlm.nih.gov/11018013" }, { "database": "PubMed", "id": "11751637", "url": "https://pubmed.ncbi.nlm.nih.gov/11751637" }, { "database": "PubMed", "id": "12972617", "url": "https://pubmed.ncbi.nlm.nih.gov/12972617" }, { "database": "PubMed", "id": "20818391", "url": "https://pubmed.ncbi.nlm.nih.gov/20818391" }, { "database": "PubMed", "id": "9237170", "url": "https://pubmed.ncbi.nlm.nih.gov/9237170" } ], "site_lbl": "Ser1564", "uniprot_canonical_ac": "P04050-1" }, { "start_pos": 1571, "end_pos": 1571, "kinase_uniprot_canonical_ac": "P46962-1", "kinase_gene_name": "CTK2", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P04050", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P04050" }, { "database": "PubMed", "id": "10594013", "url": "https://pubmed.ncbi.nlm.nih.gov/10594013" }, { "database": "PubMed", "id": "11018013", "url": "https://pubmed.ncbi.nlm.nih.gov/11018013" }, { "database": "PubMed", "id": "11751637", "url": "https://pubmed.ncbi.nlm.nih.gov/11751637" }, { "database": "PubMed", "id": "12972617", "url": "https://pubmed.ncbi.nlm.nih.gov/12972617" }, { "database": "PubMed", "id": "20818391", "url": "https://pubmed.ncbi.nlm.nih.gov/20818391" }, { "database": "PubMed", "id": "9237170", "url": "https://pubmed.ncbi.nlm.nih.gov/9237170" } ], "site_lbl": "Ser1571", "uniprot_canonical_ac": "P04050-1" }, { "start_pos": 1571, "end_pos": 1571, "kinase_uniprot_canonical_ac": "Q03957-1", "kinase_gene_name": "CTK1", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P04050", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P04050" }, { "database": "PubMed", "id": "10594013", "url": "https://pubmed.ncbi.nlm.nih.gov/10594013" }, { "database": "PubMed", "id": "11018013", "url": "https://pubmed.ncbi.nlm.nih.gov/11018013" }, { "database": "PubMed", "id": "11751637", "url": "https://pubmed.ncbi.nlm.nih.gov/11751637" }, { "database": "PubMed", "id": "12972617", "url": "https://pubmed.ncbi.nlm.nih.gov/12972617" }, { "database": "PubMed", "id": "20818391", "url": "https://pubmed.ncbi.nlm.nih.gov/20818391" }, { "database": "PubMed", "id": "9237170", "url": "https://pubmed.ncbi.nlm.nih.gov/9237170" } ], "site_lbl": "Ser1571", "uniprot_canonical_ac": "P04050-1" }, { "start_pos": 1578, "end_pos": 1578, "kinase_uniprot_canonical_ac": "P46962-1", "kinase_gene_name": "CTK2", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P04050", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P04050" }, { "database": "PubMed", "id": "10594013", "url": "https://pubmed.ncbi.nlm.nih.gov/10594013" }, { "database": "PubMed", "id": "11018013", "url": "https://pubmed.ncbi.nlm.nih.gov/11018013" }, { "database": "PubMed", "id": "11751637", "url": "https://pubmed.ncbi.nlm.nih.gov/11751637" }, { "database": "PubMed", "id": "12972617", "url": "https://pubmed.ncbi.nlm.nih.gov/12972617" }, { "database": "PubMed", "id": "20818391", "url": "https://pubmed.ncbi.nlm.nih.gov/20818391" }, { "database": "PubMed", "id": "9237170", "url": "https://pubmed.ncbi.nlm.nih.gov/9237170" } ], "site_lbl": "Ser1578", "uniprot_canonical_ac": "P04050-1" }, { "start_pos": 1578, "end_pos": 1578, "kinase_uniprot_canonical_ac": "Q03957-1", "kinase_gene_name": "CTK1", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P04050", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P04050" }, { "database": "PubMed", "id": "10594013", "url": "https://pubmed.ncbi.nlm.nih.gov/10594013" }, { "database": "PubMed", "id": "11018013", "url": "https://pubmed.ncbi.nlm.nih.gov/11018013" }, { "database": "PubMed", "id": "11751637", "url": "https://pubmed.ncbi.nlm.nih.gov/11751637" }, { "database": "PubMed", "id": "12972617", "url": "https://pubmed.ncbi.nlm.nih.gov/12972617" }, { "database": "PubMed", "id": "20818391", "url": "https://pubmed.ncbi.nlm.nih.gov/20818391" }, { "database": "PubMed", "id": "9237170", "url": "https://pubmed.ncbi.nlm.nih.gov/9237170" } ], "site_lbl": "Ser1578", "uniprot_canonical_ac": "P04050-1" }, { "start_pos": 1585, "end_pos": 1585, "kinase_uniprot_canonical_ac": "P46962-1", "kinase_gene_name": "CTK2", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P04050", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P04050" }, { "database": "PubMed", "id": "10594013", "url": "https://pubmed.ncbi.nlm.nih.gov/10594013" }, { "database": "PubMed", "id": "11018013", "url": "https://pubmed.ncbi.nlm.nih.gov/11018013" }, { "database": "PubMed", "id": "11751637", "url": "https://pubmed.ncbi.nlm.nih.gov/11751637" }, { "database": "PubMed", "id": "12972617", "url": "https://pubmed.ncbi.nlm.nih.gov/12972617" }, { "database": "PubMed", "id": "20818391", "url": "https://pubmed.ncbi.nlm.nih.gov/20818391" }, { "database": "PubMed", "id": "9237170", "url": "https://pubmed.ncbi.nlm.nih.gov/9237170" } ], "site_lbl": "Ser1585", "uniprot_canonical_ac": "P04050-1" }, { "start_pos": 1585, "end_pos": 1585, "kinase_uniprot_canonical_ac": "Q03957-1", "kinase_gene_name": "CTK1", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P04050", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P04050" }, { "database": "PubMed", "id": "10594013", "url": "https://pubmed.ncbi.nlm.nih.gov/10594013" }, { "database": "PubMed", "id": "11018013", "url": "https://pubmed.ncbi.nlm.nih.gov/11018013" }, { "database": "PubMed", "id": "11751637", "url": "https://pubmed.ncbi.nlm.nih.gov/11751637" }, { "database": "PubMed", "id": "12972617", "url": "https://pubmed.ncbi.nlm.nih.gov/12972617" }, { "database": "PubMed", "id": "20818391", "url": "https://pubmed.ncbi.nlm.nih.gov/20818391" }, { "database": "PubMed", "id": "9237170", "url": "https://pubmed.ncbi.nlm.nih.gov/9237170" } ], "site_lbl": "Ser1585", "uniprot_canonical_ac": "P04050-1" }, { "start_pos": 1592, "end_pos": 1592, "kinase_uniprot_canonical_ac": "P46962-1", "kinase_gene_name": "CTK2", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P04050", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P04050" }, { "database": "PubMed", "id": "10594013", "url": "https://pubmed.ncbi.nlm.nih.gov/10594013" }, { "database": "PubMed", "id": "11018013", "url": "https://pubmed.ncbi.nlm.nih.gov/11018013" }, { "database": "PubMed", "id": "11751637", "url": "https://pubmed.ncbi.nlm.nih.gov/11751637" }, { "database": "PubMed", "id": "12972617", "url": "https://pubmed.ncbi.nlm.nih.gov/12972617" }, { "database": "PubMed", "id": "20818391", "url": "https://pubmed.ncbi.nlm.nih.gov/20818391" }, { "database": "PubMed", "id": "9237170", "url": "https://pubmed.ncbi.nlm.nih.gov/9237170" } ], "site_lbl": "Ser1592", "uniprot_canonical_ac": "P04050-1" }, { "start_pos": 1592, "end_pos": 1592, "kinase_uniprot_canonical_ac": "Q03957-1", "kinase_gene_name": "CTK1", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P04050", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P04050" }, { "database": "PubMed", "id": "10594013", "url": "https://pubmed.ncbi.nlm.nih.gov/10594013" }, { "database": "PubMed", "id": "11018013", "url": "https://pubmed.ncbi.nlm.nih.gov/11018013" }, { "database": "PubMed", "id": "11751637", "url": "https://pubmed.ncbi.nlm.nih.gov/11751637" }, { "database": "PubMed", "id": "12972617", "url": "https://pubmed.ncbi.nlm.nih.gov/12972617" }, { "database": "PubMed", "id": "20818391", "url": "https://pubmed.ncbi.nlm.nih.gov/20818391" }, { "database": "PubMed", "id": "9237170", "url": "https://pubmed.ncbi.nlm.nih.gov/9237170" } ], "site_lbl": "Ser1592", "uniprot_canonical_ac": "P04050-1" }, { "start_pos": 1599, "end_pos": 1599, "kinase_uniprot_canonical_ac": "P46962-1", "kinase_gene_name": "CTK2", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P04050", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P04050" }, { "database": "PubMed", "id": "10594013", "url": "https://pubmed.ncbi.nlm.nih.gov/10594013" }, { "database": "PubMed", "id": "11018013", "url": "https://pubmed.ncbi.nlm.nih.gov/11018013" }, { "database": "PubMed", "id": "11751637", "url": "https://pubmed.ncbi.nlm.nih.gov/11751637" }, { "database": "PubMed", "id": "12972617", "url": "https://pubmed.ncbi.nlm.nih.gov/12972617" }, { "database": "PubMed", "id": "20818391", "url": "https://pubmed.ncbi.nlm.nih.gov/20818391" }, { "database": "PubMed", "id": "9237170", "url": "https://pubmed.ncbi.nlm.nih.gov/9237170" } ], "site_lbl": "Ser1599", "uniprot_canonical_ac": "P04050-1" }, { "start_pos": 1599, "end_pos": 1599, "kinase_uniprot_canonical_ac": "Q03957-1", "kinase_gene_name": "CTK1", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P04050", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P04050" }, { "database": "PubMed", "id": "10594013", "url": "https://pubmed.ncbi.nlm.nih.gov/10594013" }, { "database": "PubMed", "id": "11018013", "url": "https://pubmed.ncbi.nlm.nih.gov/11018013" }, { "database": "PubMed", "id": "11751637", "url": "https://pubmed.ncbi.nlm.nih.gov/11751637" }, { "database": "PubMed", "id": "12972617", "url": "https://pubmed.ncbi.nlm.nih.gov/12972617" }, { "database": "PubMed", "id": "20818391", "url": "https://pubmed.ncbi.nlm.nih.gov/20818391" }, { "database": "PubMed", "id": "9237170", "url": "https://pubmed.ncbi.nlm.nih.gov/9237170" } ], "site_lbl": "Ser1599", "uniprot_canonical_ac": "P04050-1" }, { "start_pos": 1606, "end_pos": 1606, "kinase_uniprot_canonical_ac": "P46962-1", "kinase_gene_name": "CTK2", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P04050", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P04050" }, { "database": "PubMed", "id": "10594013", "url": "https://pubmed.ncbi.nlm.nih.gov/10594013" }, { "database": "PubMed", "id": "11018013", "url": "https://pubmed.ncbi.nlm.nih.gov/11018013" }, { "database": "PubMed", "id": "11751637", "url": "https://pubmed.ncbi.nlm.nih.gov/11751637" }, { "database": "PubMed", "id": "12972617", "url": "https://pubmed.ncbi.nlm.nih.gov/12972617" }, { "database": "PubMed", "id": "20818391", "url": "https://pubmed.ncbi.nlm.nih.gov/20818391" }, { "database": "PubMed", "id": "9237170", "url": "https://pubmed.ncbi.nlm.nih.gov/9237170" } ], "site_lbl": "Ser1606", "uniprot_canonical_ac": "P04050-1" }, { "start_pos": 1606, "end_pos": 1606, "kinase_uniprot_canonical_ac": "Q03957-1", "kinase_gene_name": "CTK1", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P04050", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P04050" }, { "database": "PubMed", "id": "10594013", "url": "https://pubmed.ncbi.nlm.nih.gov/10594013" }, { "database": "PubMed", "id": "11018013", "url": "https://pubmed.ncbi.nlm.nih.gov/11018013" }, { "database": "PubMed", "id": "11751637", "url": "https://pubmed.ncbi.nlm.nih.gov/11751637" }, { "database": "PubMed", "id": "12972617", "url": "https://pubmed.ncbi.nlm.nih.gov/12972617" }, { "database": "PubMed", "id": "20818391", "url": "https://pubmed.ncbi.nlm.nih.gov/20818391" }, { "database": "PubMed", "id": "9237170", "url": "https://pubmed.ncbi.nlm.nih.gov/9237170" } ], "site_lbl": "Ser1606", "uniprot_canonical_ac": "P04050-1" }, { "start_pos": 1613, "end_pos": 1613, "kinase_uniprot_canonical_ac": "P46962-1", "kinase_gene_name": "CTK2", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P04050", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P04050" }, { "database": "PubMed", "id": "10594013", "url": "https://pubmed.ncbi.nlm.nih.gov/10594013" }, { "database": "PubMed", "id": "11018013", "url": "https://pubmed.ncbi.nlm.nih.gov/11018013" }, { "database": "PubMed", "id": "11751637", "url": "https://pubmed.ncbi.nlm.nih.gov/11751637" }, { "database": "PubMed", "id": "12972617", "url": "https://pubmed.ncbi.nlm.nih.gov/12972617" }, { "database": "PubMed", "id": "20818391", "url": "https://pubmed.ncbi.nlm.nih.gov/20818391" }, { "database": "PubMed", "id": "9237170", "url": "https://pubmed.ncbi.nlm.nih.gov/9237170" } ], "site_lbl": "Ser1613", "uniprot_canonical_ac": "P04050-1" }, { "start_pos": 1613, "end_pos": 1613, "kinase_uniprot_canonical_ac": "Q03957-1", "kinase_gene_name": "CTK1", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P04050", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P04050" }, { "database": "PubMed", "id": "10594013", "url": "https://pubmed.ncbi.nlm.nih.gov/10594013" }, { "database": "PubMed", "id": "11018013", "url": "https://pubmed.ncbi.nlm.nih.gov/11018013" }, { "database": "PubMed", "id": "11751637", "url": "https://pubmed.ncbi.nlm.nih.gov/11751637" }, { "database": "PubMed", "id": "12972617", "url": "https://pubmed.ncbi.nlm.nih.gov/12972617" }, { "database": "PubMed", "id": "20818391", "url": "https://pubmed.ncbi.nlm.nih.gov/20818391" }, { "database": "PubMed", "id": "9237170", "url": "https://pubmed.ncbi.nlm.nih.gov/9237170" } ], "site_lbl": "Ser1613", "uniprot_canonical_ac": "P04050-1" }, { "start_pos": 1620, "end_pos": 1620, "kinase_uniprot_canonical_ac": "P46962-1", "kinase_gene_name": "CTK2", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P04050", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P04050" }, { "database": "PubMed", "id": "10594013", "url": "https://pubmed.ncbi.nlm.nih.gov/10594013" }, { "database": "PubMed", "id": "11018013", "url": "https://pubmed.ncbi.nlm.nih.gov/11018013" }, { "database": "PubMed", "id": "11751637", "url": "https://pubmed.ncbi.nlm.nih.gov/11751637" }, { "database": "PubMed", "id": "12972617", "url": "https://pubmed.ncbi.nlm.nih.gov/12972617" }, { "database": "PubMed", "id": "20818391", "url": "https://pubmed.ncbi.nlm.nih.gov/20818391" }, { "database": "PubMed", "id": "9237170", "url": "https://pubmed.ncbi.nlm.nih.gov/9237170" } ], "site_lbl": "Ser1620", "uniprot_canonical_ac": "P04050-1" }, { "start_pos": 1620, "end_pos": 