[ { "title": "The Yeast DNA Damage Checkpoint Kinase Rad53 Targets the Exoribonuclease, Xrn1.", "journal": "G3 (Bethesda, Md.)", "date": "2018-12-10", "authors": "Lao Jessica P, Ulrich Katie M, Johnson Jeffrey R, Newton Billy W, Vashisht Ajay A, Wohlschlegel James A, Krogan Nevan J, Toczyski David P", "reference": { "type": "PubMed", "id": "30377154", "url": "https://pubmed.ncbi.nlm.nih.gov/30377154" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P48164-1", "protein_name": "Small ribosomal subunit protein eS7B", "gene_name": "RPS7B", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P53685-1", "protein_name": "NAD-dependent protein deacetylase HST1", "gene_name": "HST1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P47019-1", "protein_name": "Ribosome biogenesis protein ALB1", "gene_name": "ALB1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q12211-1", "protein_name": "tRNA pseudouridine synthase 1", "gene_name": "PUS1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P22147-1", "protein_name": "5'-3' exoribonuclease 1", "gene_name": "XRN1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P05374-1", "protein_name": "Phosphatidylethanolamine N-methyltransferase", "gene_name": "CHO2", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P06105-1", "protein_name": "Protein SCP160", "gene_name": "SCP160", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P06634-1", "protein_name": "ATP-dependent RNA helicase DED1", "gene_name": "DED1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P17555-1", "protein_name": "Adenylyl cyclase-associated protein", "gene_name": "SRV2", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P32481-1", "protein_name": "Eukaryotic translation initiation factor 2 subunit gamma", "gene_name": "GCD11", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P36124-1", "protein_name": "Histone reader SET3", "gene_name": "SET3", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P48164", "url": "https://www.uniprot.org/uniprotkb/P48164" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "phosphorylation": [ { "start_pos": 168, "end_pos": 168, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "SGD", "id": "S000005040", "url": "https://www.yeastgenome.org/locus/S000005040" }, { "database": "iPTMnet", "id": "P48164", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P48164" }, { "database": "PubMed", "id": "30377154", "url": "https://pubmed.ncbi.nlm.nih.gov/30377154" } ], "site_lbl": "Ser168", "uniprot_canonical_ac": "P48164-1" }, { "start_pos": 143, "end_pos": 143, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "SGD", "id": "S000005429", "url": "https://www.yeastgenome.org/locus/S000005429" }, { "database": "iPTMnet", "id": "P53685", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P53685" }, { "database": "PubMed", "id": "23749301", "url": "https://pubmed.ncbi.nlm.nih.gov/23749301" }, { "database": "PubMed", "id": "30377154", "url": "https://pubmed.ncbi.nlm.nih.gov/30377154" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" } ], "site_lbl": "Ser143", "uniprot_canonical_ac": "P53685-1" }, { "start_pos": 41, "end_pos": 41, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "SGD", "id": "S000003658", "url": "https://www.yeastgenome.org/locus/S000003658" }, { "database": "iPTMnet", "id": "P47019", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P47019" }, { "database": "PubMed", "id": "30377154", "url": "https://pubmed.ncbi.nlm.nih.gov/30377154" } ], "site_lbl": "Ser41", "uniprot_canonical_ac": "P47019-1" }, { "start_pos": 478, "end_pos": 478, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "SGD", "id": "S000006133", "url": "https://www.yeastgenome.org/locus/S000006133" }, { "database": "iPTMnet", "id": "Q12211", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q12211" }, { "database": "PubMed", "id": "30377154", "url": "https://pubmed.ncbi.nlm.nih.gov/30377154" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" } ], "site_lbl": "Ser478", "uniprot_canonical_ac": "Q12211-1" }, { "start_pos": 1467, "end_pos": 1467, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P22147", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P22147" }, { "database": "PubMed", "id": "30377154", "url": "https://pubmed.ncbi.nlm.nih.gov/30377154" }, { "database": "SGD", "id": "S000003141", "url": "https://www.yeastgenome.org/locus/S000003141" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" } ], "site_lbl": "Ser1467", "uniprot_canonical_ac": "P22147-1" }, { "start_pos": 598, "end_pos": 598, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "SGD", "id": "S000003389", "url": "https://www.yeastgenome.org/locus/S000003389" }, { "database": "iPTMnet", "id": "P05374", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05374" }, { "database": "PubMed", "id": "30377154", "url": "https://pubmed.ncbi.nlm.nih.gov/30377154" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" } ], "site_lbl": "Ser598", "uniprot_canonical_ac": "P05374-1" }, { "start_pos": 325, "end_pos": 325, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P06105", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P06105" }, { "database": "PubMed", "id": "18407956", "url": "https://pubmed.ncbi.nlm.nih.gov/18407956" }, { "database": "SGD", "id": "S000003616", "url": "https://www.yeastgenome.org/locus/S000003616" }, { "database": "PubMed", "id": "30377154", "url": "https://pubmed.ncbi.nlm.nih.gov/30377154" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" } ], "site_lbl": "Ser325", "uniprot_canonical_ac": "P06105-1" }, { "start_pos": 218, "end_pos": 218, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P06634", "url": "https://www.uniprot.org/uniprotkb/P06634" }, { "database": "PubMed", "id": "19779198", "url": "https://pubmed.ncbi.nlm.nih.gov/19779198" }, { "database": "iPTMnet", "id": "P06634", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P06634" }, { "database": "SGD", "id": "S000005730", "url": "https://www.yeastgenome.org/locus/S000005730" }, { "database": "PubMed", "id": "30377154", "url": "https://pubmed.ncbi.nlm.nih.gov/30377154" }, { "database": "PubMed", "id": "33481703", "url": "https://pubmed.ncbi.nlm.nih.gov/33481703" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" } ], "site_lbl": "Ser218", "uniprot_canonical_ac": "P06634-1" }, { "start_pos": 343, "end_pos": 343, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "SGD", "id": "S000005082", "url": "https://www.yeastgenome.org/locus/S000005082" }, { "database": "iPTMnet", "id": "P17555", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P17555" }, { "database": "PubMed", "id": "30377154", "url": "https://pubmed.ncbi.nlm.nih.gov/30377154" }, { "database": "PubMed", "id": "32597660", "url": "https://pubmed.ncbi.nlm.nih.gov/32597660" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" } ], "site_lbl": "Ser343", "uniprot_canonical_ac": "P17555-1" }, { "start_pos": 346, "end_pos": 346, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "SGD", "id": "S000005082", "url": "https://www.yeastgenome.org/locus/S000005082" }, { "database": "iPTMnet", "id": "P17555", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P17555" }, { "database": "PubMed", "id": "30377154", "url": "https://pubmed.ncbi.nlm.nih.gov/30377154" }, { "database": "PubMed", "id": "32597660", "url": "https://pubmed.ncbi.nlm.nih.gov/32597660" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" } ], "site_lbl": "Ser346", "uniprot_canonical_ac": "P17555-1" }, { "start_pos": 258, "end_pos": 258, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P32481", "url": "https://www.uniprot.org/uniprotkb/P32481" }, { "database": "PubMed", "id": "18407956", "url": "https://pubmed.ncbi.nlm.nih.gov/18407956" }, { "database": "PubMed", "id": "17287358", "url": "https://pubmed.ncbi.nlm.nih.gov/17287358" }, { "database": "iPTMnet", "id": "P32481", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P32481" }, { "database": "PubMed", "id": "19779198", "url": "https://pubmed.ncbi.nlm.nih.gov/19779198" }, { "database": "SGD", "id": "S000000827", "url": "https://www.yeastgenome.org/locus/S000000827" }, { "database": "PubMed", "id": "30377154", "url": "https://pubmed.ncbi.nlm.nih.gov/30377154" }, { "database": "PubMed", "id": "33481703", "url": "https://pubmed.ncbi.nlm.nih.gov/33481703" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" } ], "site_lbl": "Ser258", "uniprot_canonical_ac": "P32481-1" }, { "start_pos": 741, "end_pos": 741, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P36124", "url": "https://www.uniprot.org/uniprotkb/P36124" }, { "database": "PubMed", "id": "18407956", "url": "https://pubmed.ncbi.nlm.nih.gov/18407956" }, { "database": "iPTMnet", "id": "P36124", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P36124" }, { "database": "PubMed", "id": "19779198", "url": "https://pubmed.ncbi.nlm.nih.gov/19779198" }, { "database": "SGD", "id": "S000001737", "url": "https://www.yeastgenome.org/locus/S000001737" }, { "database": "PubMed", "id": "30377154", "url": "https://pubmed.ncbi.nlm.nih.gov/30377154" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" } ], "site_lbl": "Ser741", "uniprot_canonical_ac": "P36124-1" } ], "record_id": "pubmed.30377154", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 11 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 12 }, { "field": "total_sites", "count": 12 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Collided ribosomes form a unique structural interface to induce Hel2-driven quality control\u00a0pathways.", "journal": "The EMBO journal", "date": "2019-03-01", "authors": "Ikeuchi Ken, Tesina Petr, Matsuo Yoshitaka, Sugiyama Takato, Cheng Jingdong, Saeki Yasushi, Tanaka Keiji, Becker Thomas, Beckmann Roland, Inada Toshifumi", "reference": { "type": "PubMed", "id": "30609991", "url": "https://pubmed.ncbi.nlm.nih.gov/30609991" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P48164-1", "protein_name": "Small ribosomal subunit protein eS7B", "gene_name": "RPS7B", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q05580-1", "protein_name": "E3 ubiquitin-protein ligase HEL2", "gene_name": "HEL2", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P38701-1", "protein_name": "Small ribosomal subunit protein uS10", "gene_name": "RPS20", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P26786-1", "protein_name": "Small ribosomal subunit protein eS7A", "gene_name": "RPS7A", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P34909-1", "protein_name": "General negative regulator of transcription subunit 4", "gene_name": "MOT2", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P48164", "url": "https://www.uniprot.org/uniprotkb/P48164" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "mutagenesis": [ { "start_pos": 64, "end_pos": 67, "sequence_org": "CVIC", "sequence_mut": "AVIA", "comment": "Abolished E3 ubiquitin-protein ligase activity and ability to activate the ribosome quality control (RQC) and No-Go Decay (NGD) pathways.", "evidence": [ { "database": "UniProtKB", "id": "Q05580", "url": "https://www.uniprot.org/uniprotkb/Q05580" }, { "database": "PubMed", "id": "30609991", "url": "https://pubmed.ncbi.nlm.nih.gov/30609991" } ], "uniprot_canonical_ac": "Q05580-1" } ], "record_id": "pubmed.30609991", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 5 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