1620, "kinase_uniprot_canonical_ac": "Q03957-1", "kinase_gene_name": "CTK1", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P04050", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P04050" }, { "database": "PubMed", "id": "10594013", "url": "https://pubmed.ncbi.nlm.nih.gov/10594013" }, { "database": "PubMed", "id": "11018013", "url": "https://pubmed.ncbi.nlm.nih.gov/11018013" }, { "database": "PubMed", "id": "11751637", "url": "https://pubmed.ncbi.nlm.nih.gov/11751637" }, { "database": "PubMed", "id": "12972617", "url": "https://pubmed.ncbi.nlm.nih.gov/12972617" }, { "database": "PubMed", "id": "20818391", "url": "https://pubmed.ncbi.nlm.nih.gov/20818391" }, { "database": "PubMed", "id": "9237170", "url": "https://pubmed.ncbi.nlm.nih.gov/9237170" } ], "site_lbl": "Ser1620", "uniprot_canonical_ac": "P04050-1" }, { "start_pos": 1627, "end_pos": 1627, "kinase_uniprot_canonical_ac": "P46962-1", "kinase_gene_name": "CTK2", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P04050", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P04050" }, { "database": "PubMed", "id": "10594013", "url": "https://pubmed.ncbi.nlm.nih.gov/10594013" }, { "database": "PubMed", "id": "11018013", "url": "https://pubmed.ncbi.nlm.nih.gov/11018013" }, { "database": "PubMed", "id": "11751637", "url": "https://pubmed.ncbi.nlm.nih.gov/11751637" }, { "database": "PubMed", "id": "12972617", "url": "https://pubmed.ncbi.nlm.nih.gov/12972617" }, { "database": "PubMed", "id": "20818391", "url": "https://pubmed.ncbi.nlm.nih.gov/20818391" }, { "database": "PubMed", "id": "9237170", "url": "https://pubmed.ncbi.nlm.nih.gov/9237170" } ], "site_lbl": "Ser1627", "uniprot_canonical_ac": "P04050-1" }, { "start_pos": 1627, "end_pos": 1627, "kinase_uniprot_canonical_ac": "Q03957-1", "kinase_gene_name": "CTK1", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P04050", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P04050" }, { "database": "PubMed", "id": "10594013", "url": "https://pubmed.ncbi.nlm.nih.gov/10594013" }, { "database": "PubMed", "id": "11018013", "url": "https://pubmed.ncbi.nlm.nih.gov/11018013" }, { "database": "PubMed", "id": "11751637", "url": "https://pubmed.ncbi.nlm.nih.gov/11751637" }, { "database": "PubMed", "id": "12972617", "url": "https://pubmed.ncbi.nlm.nih.gov/12972617" }, { "database": "PubMed", "id": "20818391", "url": "https://pubmed.ncbi.nlm.nih.gov/20818391" }, { "database": "PubMed", "id": "9237170", "url": "https://pubmed.ncbi.nlm.nih.gov/9237170" } ], "site_lbl": "Ser1627", "uniprot_canonical_ac": "P04050-1" }, { "start_pos": 1634, "end_pos": 1634, "kinase_uniprot_canonical_ac": "P46962-1", "kinase_gene_name": "CTK2", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P04050", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P04050" }, { "database": "PubMed", "id": "10594013", "url": "https://pubmed.ncbi.nlm.nih.gov/10594013" }, { "database": "PubMed", "id": "11018013", "url": "https://pubmed.ncbi.nlm.nih.gov/11018013" }, { "database": "PubMed", "id": "11751637", "url": "https://pubmed.ncbi.nlm.nih.gov/11751637" }, { "database": "PubMed", "id": "12972617", "url": "https://pubmed.ncbi.nlm.nih.gov/12972617" }, { "database": "PubMed", "id": "20818391", "url": "https://pubmed.ncbi.nlm.nih.gov/20818391" }, { "database": "PubMed", "id": "9237170", "url": "https://pubmed.ncbi.nlm.nih.gov/9237170" } ], "site_lbl": "Ser1634", "uniprot_canonical_ac": "P04050-1" }, { "start_pos": 1634, "end_pos": 1634, "kinase_uniprot_canonical_ac": "Q03957-1", "kinase_gene_name": "CTK1", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P04050", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P04050" }, { "database": "PubMed", "id": "10594013", "url": "https://pubmed.ncbi.nlm.nih.gov/10594013" }, { "database": "PubMed", "id": "11018013", "url": "https://pubmed.ncbi.nlm.nih.gov/11018013" }, { "database": "PubMed", "id": "11751637", "url": "https://pubmed.ncbi.nlm.nih.gov/11751637" }, { "database": "PubMed", "id": "12972617", "url": "https://pubmed.ncbi.nlm.nih.gov/12972617" }, { "database": "PubMed", "id": "20818391", "url": "https://pubmed.ncbi.nlm.nih.gov/20818391" }, { "database": "PubMed", "id": "9237170", "url": "https://pubmed.ncbi.nlm.nih.gov/9237170" } ], "site_lbl": "Ser1634", "uniprot_canonical_ac": "P04050-1" }, { "start_pos": 1641, "end_pos": 1641, "kinase_uniprot_canonical_ac": "P46962-1", "kinase_gene_name": "CTK2", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P04050", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P04050" }, { "database": "PubMed", "id": "10594013", "url": "https://pubmed.ncbi.nlm.nih.gov/10594013" }, { "database": "PubMed", "id": "11018013", "url": "https://pubmed.ncbi.nlm.nih.gov/11018013" }, { "database": "PubMed", "id": "11751637", "url": "https://pubmed.ncbi.nlm.nih.gov/11751637" }, { "database": "PubMed", "id": "12972617", "url": "https://pubmed.ncbi.nlm.nih.gov/12972617" }, { "database": "PubMed", "id": "20818391", "url": "https://pubmed.ncbi.nlm.nih.gov/20818391" }, { "database": "PubMed", "id": "9237170", "url": "https://pubmed.ncbi.nlm.nih.gov/9237170" } ], "site_lbl": "Ser1641", "uniprot_canonical_ac": "P04050-1" }, { "start_pos": 1641, "end_pos": 1641, "kinase_uniprot_canonical_ac": "Q03957-1", "kinase_gene_name": "CTK1", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P04050", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P04050" }, { "database": "PubMed", "id": "10594013", "url": "https://pubmed.ncbi.nlm.nih.gov/10594013" }, { "database": "PubMed", "id": "11018013", "url": "https://pubmed.ncbi.nlm.nih.gov/11018013" }, { "database": "PubMed", "id": "11751637", "url": "https://pubmed.ncbi.nlm.nih.gov/11751637" }, { "database": "PubMed", "id": "12972617", "url": "https://pubmed.ncbi.nlm.nih.gov/12972617" }, { "database": "PubMed", "id": "20818391", "url": "https://pubmed.ncbi.nlm.nih.gov/20818391" }, { "database": "PubMed", "id": "9237170", "url": "https://pubmed.ncbi.nlm.nih.gov/9237170" } ], "site_lbl": "Ser1641", "uniprot_canonical_ac": "P04050-1" }, { "start_pos": 1648, "end_pos": 1648, "kinase_uniprot_canonical_ac": "P46962-1", "kinase_gene_name": "CTK2", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P04050", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P04050" }, { "database": "PubMed", "id": "10594013", "url": "https://pubmed.ncbi.nlm.nih.gov/10594013" }, { "database": "PubMed", "id": "11018013", "url": "https://pubmed.ncbi.nlm.nih.gov/11018013" }, { "database": "PubMed", "id": "11751637", "url": "https://pubmed.ncbi.nlm.nih.gov/11751637" }, { "database": "PubMed", "id": "12972617", "url": "https://pubmed.ncbi.nlm.nih.gov/12972617" }, { "database": "PubMed", "id": "20818391", "url": "https://pubmed.ncbi.nlm.nih.gov/20818391" }, { "database": "PubMed", "id": "9237170", "url": "https://pubmed.ncbi.nlm.nih.gov/9237170" } ], "site_lbl": "Ser1648", "uniprot_canonical_ac": "P04050-1" }, { "start_pos": 1648, "end_pos": 1648, "kinase_uniprot_canonical_ac": "Q03957-1", "kinase_gene_name": "CTK1", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P04050", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P04050" }, { "database": "PubMed", "id": "10594013", "url": "https://pubmed.ncbi.nlm.nih.gov/10594013" }, { "database": "PubMed", "id": "11018013", "url": "https://pubmed.ncbi.nlm.nih.gov/11018013" }, { "database": "PubMed", "id": "11751637", "url": "https://pubmed.ncbi.nlm.nih.gov/11751637" }, { "database": "PubMed", "id": "12972617", "url": "https://pubmed.ncbi.nlm.nih.gov/12972617" }, { "database": "PubMed", "id": "20818391", "url": "https://pubmed.ncbi.nlm.nih.gov/20818391" }, { "database": "PubMed", "id": "9237170", "url": "https://pubmed.ncbi.nlm.nih.gov/9237170" } ], "site_lbl": "Ser1648", "uniprot_canonical_ac": "P04050-1" }, { "start_pos": 1655, "end_pos": 1655, "kinase_uniprot_canonical_ac": "P46962-1", "kinase_gene_name": "CTK2", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P04050", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P04050" }, { "database": "PubMed", "id": "10594013", "url": "https://pubmed.ncbi.nlm.nih.gov/10594013" }, { "database": "PubMed", "id": "11018013", "url": "https://pubmed.ncbi.nlm.nih.gov/11018013" }, { "database": "PubMed", "id": "11751637", "url": "https://pubmed.ncbi.nlm.nih.gov/11751637" }, { "database": "PubMed", "id": "12972617", "url": "https://pubmed.ncbi.nlm.nih.gov/12972617" }, { "database": "PubMed", "id": "20818391", "url": "https://pubmed.ncbi.nlm.nih.gov/20818391" }, { "database": "PubMed", "id": "9237170", "url": "https://pubmed.ncbi.nlm.nih.gov/9237170" } ], "site_lbl": "Ser1655", "uniprot_canonical_ac": "P04050-1" }, { "start_pos": 1655, "end_pos": 1655, "kinase_uniprot_canonical_ac": "Q03957-1", "kinase_gene_name": "CTK1", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P04050", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P04050" }, { "database": "PubMed", "id": "10594013", "url": "https://pubmed.ncbi.nlm.nih.gov/10594013" }, { "database": "PubMed", "id": "11018013", "url": "https://pubmed.ncbi.nlm.nih.gov/11018013" }, { "database": "PubMed", "id": "11751637", "url": "https://pubmed.ncbi.nlm.nih.gov/11751637" }, { "database": "PubMed", "id": "12972617", "url": "https://pubmed.ncbi.nlm.nih.gov/12972617" }, { "database": "PubMed", "id": "20818391", "url": "https://pubmed.ncbi.nlm.nih.gov/20818391" }, { "database": "PubMed", "id": "9237170", "url": "https://pubmed.ncbi.nlm.nih.gov/9237170" } ], "site_lbl": "Ser1655", "uniprot_canonical_ac": "P04050-1" }, { "start_pos": 1662, "end_pos": 1662, "kinase_uniprot_canonical_ac": "P46962-1", "kinase_gene_name": "CTK2", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P04050", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P04050" }, { "database": "PubMed", "id": "10594013", "url": "https://pubmed.ncbi.nlm.nih.gov/10594013" }, { "database": "PubMed", "id": "11018013", "url": "https://pubmed.ncbi.nlm.nih.gov/11018013" }, { "database": "PubMed", "id": "11751637", "url": "https://pubmed.ncbi.nlm.nih.gov/11751637" }, { "database": "PubMed", "id": "12972617", "url": "https://pubmed.ncbi.nlm.nih.gov/12972617" }, { "database": "PubMed", "id": "20818391", "url": "https://pubmed.ncbi.nlm.nih.gov/20818391" }, { "database": "PubMed", "id": "9237170", "url": "https://pubmed.ncbi.nlm.nih.gov/9237170" } ], "site_lbl": "Ser1662", "uniprot_canonical_ac": "P04050-1" }, { "start_pos": 1662, "end_pos": 1662, "kinase_uniprot_canonical_ac": "Q03957-1", "kinase_gene_name": "CTK1", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P04050", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P04050" }, { "database": "PubMed", "id": "10594013", "url": "https://pubmed.ncbi.nlm.nih.gov/10594013" }, { "database": "PubMed", "id": "11018013", "url": "https://pubmed.ncbi.nlm.nih.gov/11018013" }, { "database": "PubMed", "id": "11751637", "url": "https://pubmed.ncbi.nlm.nih.gov/11751637" }, { "database": "PubMed", "id": "12972617", "url": "https://pubmed.ncbi.nlm.nih.gov/12972617" }, { "database": "PubMed", "id": "20818391", "url": "https://pubmed.ncbi.nlm.nih.gov/20818391" }, { "database": "PubMed", "id": "9237170", "url": "https://pubmed.ncbi.nlm.nih.gov/9237170" } ], "site_lbl": "Ser1662", "uniprot_canonical_ac": "P04050-1" }, { "start_pos": 1669, "end_pos": 1669, "kinase_uniprot_canonical_ac": "P46962-1", "kinase_gene_name": "CTK2", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P04050", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P04050" }, { "database": "PubMed", "id": "10594013", "url": "https://pubmed.ncbi.nlm.nih.gov/10594013" }, { "database": "PubMed", "id": "11018013", "url": "https://pubmed.ncbi.nlm.nih.gov/11018013" }, { "database": "PubMed", "id": "11751637", "url": "https://pubmed.ncbi.nlm.nih.gov/11751637" }, { "database": "PubMed", "id": "12972617", "url": "https://pubmed.ncbi.nlm.nih.gov/12972617" }, { "database": "PubMed", "id": "20818391", "url": "https://pubmed.ncbi.nlm.nih.gov/20818391" }, { "database": "PubMed", "id": "9237170", "url": "https://pubmed.ncbi.nlm.nih.gov/9237170" } ], "site_lbl": "Ser1669", "uniprot_canonical_ac": "P04050-1" }, { "start_pos": 1669, "end_pos": 1669, "kinase_uniprot_canonical_ac": "Q03957-1", "kinase_gene_name": "CTK1", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P04050", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P04050" }, { "database": "PubMed", "id": "10594013", "url": "https://pubmed.ncbi.nlm.nih.gov/10594013" }, { "database": "PubMed", "id": "11018013", "url": "https://pubmed.ncbi.nlm.nih.gov/11018013" }, { "database": "PubMed", "id": "11751637", "url": "https://pubmed.ncbi.nlm.nih.gov/11751637" }, { "database": "PubMed", "id": "12972617", "url": "https://pubmed.ncbi.nlm.nih.gov/12972617" }, { "database": "PubMed", "id": "20818391", "url": "https://pubmed.ncbi.nlm.nih.gov/20818391" }, { "database": "PubMed", "id": "9237170", "url": "https://pubmed.ncbi.nlm.nih.gov/9237170" } ], "site_lbl": "Ser1669", "uniprot_canonical_ac": "P04050-1" }, { "start_pos": 1676, "end_pos": 1676, "kinase_uniprot_canonical_ac": "P46962-1", "kinase_gene_name": "CTK2", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P04050", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P04050" }, { "database": "PubMed", "id": "10594013", "url": "https://pubmed.ncbi.nlm.nih.gov/10594013" }, { "database": "PubMed", "id": "11018013", "url": "https://pubmed.ncbi.nlm.nih.gov/11018013" }, { "database": "PubMed", "id": "11751637", "url": "https://pubmed.ncbi.nlm.nih.gov/11751637" }, { "database": "PubMed", "id": "12972617", "url": "https://pubmed.ncbi.nlm.nih.gov/12972617" }, { "database": "PubMed", "id": "20818391", "url": "https://pubmed.ncbi.nlm.nih.gov/20818391" }, { "database": "PubMed", "id": "9237170", "url": "https://pubmed.ncbi.nlm.nih.gov/9237170" } ], "site_lbl": "Ser1676", "uniprot_canonical_ac": "P04050-1" }, { "start_pos": 1676, "end_pos": 1676, "kinase_uniprot_canonical_ac": "Q03957-1", "kinase_gene_name": "CTK1", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P04050", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P04050" }, { "database": "PubMed", "id": "10594013", "url": "https://pubmed.ncbi.nlm.nih.gov/10594013" }, { "database": "PubMed", "id": "11018013", "url": "https://pubmed.ncbi.nlm.nih.gov/11018013" }, { "database": "PubMed", "id": "11751637", "url": "https://pubmed.ncbi.nlm.nih.gov/11751637" }, { "database": "PubMed", "id": "12972617", "url": "https://pubmed.ncbi.nlm.nih.gov/12972617" }, { "database": "PubMed", "id": "20818391", "url": "https://pubmed.ncbi.nlm.nih.gov/20818391" }, { "database": "PubMed", "id": "9237170", "url": "https://pubmed.ncbi.nlm.nih.gov/9237170" } ], "site_lbl": "Ser1676", "uniprot_canonical_ac": "P04050-1" }, { "start_pos": 1683, "end_pos": 1683, "kinase_uniprot_canonical_ac": "P46962-1", "kinase_gene_name": "CTK2", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P04050", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P04050" }, { "database": "PubMed", "id": "10594013", "url": "https://pubmed.ncbi.nlm.nih.gov/10594013" }, { "database": "PubMed", "id": "11018013", "url": "https://pubmed.ncbi.nlm.nih.gov/11018013" }, { "database": "PubMed", "id": "11751637", "url": "https://pubmed.ncbi.nlm.nih.gov/11751637" }, { "database": "PubMed", "id": "12972617", "url": "https://pubmed.ncbi.nlm.nih.gov/12972617" }, { "database": "PubMed", "id": "20818391", "url": "https://pubmed.ncbi.nlm.nih.gov/20818391" }, { "database": "PubMed", "id": "9237170", "url": "https://pubmed.ncbi.nlm.nih.gov/9237170" } ], "site_lbl": "Ser1683", "uniprot_canonical_ac": "P04050-1" }, { "start_pos": 1683, "end_pos": 1683, "kinase_uniprot_canonical_ac": "Q03957-1", "kinase_gene_name": "CTK1", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P04050", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P04050" }, { "database": "PubMed", "id": "10594013", "url": "https://pubmed.ncbi.nlm.nih.gov/10594013" }, { "database": "PubMed", "id": "11018013", "url": "https://pubmed.ncbi.nlm.nih.gov/11018013" }, { "database": "PubMed", "id": "11751637", "url": "https://pubmed.ncbi.nlm.nih.gov/11751637" }, { "database": "PubMed", "id": "12972617", "url": "https://pubmed.ncbi.nlm.nih.gov/12972617" }, { "database": "PubMed", "id": "20818391", "url": "https://pubmed.ncbi.nlm.nih.gov/20818391" }, { "database": "PubMed", "id": "9237170", "url": "https://pubmed.ncbi.nlm.nih.gov/9237170" } ], "site_lbl": "Ser1683", "uniprot_canonical_ac": "P04050-1" }, { "start_pos": 1690, "end_pos": 1690, "kinase_uniprot_canonical_ac": "P46962-1", "kinase_gene_name": "CTK2", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P04050", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P04050" }, { "database": "PubMed", "id": "10594013", "url": "https://pubmed.ncbi.nlm.nih.gov/10594013" }, { "database": "PubMed", "id": "11018013", "url": "https://pubmed.ncbi.nlm.nih.gov/11018013" }, { "database": "PubMed", "id": "11751637", "url": "https://pubmed.ncbi.nlm.nih.gov/11751637" }, { "database": "PubMed", "id": "12972617", "url": "https://pubmed.ncbi.nlm.nih.gov/12972617" }, { "database": "PubMed", "id": "20818391", "url": "https://pubmed.ncbi.nlm.nih.gov/20818391" }, { "database": "PubMed", "id": "9237170", "url": "https://pubmed.ncbi.nlm.nih.gov/9237170" } ], "site_lbl": "Ser1690", "uniprot_canonical_ac": "P04050-1" }, { "start_pos": 1690, "end_pos": 1690, "kinase_uniprot_canonical_ac": "Q03957-1", "kinase_gene_name": "CTK1", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P04050", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P04050" }, { "database": "PubMed", "id": "10594013", "url": "https://pubmed.ncbi.nlm.nih.gov/10594013" }, { "database": "PubMed", "id": "11018013", "url": "https://pubmed.ncbi.nlm.nih.gov/11018013" }, { "database": "PubMed", "id": "11751637", "url": "https://pubmed.ncbi.nlm.nih.gov/11751637" }, { "database": "PubMed", "id": "12972617", "url": "https://pubmed.ncbi.nlm.nih.gov/12972617" }, { "database": "PubMed", "id": "20818391", "url": "https://pubmed.ncbi.nlm.nih.gov/20818391" }, { "database": "PubMed", "id": "9237170", "url": "https://pubmed.ncbi.nlm.nih.gov/9237170" } ], "site_lbl": "Ser1690", "uniprot_canonical_ac": "P04050-1" }, { "start_pos": 1697, "end_pos": 1697, "kinase_uniprot_canonical_ac": "P46962-1", "kinase_gene_name": "CTK2", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P04050", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P04050" }, { "database": "PubMed", "id": "10594013", "url": "https://pubmed.ncbi.nlm.nih.gov/10594013" }, { "database": "PubMed", "id": "11018013", "url": "https://pubmed.ncbi.nlm.nih.gov/11018013" }, { "database": "PubMed", "id": "11751637", "url": "https://pubmed.ncbi.nlm.nih.gov/11751637" }, { "database": "PubMed", "id": "12972617", "url": "https://pubmed.ncbi.nlm.nih.gov/12972617" }, { "database": "PubMed", "id": "20818391", "url": "https://pubmed.ncbi.nlm.nih.gov/20818391" }, { "database": "PubMed", "id": "9237170", "url": "https://pubmed.ncbi.nlm.nih.gov/9237170" } ], "site_lbl": "Ser1697", "uniprot_canonical_ac": "P04050-1" }, { "start_pos": 1697, "end_pos": 1697, "kinase_uniprot_canonical_ac": "Q03957-1", "kinase_gene_name": "CTK1", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P04050", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P04050" }, { "database": "PubMed", "id": "10594013", "url": "https://pubmed.ncbi.nlm.nih.gov/10594013" }, { "database": "PubMed", "id": "11018013", "url": "https://pubmed.ncbi.nlm.nih.gov/11018013" }, { "database": "PubMed", "id": "11751637", "url": "https://pubmed.ncbi.nlm.nih.gov/11751637" }, { "database": "PubMed", "id": "12972617", "url": "https://pubmed.ncbi.nlm.nih.gov/12972617" }, { "database": "PubMed", "id": "20818391", "url": "https://pubmed.ncbi.nlm.nih.gov/20818391" }, { "database": "PubMed", "id": "9237170", "url": "https://pubmed.ncbi.nlm.nih.gov/9237170" } ], "site_lbl": "Ser1697", "uniprot_canonical_ac": "P04050-1" }, { "start_pos": 1704, "end_pos": 1704, "kinase_uniprot_canonical_ac": "P46962-1", "kinase_gene_name": "CTK2", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P04050", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P04050" }, { "database": "PubMed", "id": "10594013", "url": "https://pubmed.ncbi.nlm.nih.gov/10594013" }, { "database": "PubMed", "id": "11018013", "url": "https://pubmed.ncbi.nlm.nih.gov/11018013" }, { "database": "PubMed", "id": "11751637", "url": "https://pubmed.ncbi.nlm.nih.gov/11751637" }, { "database": "PubMed", "id": "12972617", "url": "https://pubmed.ncbi.nlm.nih.gov/12972617" }, { "database": "PubMed", "id": "20818391", "url": "https://pubmed.ncbi.nlm.nih.gov/20818391" }, { "database": "PubMed", "id": "9237170", "url": "https://pubmed.ncbi.nlm.nih.gov/9237170" } ], "site_lbl": "Ser1704", "uniprot_canonical_ac": "P04050-1" }, { "start_pos": 1704, "end_pos": 1704, "kinase_uniprot_canonical_ac": "Q03957-1", "kinase_gene_name": "CTK1", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P04050", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P04050" }, { "database": "PubMed", "id": "10594013", "url": "https://pubmed.ncbi.nlm.nih.gov/10594013" }, { "database": "PubMed", "id": "11018013", "url": "https://pubmed.ncbi.nlm.nih.gov/11018013" }, { "database": "PubMed", "id": "11751637", "url": "https://pubmed.ncbi.nlm.nih.gov/11751637" }, { "database": "PubMed", "id": "12972617", "url": "https://pubmed.ncbi.nlm.nih.gov/12972617" }, { "database": "PubMed", "id": "20818391", "url": "https://pubmed.ncbi.nlm.nih.gov/20818391" }, { "database": "PubMed", "id": "9237170", "url": "https://pubmed.ncbi.nlm.nih.gov/9237170" } ], "site_lbl": "Ser1704", "uniprot_canonical_ac": "P04050-1" }, { "start_pos": 1711, "end_pos": 1711, "kinase_uniprot_canonical_ac": "P46962-1", "kinase_gene_name": "CTK2", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P04050", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P04050" }, { "database": "PubMed", "id": "10594013", "url": "https://pubmed.ncbi.nlm.nih.gov/10594013" }, { "database": "PubMed", "id": "11018013", "url": "https://pubmed.ncbi.nlm.nih.gov/11018013" }, { "database": "PubMed", "id": "11751637", "url": "https://pubmed.ncbi.nlm.nih.gov/11751637" }, { "database": "PubMed", "id": "12972617", "url": "https://pubmed.ncbi.nlm.nih.gov/12972617" }, { "database": "PubMed", "id": "20818391", "url": "https://pubmed.ncbi.nlm.nih.gov/20818391" }, { "database": "PubMed", "id": "9237170", "url": "https://pubmed.ncbi.nlm.nih.gov/9237170" } ], "site_lbl": "Ser1711", "uniprot_canonical_ac": "P04050-1" }, { "start_pos": 1711, "end_pos": 1711, "kinase_uniprot_canonical_ac": "Q03957-1", "kinase_gene_name": "CTK1", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P04050", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P04050" }, { "database": "PubMed", "id": "10594013", "url": "https://pubmed.ncbi.nlm.nih.gov/10594013" }, { "database": "PubMed", "id": "11018013", "url": "https://pubmed.ncbi.nlm.nih.gov/11018013" }, { "database": "PubMed", "id": "11751637", "url": "https://pubmed.ncbi.nlm.nih.gov/11751637" }, { "database": "PubMed", "id": "12972617", "url": "https://pubmed.ncbi.nlm.nih.gov/12972617" }, { "database": "PubMed", "id": "20818391", "url": "https://pubmed.ncbi.nlm.nih.gov/20818391" }, { "database": "PubMed", "id": "9237170", "url": "https://pubmed.ncbi.nlm.nih.gov/9237170" } ], "site_lbl": "Ser1711", "uniprot_canonical_ac": "P04050-1" }, { "start_pos": 1718, "end_pos": 1718, "kinase_uniprot_canonical_ac": "P46962-1", "kinase_gene_name": "CTK2", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P04050", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P04050" }, { "database": "PubMed", "id": "10594013", "url": "https://pubmed.ncbi.nlm.nih.gov/10594013" }, { "database": "PubMed", "id": "11018013", "url": "https://pubmed.ncbi.nlm.nih.gov/11018013" }, { "database": "PubMed", "id": "11751637", "url": "https://pubmed.ncbi.nlm.nih.gov/11751637" }, { "database": "PubMed", "id": "12972617", "url": "https://pubmed.ncbi.nlm.nih.gov/12972617" }, { "database": "PubMed", "id": "20818391", "url": "https://pubmed.ncbi.nlm.nih.gov/20818391" }, { "database": "PubMed", "id": "9237170", "url": "https://pubmed.ncbi.nlm.nih.gov/9237170" } ], "site_lbl": "Ser1718", "uniprot_canonical_ac": "P04050-1" }, { "start_pos": 1718, "end_pos": 1718, "kinase_uniprot_canonical_ac": "Q03957-1", "kinase_gene_name": "CTK1", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P04050", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P04050" }, { "database": "PubMed", "id": "10594013", "url": "https://pubmed.ncbi.nlm.nih.gov/10594013" }, { "database": "PubMed", "id": "11018013", "url": "https://pubmed.ncbi.nlm.nih.gov/11018013" }, { "database": "PubMed", "id": "11751637", "url": "https://pubmed.ncbi.nlm.nih.gov/11751637" }, { "database": "PubMed", "id": "12972617", "url": "https://pubmed.ncbi.nlm.nih.gov/12972617" }, { "database": "PubMed", "id": "20818391", "url": "https://pubmed.ncbi.nlm.nih.gov/20818391" }, { "database": "PubMed", "id": "9237170", "url": "https://pubmed.ncbi.nlm.nih.gov/9237170" } ], "site_lbl": "Ser1718", "uniprot_canonical_ac": "P04050-1" } ], "record_id": "pubmed.11751637", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 53 }, { "field": "total_sites", "count": 27 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The RNA polymerase II CTD kinase CTDK-I affects pre-mRNA 3' cleavage/polyadenylation through the processing component Pti1p.", "journal": "Molecular cell", "date": "2002-12", "authors": "Skaar David A, Greenleaf Arno L", "reference": { "type": "PubMed", "id": "12504017", "url": "https://pubmed.ncbi.nlm.nih.gov/12504017" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q03957-1", "protein_name": "CTD kinase subunit alpha", "gene_name": "CTK1", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "Q03957", "url": "https://www.uniprot.org/uniprotkb/Q03957" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.12504017", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "A genome-wide screen for Saccharomyces cerevisiae deletion mutants that affect telomere length.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2004-06-08", "authors": "Askree Syed H, Yehuda Tal, Smolikov Sarit, Gurevich Raya, Hawk Joshua, Coker Carrie, Krauskopf Anat, Kupiec Martin, McEachern Michael J", "reference": { "type": "PubMed", "id": "15161972", "url": "https://pubmed.ncbi.nlm.nih.gov/15161972" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q03957-1", "protein_name": "CTD kinase subunit alpha", "gene_name": "CTK1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q3E7B9-1", "protein_name": "Uncharacterized protein YOR008C-A", "gene_name": "", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q08281-1", "protein_name": "Restriction of telomere capping protein 1", "gene_name": "RTC1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q08645-1", "protein_name": "Folylpolyglutamate synthase", "gene_name": "MET7", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P38801-1", "protein_name": "Exosome complex protein LRP1", "gene_name": "LRP1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P38961-1", "protein_name": "25S rRNA (adenine(645)-N(1))-methyltransferase", "gene_name": "RRP8", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P40530-1", "protein_name": "[Pyruvate dehydrogenase (acetyl-transferring)] kinase 1, mitochondrial", "gene_name": "PKP1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q12245-1", "protein_name": "Proteasome chaperone 4", "gene_name": "POC4", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "Q03957", "url": "https://www.uniprot.org/uniprotkb/Q03957" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.15161972", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 8 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Phosphorylation by Cak1 regulates the C-terminal domain kinase Ctk1 in Saccharomyces cerevisiae.", "journal": "Molecular and cellular biology", "date": "2005-05", "authors": "Ostapenko Denis, Solomon Mark J", "reference": { "type": "PubMed", "id": "15870265", "url": "https://pubmed.ncbi.nlm.nih.gov/15870265" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q03957-1", "protein_name": "CTD kinase subunit alpha", "gene_name": "CTK1", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "Q03957", "url": "https://www.uniprot.org/uniprotkb/Q03957" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "mutagenesis": [ { "start_pos": 324, "end_pos": 324, "sequence_org": "D", "sequence_mut": "N", "comment": "Cold-sensitive. Sensitive to hydroxyurea and UV irradiation. Interferes with ATP-binding.", "evidence": [ { "database": "UniProtKB", "id": "Q03957", "url": "https://www.uniprot.org/uniprotkb/Q03957" }, { "database": "PubMed", "id": "15870265", "url": "https://pubmed.ncbi.nlm.nih.gov/15870265" }, { "database": "PubMed", "id": "12684377", "url": "https://pubmed.ncbi.nlm.nih.gov/12684377" } ], "uniprot_canonical_ac": "Q03957-1" }, { "start_pos": 338, "end_pos": 338, "sequence_org": "T", "sequence_mut": "A", "comment": "Cold-sensitive. Abolishes kinase activity. Delayed growth at early stationary phase. Shows no increase in CTDSer-2 phosphorylation in the transition from rapid growth to stationary phase. Has compromised transcriptional activation of two stationary-phase genes CTT1 and SPI1.", "evidence": [ { "database": "UniProtKB", "id": "Q03957", "url": "https://www.uniprot.org/uniprotkb/Q03957" }, { "database": "PubMed", "id": "15870265", "url": "https://pubmed.ncbi.nlm.nih.gov/15870265" } ], "uniprot_canonical_ac": "Q03957-1" } ], "phosphorylation": [ { "start_pos": 2, "end_pos": 2, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q03957", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q03957" }, { "database": "PubMed", "id": "11751637", "url": "https://pubmed.ncbi.nlm.nih.gov/11751637" }, { "database": "PubMed", "id": "15870265", "url": "https://pubmed.ncbi.nlm.nih.gov/15870265" } ], "site_lbl": "Ser2", "uniprot_canonical_ac": "Q03957-1" }, { "start_pos": 338, "end_pos": 338, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine", "evidence": [ { "database": "UniProtKB", "id": "Q03957", "url": "https://www.uniprot.org/uniprotkb/Q03957" }, { "database": "PubMed", "id": "15870265", "url": "https://pubmed.ncbi.nlm.nih.gov/15870265" }, { "database": "iPTMnet", "id": "Q03957", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q03957" }, { "database": "PubMed", "id": "11875433", "url": "https://pubmed.ncbi.nlm.nih.gov/11875433" }, { "database": "PubMed", "id": "18407956", "url": "https://pubmed.ncbi.nlm.nih.gov/18407956" }, { "database": "SGD", "id": "S000001622", "url": "https://www.yeastgenome.org/locus/S000001622" }, { "database": "PubMed", "id": "32597660", "url": "https://pubmed.ncbi.nlm.nih.gov/32597660" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" } ], "site_lbl": "Thr338", "uniprot_canonical_ac": "Q03957-1" } ], "record_id": "pubmed.15870265", "abstract": "", "glycosylation": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The RNA polymerase II kinase Ctk1 regulates positioning of a 5' histone methylation boundary along genes.", "journal": "Molecular and cellular biology", "date": "2007-01", "authors": "Xiao Tiaojiang, Shibata Yoichiro, Rao Bhargavi, Laribee R Nicholas, O'Rourke Rose, Buck Michael J, Greenblatt Jack F, Krogan Nevan J, Lieb Jason D, Strahl Brian D", "reference": { "type": "PubMed", "id": "17088384", "url": "https://pubmed.ncbi.nlm.nih.gov/17088384" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q03957-1", "protein_name": "CTD kinase subunit alpha", "gene_name": "CTK1", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "Q03957", "url": "https://www.uniprot.org/uniprotkb/Q03957" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.17088384", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The RNA polymerase II CTD kinase Ctk1 functions in translation elongation.", "journal": "Genes & development", "date": "2007-06-01", "authors": "R\u00f6ther Susanne, Str\u00e4sser Katja", "reference": { "type": "PubMed", "id": "17545469", "url": "https://pubmed.ncbi.nlm.nih.gov/17545469" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q03957-1", "protein_name": "CTD kinase subunit alpha", "gene_name": "CTK1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P25443-1", "protein_name": "Small ribosomal subunit protein uS5", "gene_name": "RPS2", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "Q03957", "url": "https://www.uniprot.org/uniprotkb/Q03957" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "phosphorylation": [ { "start_pos": 238, "end_pos": 238, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "SGD", "id": "S000003091", "url": "https://www.yeastgenome.org/locus/S000003091" }, { "database": "iPTMnet", "id": "P25443", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P25443" }, { "database": "PubMed", "id": "17545469", "url": "https://pubmed.ncbi.nlm.nih.gov/17545469" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" } ], "site_lbl": "Ser238", "uniprot_canonical_ac": "P25443-1" } ], "record_id": "pubmed.17545469", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "CTD kinase large subunit is encoded by CTK1, a gene required for normal growth of Saccharomyces cerevisiae.", "journal": "Gene Expr.", "date": "1991", "authors": "Lee J M, Greenleaf A L", "reference": { "type": "PubMed", "id": "1820212", "url": "https://pubmed.ncbi.nlm.nih.gov/1820212" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q03957-1", "protein_name": "CTD kinase subunit alpha", "gene_name": "CTK1", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "Q03957", "url": "https://www.uniprot.org/uniprotkb/Q03957" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.1820212", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Cohesin's binding to chromosomes depends on a separate complex consisting of Scc2 and Scc4 proteins.", "journal": "Molecular cell", "date": "2000-02", "authors": "Ciosk R, Shirayama M, Shevchenko A, Tanaka T, Toth A, Shevchenko A, Nasmyth K", "reference": { "type": "PubMed", "id": "10882066", "url": "https://pubmed.ncbi.nlm.nih.gov/10882066" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q04002-1", "protein_name": "Sister chromatid cohesion protein 2", "gene_name": "SCC2", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P40090-1", "protein_name": "MAU2 chromatid cohesion factor homolog", "gene_name": "SCC4", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "Q04002", "url": "https://www.uniprot.org/uniprotkb/Q04002" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.10882066", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "ATP hydrolysis is required for cohesin's association with chromosomes.", "journal": "Current biology : CB", "date": "2003-11-11", "authors": "Arumugam Prakash, Gruber Stephan, Tanaka Koichi, Haering Christian H, Mechtler Karl, Nasmyth Kim", "reference": { "type": "PubMed", "id": "14614819", "url": "https://pubmed.ncbi.nlm.nih.gov/14614819" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q04002-1", "protein_name": "Sister chromatid cohesion protein 2", "gene_name": "SCC2", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "Q04002", "url": "https://www.uniprot.org/uniprotkb/Q04002" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.14614819", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The Scc2-Scc4 complex acts in sister chromatid cohesion and transcriptional regulation by maintaining nucleosome-free regions.", "journal": "Nature genetics", "date": "2014-10", "authors": "Lopez-Serra Lidia, Kelly Gavin, Patel Harshil, Stewart Aengus, Uhlmann Frank", "reference": { "type": "PubMed", "id": "25173104", "url": "https://pubmed.ncbi.nlm.nih.gov/25173104" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q04002-1", "protein_name": "Sister chromatid cohesion protein 2", "gene_name": "SCC2", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P40090-1", "protein_name": "MAU2 chromatid cohesion factor homolog", "gene_name": "SCC4", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "Q04002", "url": "https://www.uniprot.org/uniprotkb/Q04002" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.25173104", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Structural evidence for Scc4-dependent localization of cohesin loading.", "journal": "Elife", "date": "2015", "authors": "Hinshaw Stephen M, Makrantoni Vasso, Kerr Alastair, Marston Ad\u00e8le L, Harrison Stephen C", "reference": { "type": "PubMed", "id": "26038942", "url": "https://pubmed.ncbi.nlm.nih.gov/26038942" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q04002-1", "protein_name": "Sister chromatid cohesion protein 2", "gene_name": "SCC2", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P40090-1", "protein_name": "MAU2 chromatid cohesion factor homolog", "gene_name": "SCC4", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "Q04002", "url": "https://www.uniprot.org/uniprotkb/Q04002" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "mutagenesis": [ { "start_pos": 256, "end_pos": 256, "sequence_org": "L", "sequence_mut": "K", "comment": "In scc4m7; eliminates centromeric localization of SCC2 in mitotic cells and reduces association of the cohesin subunit SCC1 with the centromere and pericentromere; when associated with A-298; D-299; A-313; A-324; D-327; and D-331.", "evidence": [ { "database": "UniProtKB", "id": "P40090", "url": "https://www.uniprot.org/uniprotkb/P40090" }, { "database": "PubMed", "id": "26038942", "url": "https://pubmed.ncbi.nlm.nih.gov/26038942" } ], "uniprot_canonical_ac": "P40090-1" }, { "start_pos": 298, "end_pos": 298, "sequence_org": "Y", "sequence_mut": "A", "comment": "In scc4m7; eliminates centromeric localization of SCC2 in mitotic cells and reduces association of the cohesin subunit SCC1 with the centromere and pericentromere; when associated with K-256; D-299; A-313; A-324; D-327; and D-331.", "evidence": [ { "database": "UniProtKB", "id": "P40090", "url": "https://www.uniprot.org/uniprotkb/P40090" }, { "database": "PubMed", "id": "26038942", "url": "https://pubmed.ncbi.nlm.nih.gov/26038942" } ], "uniprot_canonical_ac": "P40090-1" }, { "start_pos": 299, "end_pos": 299, "sequence_org": "K", "sequence_mut": "D", "comment": "In scc4m7; eliminates centromeric localization of SCC2 in mitotic cells and reduces association of the cohesin subunit SCC1 with the centromere and pericentromere; when associated with K-256; A-298; A-313; A-324; D-327; and D-331.", "evidence": [ { "database": "UniProtKB", "id": "P40090", "url": "https://www.uniprot.org/uniprotkb/P40090" }, { "database": "PubMed", "id": "26038942", "url": "https://pubmed.ncbi.nlm.nih.gov/26038942" } ], "uniprot_canonical_ac": "P40090-1" }, { "start_pos": 313, "end_pos": 313, "sequence_org": "Y", "sequence_mut": "A", "comment": "In scc4m7; eliminates centromeric localization of SCC2 in mitotic cells and reduces association of the cohesin subunit SCC1 with the centromere and pericentromere; when associated with K-256; A-298; D-299; A-324; D-327; and D-331.", "evidence": [ { "database": "UniProtKB", "id": "P40090", "url": "https://www.uniprot.org/uniprotkb/P40090" }, { "database": "PubMed", "id": "26038942", "url": "https://pubmed.ncbi.nlm.nih.gov/26038942" } ], "uniprot_canonical_ac": "P40090-1" }, { "start_pos": 324, "end_pos": 324, "sequence_org": "F", "sequence_mut": "A", "comment": "In scc4m35; eliminates centromeric localization of SCC2 in mitotic cells and reduces association of the cohesin subunit SCC1 with the centromere and pericentromere; when associated with A-327; A-331; A-540 and A-541. In scc4m7; eliminates centromeric localization of SCC2 in mitotic cells and reduces association of the cohesin subunit SCC1 with the centromere and pericentromere; when associated with K-256; A-298; D-299; A-313; D-327; and D-331.", "evidence": [ { "database": "UniProtKB", "id": "P40090", "url": "https://www.uniprot.org/uniprotkb/P40090" }, { "database": "PubMed", "id": "26038942", "url": "https://pubmed.ncbi.nlm.nih.gov/26038942" } ], "uniprot_canonical_ac": "P40090-1" }, { "start_pos": 327, "end_pos": 327, "sequence_org": "K", "sequence_mut": "A", "comment": "In scc4m35; eliminates centromeric localization of SCC2 in mitotic cells and reduces association of the cohesin subunit SCC1 with the centromere and pericentromere; when associated with A-324; A-331; A-540 and A-541.", "evidence": [ { "database": "UniProtKB", "id": "P40090", "url": "https://www.uniprot.org/uniprotkb/P40090" }, { "database": "PubMed", "id": "26038942", "url": "https://pubmed.ncbi.nlm.nih.gov/26038942" } ], "uniprot_canonical_ac": "P40090-1" }, { "start_pos": 327, "end_pos": 327, "sequence_org": "K", "sequence_mut": "D", "comment": "In scc4m7; eliminates centromeric localization of SCC2 in mitotic cells and reduces association of the cohesin subunit SCC1 with the centromere and pericentromere; when associated with K-256; A-298; D-299; A-313; A-324 and D-331.", "evidence": [ { "database": "UniProtKB", "id": "P40090", "url": "https://www.uniprot.org/uniprotkb/P40090" }, { "database": "PubMed", "id": "26038942", "url": "https://pubmed.ncbi.nlm.nih.gov/26038942" } ], "uniprot_canonical_ac": "P40090-1" }, { "start_pos": 331, "end_pos": 331, "sequence_org": "K", "sequence_mut": "A", "comment": "In scc4m35; eliminates centromeric localization of SCC2 in mitotic cells and reduces association of the cohesin subunit SCC1 with the centromere and pericentromere; when associated with A-324; A-327; A-540 and A-541.", "evidence": [ { "database": "UniProtKB", "id": "P40090", "url": "https://www.uniprot.org/uniprotkb/P40090" }, { "database": "PubMed", "id": "26038942", "url": "https://pubmed.ncbi.nlm.nih.gov/26038942" } ], "uniprot_canonical_ac": "P40090-1" }, { "start_pos": 331, "end_pos": 331, "sequence_org": "K", "sequence_mut": "D", "comment": "In scc4m7; eliminates centromeric localization of SCC2 in mitotic cells and reduces association of the cohesin subunit SCC1 with the centromere and pericentromere; when associated with K-256; A-298; D-299; A-313; A-324 and D-327.", "evidence": [ { "database": "UniProtKB", "id": "P40090", "url": "https://www.uniprot.org/uniprotkb/P40090" }, { "database": "PubMed", "id": "26038942", "url": "https://pubmed.ncbi.nlm.nih.gov/26038942" } ], "uniprot_canonical_ac": "P40090-1" }, { "start_pos": 540, "end_pos": 540, "sequence_org": "K", "sequence_mut": "A", "comment": "In scc4m35; eliminates centromeric localization of SCC2 in mitotic cells and reduces association of the cohesin subunit SCC1 with the centromere and pericentromere; when associated with A-324; A-327; A-331 and A-541.", "evidence": [ { "database": "UniProtKB", "id": "P40090", "url": "https://www.uniprot.org/uniprotkb/P40090" }, { "database": "PubMed", "id": "26038942", "url": "https://pubmed.ncbi.nlm.nih.gov/26038942" } ], "uniprot_canonical_ac": "P40090-1" }, { "start_pos": 541, "end_pos": 541, "sequence_org": "K", "sequence_mut": "A", "comment": "In scc4m35; eliminates centromeric localization of SCC2 in mitotic cells and reduces association of the cohesin subunit SCC1 with the centromere and pericentromere; when associated with A-324; A-327; A-331 and A-540.", "evidence": [ { "database": "UniProtKB", "id": "P40090", "url": "https://www.uniprot.org/uniprotkb/P40090" }, { "database": "PubMed", "id": "26038942", "url": "https://pubmed.ncbi.nlm.nih.gov/26038942" } ], "uniprot_canonical_ac": "P40090-1" } ], "record_id": "pubmed.26038942", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Phosphorylation of the Scc2 cohesin deposition complex subunit regulates chromosome condensation through cohesin integrity.", "journal": "Molecular biology of the cell", "date": "2015-11-01", "authors": "Woodman Julie, Hoffman Matthew, Dzieciatkowska Monika, Hansen Kirk C, Megee Paul C", "reference": { "type": "PubMed", "id": "26354421", "url": "https://pubmed.ncbi.nlm.nih.gov/26354421" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q04002-1", "protein_name": "Sister chromatid cohesion protein 2", "gene_name": "SCC2", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "Q04002", "url": "https://www.uniprot.org/uniprotkb/Q04002" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "mutagenesis": [ { "start_pos": 1182, "end_pos": 1182, "sequence_org": "S", "sequence_mut": "E", "comment": "In scc2-CE; mimics constitutive phosphorylation, retains normal SCC2-SCC4 interactions and chromatin association, but exhibits decreased viability, sensitivity to genotoxic agents methyl methanesulfonate (MMS) and hydroxyurea (HU); when associated with E-1185.", "evidence": [ { "database": "UniProtKB", "id": "Q04002", "url": "https://www.uniprot.org/uniprotkb/Q04002" }, { "database": "PubMed", "id": "26354421", "url": "https://pubmed.ncbi.nlm.nih.gov/26354421" } ], "uniprot_canonical_ac": "Q04002-1" }, { "start_pos": 1185, "end_pos": 1185, "sequence_org": "S", "sequence_mut": "E", "comment": "In scc2-CE; mimics constitutive phosphorylation, retains normal SCC2-SCC4 interactions and chromatin association, but exhibits decreased viability, sensitivity to genotoxic agents methyl methanesulfonate (MMS) and hydroxyurea (HU); when associated with E-1182.", "evidence": [ { "database": "UniProtKB", "id": "Q04002", "url": "https://www.uniprot.org/uniprotkb/Q04002" }, { "database": "PubMed", "id": "26354421", "url": "https://pubmed.ncbi.nlm.nih.gov/26354421" } ], "uniprot_canonical_ac": "Q04002-1" }, { "start_pos": 127, "end_pos": 127, "sequence_org": "S", "sequence_mut": "A", "comment": "In scc2-8A; mimics unphosphorylated form and leads to novel phosphorylation sites at Ser-43, Ser-74, Ser-162, Ser-360, Ser-1179 and Ser-1183; when associated with A-67; A-157; A-163; A-231; A-236; A-305 and A-320.", "evidence": [ { "database": "UniProtKB", "id": "Q04002", "url": "https://www.uniprot.org/uniprotkb/Q04002" }, { "database": "PubMed", "id": "26354421", "url": "https://pubmed.ncbi.nlm.nih.gov/26354421" } ], "uniprot_canonical_ac": "Q04002-1" }, { "start_pos": 127, "end_pos": 127, "sequence_org": "S", "sequence_mut": "E", "comment": "In scc2-8E; mimics constitutive phosphorylation, retains normal SCC2-SCC4 interactions and chromatin association, but exhibits decreased viability, sensitivity to genotoxic agents methyl methanesulfonate (MMS) and hydroxyurea (HU), and decreased stability of the MCD1 cohesin subunit in mitotic cells; when associated with E-67; E-157; E-163; E-231; E-236; E-305 and E-320.", "evidence": [ { "database": "UniProtKB", "id": "Q04002", "url": "https://www.uniprot.org/uniprotkb/Q04002" }, { "database": "PubMed", "id": "26354421", "url": "https://pubmed.ncbi.nlm.nih.gov/26354421" } ], "uniprot_canonical_ac": "Q04002-1" }, { "start_pos": 157, "end_pos": 157, "sequence_org": "S", "sequence_mut": "A", "comment": "In scc2-8A; mimics unphosphorylated form and leads to novel phosphorylation sites at Ser-43, Ser-74, Ser-162, Ser-360, Ser-1179 and Ser-1183; when associated with A-67; A-127; A-163; A-231; A-236; A-305 and A-320.", "evidence": [ { "database": "UniProtKB", "id": "Q04002", "url": "https://www.uniprot.org/uniprotkb/Q04002" }, { "database": "PubMed", "id": "26354421", "url": "https://pubmed.ncbi.nlm.nih.gov/26354421" } ], "uniprot_canonical_ac": "Q04002-1" }, { "start_pos": 157, "end_pos": 157, "sequence_org": "S", "sequence_mut": "E", "comment": "In scc2-8E; mimics constitutive phosphorylation, retains normal SCC2-SCC4 interactions and chromatin association, but exhibits decreased viability, sensitivity to genotoxic agents methyl methanesulfonate (MMS) and hydroxyurea (HU), and decreased stability of the MCD1 cohesin subunit in mitotic cells; when associated with E-67; E-127; E-163; E-231; E-236; E-305 and E-320.", "evidence": [ { "database": "UniProtKB", "id": "Q04002", "url": "https://www.uniprot.org/uniprotkb/Q04002" }, { "database": "PubMed", "id": "26354421", "url": "https://pubmed.ncbi.nlm.nih.gov/26354421" } ], "uniprot_canonical_ac": "Q04002-1" }, { "start_pos": 163, "end_pos": 163, "sequence_org": "S", "sequence_mut": "A", "comment": "In scc2-8A; mimics unphosphorylated form and leads to novel phosphorylation sites at Ser-43, Ser-74, Ser-162, Ser-360, Ser-1179 and Ser-1183; when associated with A-67; A-127; A-157; A-231; A-236; A-305 and A-320.", "evidence": [ { "database": "UniProtKB", "id": "Q04002", "url": "https://www.uniprot.org/uniprotkb/Q04002" }, { "database": "PubMed", "id": "26354421", "url": "https://pubmed.ncbi.nlm.nih.gov/26354421" } ], "uniprot_canonical_ac": "Q04002-1" }, { "start_pos": 163, "end_pos": 163, "sequence_org": "S", "sequence_mut": "E", "comment": "In scc2-8E; mimics constitutive phosphorylation, retains normal SCC2-SCC4 interactions and chromatin association, but exhibits decreased viability, sensitivity to genotoxic agents methyl methanesulfonate (MMS) and hydroxyurea (HU), and decreased stability of the MCD1 cohesin subunit in mitotic cells; when associated with E-67; E-127; E-157; E-231; E-236; E-305 and E-320.", "evidence": [ { "database": "UniProtKB", "id": "Q04002", "url": "https://www.uniprot.org/uniprotkb/Q04002" }, { "database": "PubMed", "id": "26354421", "url": "https://pubmed.ncbi.nlm.nih.gov/26354421" } ], "uniprot_canonical_ac": "Q04002-1" }, { "start_pos": 231, "end_pos": 231, "sequence_org": "T", "sequence_mut": "A", "comment": "In scc2-8A; mimics unphosphorylated form and leads to novel phosphorylation sites at Ser-43, Ser-74, Ser-162, Ser-360, Ser-1179 and Ser-1183; when associated with A-67; A-127; A-157; A-163; A-236; A-305 and A-320.", "evidence": [ { "database": "UniProtKB", "id": "Q04002", "url": "https://www.uniprot.org/uniprotkb/Q04002" }, { "database": "PubMed", "id": "26354421", "url": "https://pubmed.ncbi.nlm.nih.gov/26354421" } ], "uniprot_canonical_ac": "Q04002-1" }, { "start_pos": 231, "end_pos": 231, "sequence_org": "T", "sequence_mut": "E", "comment": "In scc2-8E; mimics constitutive phosphorylation, retains normal SCC2-SCC4 interactions and chromatin association, but exhibits decreased viability, sensitivity to genotoxic agents methyl methanesulfonate (MMS) and hydroxyurea (HU), and decreased stability of the MCD1 cohesin subunit in mitotic cells; when associated with E-67; E-127; E-157; E-163; E-236; E-305 and E-320. In scc2-2NE; mimics constitutive phosphorylation, retains normal SCC2-SCC4 interactions and chromatin association, but exhibits decreased viability, sensitivity to genotoxic agents methyl methanesulfonate (MMS) and hydroxyurea (HU), and decreased stability of the MCD1 cohesin subunit in mitotic cells; when associated with E-236; E-305 and E-320.", "evidence": [ { "database": "UniProtKB", "id": "Q04002", "url": "https://www.uniprot.org/uniprotkb/Q04002" }, { "database": "PubMed", "id": "26354421", "url": "https://pubmed.ncbi.nlm.nih.gov/26354421" } ], "uniprot_canonical_ac": "Q04002-1" }, { "start_pos": 236, "end_pos": 236, "sequence_org": "T", "sequence_mut": "A", "comment": "In scc2-8A; mimics unphosphorylated form and leads to novel phosphorylation sites at Ser-43, Ser-74, Ser-162, Ser-360, Ser-1179 and Ser-1183; when associated with A-67; A-127; A-157; A-163; A-231; A-305 and A-320.", "evidence": [ { "database": "UniProtKB", "id": "Q04002", "url": "https://www.uniprot.org/uniprotkb/Q04002" }, { "database": "PubMed", "id": "26354421", "url": "https://pubmed.ncbi.nlm.nih.gov/26354421" } ], "uniprot_canonical_ac": "Q04002-1" }, { "start_pos": 236, "end_pos": 236, "sequence_org": "T", "sequence_mut": "E", "comment": "In scc2-8E; mimics constitutive phosphorylation, retains normal SCC2-SCC4 interactions and chromatin association, but exhibits decreased viability, sensitivity to genotoxic agents methyl methanesulfonate (MMS) and hydroxyurea (HU), and decreased stability of the MCD1 cohesin subunit in mitotic cells; when associated with E-67; E-127; E-157; E-163; E-231; E-305 and E-320. In scc2-2NE; mimics constitutive phosphorylation, retains normal SCC2-SCC4 interactions and chromatin association, but exhibits decreased viability, sensitivity to genotoxic agents methyl methanesulfonate (MMS) and hydroxyurea (HU), and decreased stability of the MCD1 cohesin subunit in mitotic cells; when associated with E-231; E-305 and E-320.", "evidence": [ { "database": "UniProtKB", "id": "Q04002", "url": "https://www.uniprot.org/uniprotkb/Q04002" }, { "database": "PubMed", "id": "26354421", "url": "https://pubmed.ncbi.nlm.nih.gov/26354421" } ], "uniprot_canonical_ac": "Q04002-1" }, { "start_pos": 305, "end_pos": 305, "sequence_org": "S", "sequence_mut": "A", "comment": "In scc2-8A; mimics unphosphorylated form and leads to novel phosphorylation sites at Ser-43; S-74; S-162; S-360; S-1179 and Ser-1183; when associated with A-67; A-127; A-157; A-163; A-231; A-236 and A-320.", "evidence": [ { "database": "UniProtKB", "id": "Q04002", "url": "https://www.uniprot.org/uniprotkb/Q04002" }, { "database": "PubMed", "id": "26354421", "url": "https://pubmed.ncbi.nlm.nih.gov/26354421" } ], "uniprot_canonical_ac": "Q04002-1" }, { "start_pos": 305, "end_pos": 305, "sequence_org": "S", "sequence_mut": "E", "comment": "In scc2-8E; mimics constitutive phosphorylation, retains normal SCC2-SCC4 interactions and chromatin association, but exhibits decreased viability, sensitivity to genotoxic agents methyl methanesulfonate (MMS) and hydroxyurea (HU), and decreased stability of the MCD1 cohesin subunit in mitotic cells; when associated with E-67; E-127; E-157; E-163; E-231; E-236 and E-320. In scc2-2NE; mimics constitutive phosphorylation, retains normal SCC2-SCC4 interactions and chromatin association, but exhibits decreased viability, sensitivity to genotoxic agents methyl methanesulfonate (MMS) and hydroxyurea (HU), and decreased stability of the MCD1 cohesin subunit in mitotic cells; when associated with E-231; E-236 and E-320.", "evidence": [ { "database": "UniProtKB", "id": "Q04002", "url": "https://www.uniprot.org/uniprotkb/Q04002" }, { "database": "PubMed", "id": "26354421", "url": "https://pubmed.ncbi.nlm.nih.gov/26354421" } ], "uniprot_canonical_ac": "Q04002-1" }, { "start_pos": 320, "end_pos": 320, "sequence_org": "S", "sequence_mut": "A", "comment": "In scc2-8A; mimics unphosphorylated form and leads to novel phosphorylation sites at S-43; S-74; S-162; S-360; S-1179 and S-1183; when associated with A-67; A-127; A-157; A-163; A-231; A-236 and A-305.", "evidence": [ { "database": "UniProtKB", "id": "Q04002", "url": "https://www.uniprot.org/uniprotkb/Q04002" }, { "database": "PubMed", "id": "26354421", "url": "https://pubmed.ncbi.nlm.nih.gov/26354421" } ], "uniprot_canonical_ac": "Q04002-1" }, { "start_pos": 320, "end_pos": 320, "sequence_org": "S", "sequence_mut": "E", "comment": "In scc2-8E; mimics constitutive phosphorylation, retains normal SCC2-SCC4 interactions and chromatin association, but exhibits decreased viability, sensitivity to genotoxic agents methyl methanesulfonate (MMS) and hydroxyurea (HU), and decreased stability of the MCD1 cohesin subunit in mitotic cells; when associated with E-67; E-127; E-157; E-163; E-231; E-236 and E-305. In scc2-2NE; mimics constitutive phosphorylation, retains normal SCC2-SCC4 interactions and chromatin association, but exhibits decreased viability, sensitivity to genotoxic agents methyl methanesulfonate (MMS) and hydroxyurea (HU), and decreased stability of the MCD1 cohesin subunit in mitotic cells; when associated with E-231; E-236 and E-305.", "evidence": [ { "database": "UniProtKB", "id": "Q04002", "url": "https://www.uniprot.org/uniprotkb/Q04002" }, { "database": "PubMed", "id": "26354421", "url": "https://pubmed.ncbi.nlm.nih.gov/26354421" } ], "uniprot_canonical_ac": "Q04002-1" }, { "start_pos": 67, "end_pos": 67, "sequence_org": "T", "sequence_mut": "A", "comment": "In scc2-8A; mimics unphosphorylated form and leads to novel phosphorylation sites at Ser-43, Ser-74, Ser-162, Ser-360, Ser-1179 and Ser-1183; when associated with A-127; A-157; A-163; A-231; A-236; A-305 and A-320.", "evidence": [ { "database": "UniProtKB", "id": "Q04002", "url": "https://www.uniprot.org/uniprotkb/Q04002" }, { "database": "PubMed", "id": "26354421", "url": "https://pubmed.ncbi.nlm.nih.gov/26354421" } ], "uniprot_canonical_ac": "Q04002-1" }, { "start_pos": 67, "end_pos": 67, "sequence_org": "T", "sequence_mut": "E", "comment": "In scc2-8E; mimics constitutive phosphorylation, retains normal SCC2-SCC4 interactions and chromatin association, but exhibits decreased viability, sensitivity to genotoxic agents methyl methanesulfonate (MMS) and hydroxyurea (HU), and decreased stability of the MCD1 cohesin subunit in mitotic cells; when associated with E-127; E-157; E-163; E-231; E-236; E-305 and E-320.", "evidence": [ { "database": "UniProtKB", "id": "Q04002", "url": "https://www.uniprot.org/uniprotkb/Q04002" }, { "database": "PubMed", "id": "26354421", "url": "https://pubmed.ncbi.nlm.nih.gov/26354421" } ], "uniprot_canonical_ac": "Q04002-1" }, { "start_pos": 753, "end_pos": 753, "sequence_org": "S", "sequence_mut": "E", "comment": "Mimics constitutive phosphorylation and causes inviability through protein instability.", "evidence": [ { "database": "UniProtKB", "id": "Q04002", "url": "https://www.uniprot.org/uniprotkb/Q04002" }, { "database": "PubMed", "id": "26354421", "url": "https://pubmed.ncbi.nlm.nih.gov/26354421" } ], "uniprot_canonical_ac": "Q04002-1" } ], "phosphorylation": [ { "start_pos": 1179, "end_pos": 1179, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; in mutant scc2-8A", "evidence": [ { "database": "UniProtKB", "id": "Q04002", "url": "https://www.uniprot.org/uniprotkb/Q04002" }, { "database": "iPTMnet", "id": "Q04002", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q04002" }, { "database": "PubMed", "id": "26354421", "url": "https://pubmed.ncbi.nlm.nih.gov/26354421" } ], "site_lbl": "Ser1179", "uniprot_canonical_ac": "Q04002-1" }, { "start_pos": 1182, "end_pos": 1182, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "Q04002", "url": "https://www.uniprot.org/uniprotkb/Q04002" }, { "database": "PubMed", "id": "26354421", "url": "https://pubmed.ncbi.nlm.nih.gov/26354421" }, { "database": "iPTMnet", "id": "Q04002", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q04002" } ], "site_lbl": "Ser1182", "uniprot_canonical_ac": "Q04002-1" }, { "start_pos": 1183, "end_pos": 1183, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; in mutant scc2-8A", "evidence": [ { "database": "UniProtKB", "id": "Q04002", "url": "https://www.uniprot.org/uniprotkb/Q04002" }, { "database": "iPTMnet", "id": "Q04002", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q04002" }, { "database": "PubMed", "id": "26354421", "url": "https://pubmed.ncbi.nlm.nih.gov/26354421" } ], "site_lbl": "Ser1183", "uniprot_canonical_ac": "Q04002-1" }, { "start_pos": 1185, "end_pos": 1185, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "Q04002", "url": "https://www.uniprot.org/uniprotkb/Q04002" }, { "database": "PubMed", "id": "26354421", "url": "https://pubmed.ncbi.nlm.nih.gov/26354421" }, { "database": "iPTMnet", "id": "Q04002", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q04002" } ], "site_lbl": "Ser1185", "uniprot_canonical_ac": "Q04002-1" }, { "start_pos": 127, "end_pos": 127, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "Q04002", "url": "https://www.uniprot.org/uniprotkb/Q04002" }, { "database": "PubMed", "id": "26354421", "url": "https://pubmed.ncbi.nlm.nih.gov/26354421" }, { "database": "iPTMnet", "id": "Q04002", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q04002" } ], "site_lbl": "Ser127", "uniprot_canonical_ac": "Q04002-1" }, { "start_pos": 157, "end_pos": 157, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "Q04002", "url": "https://www.uniprot.org/uniprotkb/Q04002" }, { "database": "PubMed", "id": "26354421", "url": "https://pubmed.ncbi.nlm.nih.gov/26354421" }, { "database": "SGD", "id": "S000002588", "url": "https://www.yeastgenome.org/locus/S000002588" }, { "database": "iPTMnet", "id": "Q04002", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q04002" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" } ], "site_lbl": "Ser157", "uniprot_canonical_ac": "Q04002-1" }, { "start_pos": 162, "end_pos": 162, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; in mutant scc2-8A", "evidence": [ { "database": "UniProtKB", "id": "Q04002", "url": "https://www.uniprot.org/uniprotkb/Q04002" }, { "database": "iPTMnet", "id": "Q04002", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q04002" }, { "database": "PubMed", "id": "26354421", "url": "https://pubmed.ncbi.nlm.nih.gov/26354421" } ], "site_lbl": "Ser162", "uniprot_canonical_ac": "Q04002-1" }, { "start_pos": 163, "end_pos": 163, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "Q04002", "url": "https://www.uniprot.org/uniprotkb/Q04002" }, { "database": "PubMed", "id": "26354421", "url": "https://pubmed.ncbi.nlm.nih.gov/26354421" }, { "database": "iPTMnet", "id": "Q04002", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q04002" } ], "site_lbl": "Ser163", "uniprot_canonical_ac": "Q04002-1" }, { "start_pos": 231, "end_pos": 231, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine", "evidence": [ { "database": "UniProtKB", "id": "Q04002", "url": "https://www.uniprot.org/uniprotkb/Q04002" }, { "database": "PubMed", "id": "26354421", "url": "https://pubmed.ncbi.nlm.nih.gov/26354421" }, { "database": "iPTMnet", "id": "Q04002", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q04002" } ], "site_lbl": "Thr231", "uniprot_canonical_ac": "Q04002-1" }, { "start_pos": 236, "end_pos": 236, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine", "evidence": [ { "database": "UniProtKB", "id": "Q04002", "url": "https://www.uniprot.org/uniprotkb/Q04002" }, { "database": "PubMed", "id": "26354421", "url": "https://pubmed.ncbi.nlm.nih.gov/26354421" }, { "database": "iPTMnet", "id": "Q04002", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q04002" } ], "site_lbl": "Thr236", "uniprot_canonical_ac": "Q04002-1" }, { "start_pos": 305, "end_pos": 305, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "Q04002", "url": "https://www.uniprot.org/uniprotkb/Q04002" }, { "database": "PubMed", "id": "26354421", "url": "https://pubmed.ncbi.nlm.nih.gov/26354421" }, { "database": "iPTMnet", "id": "Q04002", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q04002" } ], "site_lbl": "Ser305", "uniprot_canonical_ac": "Q04002-1" }, { "start_pos": 320, "end_pos": 320, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "Q04002", "url": "https://www.uniprot.org/uniprotkb/Q04002" }, { "database": "PubMed", "id": "26354421", "url": "https://pubmed.ncbi.nlm.nih.gov/26354421" }, { "database": "iPTMnet", "id": "Q04002", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q04002" } ], "site_lbl": "Ser320", "uniprot_canonical_ac": "Q04002-1" }, { "start_pos": 360, "end_pos": 360, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine; in mutant scc2-8A", "evidence": [ { "database": "UniProtKB", "id": "Q04002", "url": "https://www.uniprot.org/uniprotkb/Q04002" }, { "database": "iPTMnet", "id": "Q04002", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q04002" }, { "database": "PubMed", "id": "26354421", "url": "https://pubmed.ncbi.nlm.nih.gov/26354421" } ], "site_lbl": "Thr360", "uniprot_canonical_ac": "Q04002-1" }, { "start_pos": 43, "end_pos": 43, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; in mutant scc2-8A", "evidence": [ { "database": "UniProtKB", "id": "Q04002", "url": "https://www.uniprot.org/uniprotkb/Q04002" }, { "database": "iPTMnet", "id": "Q04002", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q04002" }, { "database": "PubMed", "id": "26354421", "url": "https://pubmed.ncbi.nlm.nih.gov/26354421" } ], "site_lbl": "Ser43", "uniprot_canonical_ac": "Q04002-1" }, { "start_pos": 67, "end_pos": 67, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine", "evidence": [ { "database": "UniProtKB", "id": "Q04002", "url": "https://www.uniprot.org/uniprotkb/Q04002" }, { "database": "PubMed", "id": "26354421", "url": "https://pubmed.ncbi.nlm.nih.gov/26354421" }, { "database": "iPTMnet", "id": "Q04002", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q04002" } ], "site_lbl": "Thr67", "uniprot_canonical_ac": "Q04002-1" }, { "start_pos": 74, "end_pos": 74, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; in mutant scc2-8A", "evidence": [ { "database": "UniProtKB", "id": "Q04002", "url": "https://www.uniprot.org/uniprotkb/Q04002" }, { "database": "iPTMnet", "id": "Q04002", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q04002" }, { "database": "PubMed", "id": "26354421", "url": "https://pubmed.ncbi.nlm.nih.gov/26354421" } ], "site_lbl": "Ser74", "uniprot_canonical_ac": "Q04002-1" }, { "start_pos": 753, "end_pos": 753, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "Q04002", "url": "https://www.uniprot.org/uniprotkb/Q04002" }, { "database": "PubMed", "id": "26354421", "url": "https://pubmed.ncbi.nlm.nih.gov/26354421" }, { "database": "iPTMnet", "id": "Q04002", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q04002" } ], "site_lbl": "Ser753", "uniprot_canonical_ac": "Q04002-1" } ], "record_id": "pubmed.26354421", "abstract": "", "glycosylation": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 17 }, { "field": "total_sites", "count": 17 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Cohesins: chromosomal proteins that prevent premature separation of sister chromatids.", "journal": "Cell", "date": "1997", "authors": "Michaelis C, Ciosk R, Nasmyth K", "reference": { "type": "PubMed", "id": "9335333", "url": "https://pubmed.ncbi.nlm.nih.gov/9335333" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q04002-1", "protein_name": "Sister chromatid cohesion protein 2", "gene_name": "SCC2", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P47037-1", "protein_name": "Structural maintenance of chromosomes protein 3", "gene_name": "SMC3", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q12158-1", "protein_name": "Sister chromatid cohesion protein 1", "gene_name": "MCD1", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "Q04002", "url": "https://www.uniprot.org/uniprotkb/Q04002" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.9335333", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Yeast cohesin complex requires a conserved protein, Eco1p(Ctf7), to establish cohesion between sister chromatids during DNA replication.", "journal": "Genes & development", "date": "1999-02-01", "authors": "T\u00f3th A, Ciosk R, Uhlmann F, Galova M, Schleiffer A, Nasmyth K", "reference": { "type": "PubMed", "id": "9990856", "url": "https://pubmed.ncbi.nlm.nih.gov/9990856" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q04002-1", "protein_name": "Sister chromatid cohesion protein 2", "gene_name": "SCC2", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P47037-1", "protein_name": "Structural maintenance of chromosomes protein 3", "gene_name": "SMC3", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P40541-1", "protein_name": "Cohesin subunit SCC3", "gene_name": "IRR1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q12158-1", "protein_name": "Sister chromatid cohesion protein 1", "gene_name": "MCD1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P43605-1", "protein_name": "N-acetyltransferase ECO1", "gene_name": "ECO1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P32908-1", "protein_name": "Structural maintenance of chromosomes protein 1", "gene_name": "SMC1", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "Q04002", "url": "https://www.uniprot.org/uniprotkb/Q04002" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.9990856", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 6 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "PIG-S and PIG-T, essential for GPI anchor attachment to proteins, form a complex with GAA1 and GPI8.", "journal": "The EMBO journal", "date": "2001", "authors": "Ohishi K, Inoue N, Kinoshita T", "reference": { "type": "PubMed", "id": "11483512", "url": "https://pubmed.ncbi.nlm.nih.gov/11483512" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q04080-1", "protein_name": "GPI transamidase component GPI17", "gene_name": "GPI17", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "O43292-1", "protein_name": "GPI-anchor transamidase component GPAA1", "gene_name": "GPAA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92643-1", "protein_name": "GPI-anchor transamidase", "gene_name": "PIGK", "tax_name": "Human" }, { "uniprot_canonical_ac": "P38875-1", "protein_name": "GPI transamidase component GPI16", "gene_name": "GPI16", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q96S52-1", "protein_name": "GPI-anchor transamidase component PIGS", "gene_name": "PIGS", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q03405-1", "protein_name": "Urokinase plasminogen activator surface receptor", "gene_name": "PLAUR", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q969N2-1", "protein_name": "GPI-anchor transamidase component PIGT", "gene_name": "PIGT", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q75T13-1", "protein_name": "GPI inositol-deacylase", "gene_name": "PGAP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H490-1", "protein_name": "GPI-anchor transamidase component PIGU", "gene_name": "PIGU", "tax_name": "Human" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "Q04080", "url": "https://www.uniprot.org/uniprotkb/Q04080" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.11483512", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 9 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "MUS81 encodes a novel helix-hairpin-helix protein involved in the response to UV- and methylation-induced DNA damage in Saccharomyces cerevisiae.", "journal": "Molecular & general genetics : MGG", "date": "2000-06", "authors": "Interthal H, Heyer W D", "reference": { "type": "PubMed", "id": "10905349", "url": "https://pubmed.ncbi.nlm.nih.gov/10905349" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q04149-1", "protein_name": "Crossover junction endonuclease MUS81", "gene_name": "MUS81", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "Q04149", "url": "https://www.uniprot.org/uniprotkb/Q04149" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.10905349", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Requirement for three novel protein complexes in the absence of the Sgs1 DNA helicase in Saccharomyces cerevisiae.", "journal": "Genetics", "date": "2001-01", "authors": "Mullen J R, Kaliraman V, Ibrahim S S, Brill S J", "reference": { "type": "PubMed", "id": "11139495", "url": "https://pubmed.ncbi.nlm.nih.gov/11139495" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q04149-1", "protein_name": "Crossover junction endonuclease MUS81", "gene_name": "MUS81", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P32828-1", "protein_name": "E3 ubiquitin-protein ligase complex SLX5-SLX8 subunit SLX5", "gene_name": "SLX5", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P40072-1", "protein_name": "E3 ubiquitin-protein ligase complex SLX5-SLX8 subunit SLX8", "gene_name": "SLX8", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P38324-1", "protein_name": "Structure-specific endonuclease subunit SLX1", "gene_name": "SLX1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P38257-1", "protein_name": "Crossover junction endonuclease MMS4", "gene_name": "MMS4", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q12098-1", "protein_name": "Structure-specific endonuclease subunit SLX4", "gene_name": "SLX4", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "Q04149", "url": "https://www.uniprot.org/uniprotkb/Q04149" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.11139495", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 6 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Functional overlap between Sgs1-Top3 and the Mms4-Mus81 endonuclease.", "journal": "Genes & development", "date": "2001-10-15", "authors": "Kaliraman V, Mullen J R, Fricke W M, Bastin-Shanower S A, Brill S J", "reference": { "type": "PubMed", "id": "11641278", "url": "https://pubmed.ncbi.nlm.nih.gov/11641278" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q04149-1", "protein_name": "Crossover junction endonuclease MUS81", "gene_name": "MUS81", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P38257-1", "protein_name": "Crossover junction endonuclease MMS4", "gene_name": "MMS4", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "Q04149", "url": "https://www.uniprot.org/uniprotkb/Q04149" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.11641278", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Cleavage of model replication forks by fission yeast Mus81-Eme1 and budding yeast Mus81-Mms4.", "journal": "The Journal of biological chemistry", "date": "2003-02-28", "authors": "Whitby Matthew C, Osman Fekret, Dixon Julie", "reference": { "type": "PubMed", "id": "12473680", "url": "https://pubmed.ncbi.nlm.nih.gov/12473680" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q04149-1", "protein_name": "Crossover junction endonuclease MUS81", "gene_name": "MUS81", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P38257-1", "protein_name": "Crossover junction endonuclease MMS4", "gene_name": "MMS4", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "Q04149", "url": "https://www.uniprot.org/uniprotkb/Q04149" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.12473680", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Alternate pathways involving Sgs1/Top3, Mus81/ Mms4, and Srs2 prevent formation of toxic recombination intermediates from single-stranded gaps created by DNA replication.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2002-12-24", "authors": "Fabre Francis, Chan Allan, Heyer Wolf-Dietrich, Gangloff Serge", "reference": { "type": "PubMed", "id": "12475932", "url": "https://pubmed.ncbi.nlm.nih.gov/12475932" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q04149-1", "protein_name": "Crossover junction endonuclease MUS81", "gene_name": "MUS81", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P38257-1", "protein_name": "Crossover junction endonuclease MMS4", "gene_name": "MMS4", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "Q04149", "url": "https://www.uniprot.org/uniprotkb/Q04149" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.12475932", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The mechanism of Mus81-Mms4 cleavage site selection distinguishes it from the homologous endonuclease Rad1-Rad10.", "journal": "Molecular and cellular biology", "date": "2003-05", "authors": "Bastin-Shanower Suzanne A, Fricke William M, Mullen Janet R, Brill Steven J", "reference": { "type": "PubMed", "id": "12724407", "url": "https://pubmed.ncbi.nlm.nih.gov/12724407" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q04149-1", "protein_name": "Crossover junction endonuclease MUS81", "gene_name": "MUS81", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P38257-1", "protein_name": "Crossover junction endonuclease MMS4", "gene_name": "MMS4", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "Q04149", "url": "https://www.uniprot.org/uniprotkb/Q04149" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.12724407", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The Mus81/Mms4 endonuclease acts independently of double-Holliday junction resolution to promote a distinct subset of crossovers during meiosis in budding yeast.", "journal": "Genetics", "date": "2003-05", "authors": "de los Santos Teresa, Hunter Neil, Lee Cindy, Larkin Brittany, Loidl Josef, Hollingsworth Nancy M", "reference": { "type": "PubMed", "id": "12750322", "url": "https://pubmed.ncbi.nlm.nih.gov/12750322" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q04149-1", "protein_name": "Crossover junction endonuclease MUS81", "gene_name": "MUS81", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P38257-1", "protein_name": "Crossover junction endonuclease MMS4", "gene_name": "MMS4", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "Q04149", "url": "https://www.uniprot.org/uniprotkb/Q04149" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "mutagenesis": [ { "start_pos": 414, "end_pos": 415, "sequence_org": "DD", "sequence_mut": "AA", "comment": "In allele MUS81-DD; abrogates endonuclease activity.", "evidence": [ { "database": "UniProtKB", "id": "Q04149", "url": "https://www.uniprot.org/uniprotkb/Q04149" }, { "database": "PubMed", "id": "12750322", "url": "https://pubmed.ncbi.nlm.nih.gov/12750322" } ], "uniprot_canonical_ac": "Q04149-1" } ], "record_id": "pubmed.12750322", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Functional domains required for the Saccharomyces cerevisiae Mus81-Mms4 endonuclease complex formation and nuclear localization.", "journal": "DNA repair", "date": "2003-12-09", "authors": "Fu Yu, Xiao Wei", "reference": { "type": "PubMed", "id": "14642571", "url": "https://pubmed.ncbi.nlm.nih.gov/14642571" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q04149-1", "protein_name": "Crossover junction endonuclease MUS81", "gene_name": "MUS81", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P38257-1", "protein_name": "Crossover junction endonuclease MMS4", "gene_name": "MMS4", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "Q04149", "url": "https://www.uniprot.org/uniprotkb/Q04149" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.14642571", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The Mus81 solution to resolution: generating meiotic crossovers without Holliday junctions.", "journal": "Genes Dev.", "date": "2004", "authors": "Hollingsworth Nancy M, Brill Steven J", "reference": { "type": "PubMed", "id": "14752007", "url": "https://pubmed.ncbi.nlm.nih.gov/14752007" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q04149-1", "protein_name": "Crossover junction endonuclease MUS81", "gene_name": "MUS81", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P38257-1", "protein_name": "Crossover junction endonuclease MMS4", "gene_name": "MMS4", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "Q04149", "url": "https://www.uniprot.org/uniprotkb/Q04149" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.14752007", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Substrate specificity of the Saccharomyces cerevisiae Mus81-Mms4 endonuclease.", "journal": "DNA repair", "date": "2005-02-03", "authors": "Fricke William M, Bastin-Shanower Suzanne A, Brill Steven J", "reference": { "type": "PubMed", "id": "15590332", "url": "https://pubmed.ncbi.nlm.nih.gov/15590332" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q04149-1", "protein_name": "Crossover junction endonuclease MUS81", "gene_name": "MUS81", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P38257-1", "protein_name": "Crossover junction endonuclease MMS4", "gene_name": "MMS4", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "Q04149", "url": "https://www.uniprot.org/uniprotkb/Q04149" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.15590332", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Roles of SGS1, MUS81, and RAD51 in the repair of lagging-strand replication defects in Saccharomyces cerevisiae.", "journal": "Current genetics", "date": "2005-10", "authors": "Ii Miki, Brill Steven J", "reference": { "type": "PubMed", "id": "16193328", "url": "https://pubmed.ncbi.nlm.nih.gov/16193328" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q04149-1", "protein_name": "Crossover junction endonuclease MUS81", "gene_name": "MUS81", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q05635-1", "protein_name": "Ribonuclease H2 subunit B", "gene_name": "RNH202", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "Q04149", "url": "https://www.uniprot.org/uniprotkb/Q04149" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.16193328", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Dhr1p, a putative DEAH-box RNA helicase, is associated with the box C+D snoRNP U3.", "journal": "Molecular and cellular biology", "date": "2000-10", "authors": "Colley A, Beggs J D, Tollervey D, Lafontaine D L", "reference": { "type": "PubMed", "id": "10982841", "url": "https://pubmed.ncbi.nlm.nih.gov/10982841" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q04217-1", "protein_name": "Probable ATP-dependent RNA helicase DHR1", "gene_name": "ECM16", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P36009-1", "protein_name": "Probable ATP-dependent RNA helicase DHR2", "gene_name": "DHR2", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "Q04217", "url": "https://www.uniprot.org/uniprotkb/Q04217" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.10982841", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "A family of small coiled-coil-forming proteins functioning at the late endosome in yeast.", "journal": "Molecular biology of the cell", "date": "2001-03", "authors": "Kranz A, Kinner A, K\u00f6lling R", "reference": { "type": "PubMed", "id": "11251082", "url": "https://pubmed.ncbi.nlm.nih.gov/11251082" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q04272-1", "protein_name": "Vacuolar protein sorting-associated protein 20", "gene_name": "VPS20", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "Q04272", "url": "https://www.uniprot.org/uniprotkb/Q04272" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.11251082", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Escrt-III: an endosome-associated heterooligomeric protein complex required for mvb sorting.", "journal": "Developmental cell", "date": "2002-08", "authors": "Babst Markus, Katzmann David J, Estepa-Sabal Eden J, Meerloo Timo, Emr Scott D", "reference": { "type": "PubMed", "id": "12194857", "url": "https://pubmed.ncbi.nlm.nih.gov/12194857" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q04272-1", "protein_name": "Vacuolar protein sorting-associated protein 20", "gene_name": "VPS20", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P36095-1", "protein_name": "Vacuolar protein-sorting-associated protein 24", "gene_name": "VPS24", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P36108-1", "protein_name": "DOA4-independent degradation protein 4", "gene_name": "DID4", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P39929-1", "protein_name": "Vacuolar-sorting protein SNF7", "gene_name": "SNF7", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "Q04272", "url": "https://www.uniprot.org/uniprotkb/Q04272" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "mutagenesis": [ { "start_pos": 2, "end_pos": 2, "sequence_org": "G", "sequence_mut": "A", "comment": "Loss of membrane association.", "evidence": [ { "database": "UniProtKB", "id": "Q04272", "url": "https://www.uniprot.org/uniprotkb/Q04272" }, { "database": "PubMed", "id": "12194857", "url": "https://pubmed.ncbi.nlm.nih.gov/12194857" } ], "uniprot_canonical_ac": "Q04272-1" } ], "record_id": "pubmed.12194857", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 4 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Vps20p and Vta1p interact with Vps4p and function in multivesicular body sorting and endosomal transport in Saccharomyces cerevisiae.", "journal": "Journal of cell science", "date": "2003-10-01", "authors": "Yeo Sebastian C L, Xu Linghui, Ren Jihui, Boulton Victoria J, Wagle Mahendra D, Liu Cong, Ren Gang, Wong Peisze, Zahn Regina, Sasajala Piriya, Yang Hongyuan, Piper Robert C, Munn Alan L", "reference": { "type": "PubMed", "id": "12953057", "url": "https://pubmed.ncbi.nlm.nih.gov/12953057" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q04272-1", "protein_name": "Vacuolar protein sorting-associated protein 20", "gene_name": "VPS20", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q06263-1", "protein_name": "Vacuolar protein sorting-associated protein VTA1", "gene_name": "VTA1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P52917-1", "protein_name": "Vacuolar protein sorting-associated protein 4", "gene_name": "VPS4", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "Q04272", "url": "https://www.uniprot.org/uniprotkb/Q04272" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.12953057", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Multivesicular body-ESCRT components function in pH response regulation in Saccharomyces cerevisiae and Candida albicans.", "journal": "Molecular biology of the cell", "date": "2004-12", "authors": "Xu Wenjie, Smith Frank J, Subaran Ryan, Mitchell Aaron P", "reference": { "type": "PubMed", "id": "15371534", "url": "https://pubmed.ncbi.nlm.nih.gov/15371534" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q04272-1", "protein_name": "Vacuolar protein sorting-associated protein 20", "gene_name": "VPS20", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q12033-1", "protein_name": "pH-response regulator protein palA/RIM20", "gene_name": "RIM20", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "Q04272", "url": "https://www.uniprot.org/uniprotkb/Q04272" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.15371534", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Structural characterization of the ATPase reaction cycle of endosomal AAA protein Vps4.", "journal": "J. Mol. Biol.", "date": "2007", "authors": "Xiao Junyu, Xia Hengchuan, Yoshino-Koh Kae, Zhou Jiahai, Xu Zhaohui", "reference": { "type": "PubMed", "id": "17949747", "url": "https://pubmed.ncbi.nlm.nih.gov/17949747" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q04272-1", "protein_name": "Vacuolar protein sorting-associated protein 20", "gene_name": "VPS20", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P36108-1", "protein_name": "DOA4-independent degradation protein 4", "gene_name": "DID4", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P52917-1", "protein_name": "Vacuolar protein sorting-associated protein 4", "gene_name": "VPS4", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "Q04272", "url": "https://www.uniprot.org/uniprotkb/Q04272" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.17949747", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "A role for Saccharomyces cerevisiae fatty acid activation protein 4 in regulating protein N-myristoylation during entry into stationary phase.", "journal": "J. Biol. Chem.", "date": "1998", "authors": "Ashrafi K, Farazi T A, Gordon J I", "reference": { "type": "PubMed", "id": "9748261", "url": "https://pubmed.ncbi.nlm.nih.gov/9748261" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q04272-1", "protein_name": "Vacuolar protein sorting-associated protein 20", "gene_name": "VPS20", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "Q04272", "url": "https://www.uniprot.org/uniprotkb/Q04272" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.9748261", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Shr3p mediates specific COPII coatomer-cargo interactions required for the packaging of amino acid permeases into ER-derived transport vesicles.", "journal": "Mol. Biol. Cell", "date": "1999", "authors": "Gilstring C F, Melin-Larsson M, Ljungdahl P O", "reference": { "type": "PubMed", "id": "10564255", "url": "https://pubmed.ncbi.nlm.nih.gov/10564255" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q04491-1", "protein_name": "Protein transport protein SEC13", "gene_name": "SEC13", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P38968-1", "protein_name": "Protein transport protein SEC31", "gene_name": "SEC31", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P40482-1", "protein_name": "Protein transport protein SEC24", "gene_name": "SEC24", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P15303-1", "protein_name": "Protein transport protein SEC23", "gene_name": "SEC23", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "Q04491", "url": "https://www.uniprot.org/uniprotkb/Q04491" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.10564255", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 4 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The use of liposomes to study COPII- and COPI-coated vesicle formation and membrane protein sorting.", "journal": "Methods (San Diego, Calif.)", "date": "2000-04", "authors": "Matsuoka K, Schekman R", "reference": { "type": "PubMed", "id": "10720463", "url": "https://pubmed.ncbi.nlm.nih.gov/10720463" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q04491-1", "protein_name": "Protein transport protein SEC13", "gene_name": "SEC13", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P20606-1", "protein_name": "Small COPII coat GTPase SAR1", "gene_name": "SAR1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P38968-1", "protein_name": "Protein transport protein SEC31", "gene_name": "SEC31", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P40482-1", "protein_name": "Protein transport protein SEC24", "gene_name": "SEC24", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P15303-1", "protein_name": "Protein transport protein SEC23", "gene_name": "SEC23", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "Q04491", "url": "https://www.uniprot.org/uniprotkb/Q04491" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.10720463", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 5 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Structure and assembly of the Nup84p complex.", "journal": "The Journal of cell biology", "date": "2000-04-03", "authors": "Siniossoglou S, Lutzmann M, Santos-Rosa H, Leonard K, Mueller S, Aebi U, Hurt E", "reference": { "type": "PubMed", "id": "10747086", "url": "https://pubmed.ncbi.nlm.nih.gov/10747086" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q04491-1", "protein_name": "Protein transport protein SEC13", "gene_name": "SEC13", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "Q04491", "url": "https://www.uniprot.org/uniprotkb/Q04491" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.10747086", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Dynamics of the COPII coat with GTP and stable analogues.", "journal": "Nat. Cell Biol.", "date": "2001", "authors": "Antonny B, Madden D, Hamamoto S, Orci L, Schekman R", "reference": { "type": "PubMed", "id": "11389436", "url": "https://pubmed.ncbi.nlm.nih.gov/11389436" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q04491-1", "protein_name": "Protein transport protein SEC13", "gene_name": "SEC13", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P20606-1", "protein_name": "Small COPII coat GTPase SAR1", "gene_name": "SAR1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P38968-1", "protein_name": "Protein transport protein SEC31", "gene_name": "SEC31", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P40482-1", "protein_name": "Protein transport protein SEC24", "gene_name": "SEC24", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P15303-1", "protein_name": "Protein transport protein SEC23", "gene_name": "SEC23", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "Q04491", "url": "https://www.uniprot.org/uniprotkb/Q04491" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.11389436", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 5 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Structure of the Sec23p/24p and Sec13p/31p complexes of COPII.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2001-09-11", "authors": "Lederkremer G Z, Cheng Y, Petre B M, Vogan E, Springer S, Schekman R, Walz T, Kirchhausen T", "reference": { "type": "PubMed", "id": "11535824", "url": "https://pubmed.ncbi.nlm.nih.gov/11535824" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q04491-1", "protein_name": "Protein transport protein SEC13", "gene_name": "SEC13", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P38968-1", "protein_name": "Protein transport protein SEC31", "gene_name": "SEC31", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P40482-1", "protein_name": "Protein transport protein SEC24", "gene_name": "SEC24", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P15303-1", "protein_name": "Protein transport protein SEC23", "gene_name": "SEC23", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "Q04491", "url": "https://www.uniprot.org/uniprotkb/Q04491" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.11535824", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 4 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Distinct roles for the cytoplasmic tail sequences of Emp24p and Erv25p in transport between the endoplasmic reticulum and Golgi complex.", "journal": "J. Biol. Chem.", "date": "2001", "authors": "Belden W J, Barlowe C", "reference": { "type": "PubMed", "id": "11560939", "url": "https://pubmed.ncbi.nlm.nih.gov/11560939" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q04491-1", "protein_name": "Protein transport protein SEC13", "gene_name": "SEC13", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P32803-1", "protein_name": "Endosomal protein P24B", "gene_name": "EMP24", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P54837-1", "protein_name": "Endoplasmic reticulum vesicle protein 25", "gene_name": "ERV25", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P20606-1", "protein_name": "Small COPII coat GTPase SAR1", "gene_name": "SAR1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P38968-1", "protein_name": "Protein transport protein SEC31", "gene_name": "SEC31", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P40482-1", "protein_name": "Protein transport protein SEC24", "gene_name": "SEC24", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P15303-1", "protein_name": "Protein transport protein SEC23", "gene_name": "SEC23", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "Q04491", "url": "https://www.uniprot.org/uniprotkb/Q04491" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "mutagenesis": [ { "start_pos": 202, "end_pos": 203, "sequence_org": "LV", "sequence_mut": "AA", "comment": "No change in COPII-binding.", "evidence": [ { "database": "UniProtKB", "id": "P32803", "url": "https://www.uniprot.org/uniprotkb/P32803" }, { "database": "PubMed", "id": "11560939", "url": "https://pubmed.ncbi.nlm.nih.gov/11560939" } ], "uniprot_canonical_ac": "P32803-1" }, { "start_pos": 206, "end_pos": 208, "sequence_org": "KTK", "sequence_mut": "ATA", "comment": "Decrease in COPI-binding.", "evidence": [ { "database": "UniProtKB", "id": "P54837", "url": "https://www.uniprot.org/uniprotkb/P54837" }, { "database": "PubMed", "id": "11560939", "url": "https://pubmed.ncbi.nlm.nih.gov/11560939" } ], "uniprot_canonical_ac": "P54837-1" } ], "record_id": "pubmed.11560939", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 7 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Surface structure of the COPII-coated vesicle.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2001-11-20", "authors": "Matsuoka K, Schekman R, Orci L, Heuser J E", "reference": { "type": "PubMed", "id": "11717432", "url": "https://pubmed.ncbi.nlm.nih.gov/11717432" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q04491-1", "protein_name": "Protein transport protein SEC13", "gene_name": "SEC13", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P38968-1", "protein_name": "Protein transport protein SEC31", "gene_name": "SEC31", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P40482-1", "protein_name": "Protein transport protein SEC24", "gene_name": "SEC24", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P15303-1", "protein_name": "Protein transport protein SEC23", "gene_name": "SEC23", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "Q04491", "url": "https://www.uniprot.org/uniprotkb/Q04491" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.11717432", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 4 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Isolation and characterization of new Saccharomyces cerevisiae mutants perturbed in nuclear pore complex assembly.", "journal": "BMC genetics", "date": "2002", "authors": "Ryan KJ, Wente SR", "reference": { "type": "PubMed", "id": "12215173", "url": "https://pubmed.ncbi.nlm.nih.gov/12215173" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q04491-1", "protein_name": "Protein transport protein SEC13", "gene_name": "SEC13", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "Q04491", "url": "https://www.uniprot.org/uniprotkb/Q04491" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "mutagenesis": [ { "start_pos": 176, "end_pos": 176, "sequence_org": "G", "sequence_mut": "R", "comment": "Leads to mislocalization of NPCs and overproliferation of the nuclear and ER membranes at 34 degrees Celsius.", "evidence": [ { "database": "UniProtKB", "id": "Q04491", "url": "https://www.uniprot.org/uniprotkb/Q04491" }, { "database": "PubMed", "id": "12215173", "url": "https://pubmed.ncbi.nlm.nih.gov/12215173" } ], "uniprot_canonical_ac": "Q04491-1" } ], "record_id": "pubmed.12215173", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Selective protein exit from yeast endoplasmic reticulum in absence of functional COPII coat component Sec13p.", "journal": "Molecular biology of the cell", "date": "2002-12", "authors": "Fatal Netta, Suntio Taina, Makarow Marja", "reference": { "type": "PubMed", "id": "12475940", "url": "https://pubmed.ncbi.nlm.nih.gov/12475940" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q04491-1", "protein_name": "Protein transport protein SEC13", "gene_name": "SEC13", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "Q04491", "url": "https://www.uniprot.org/uniprotkb/Q04491" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.12475940", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] } ]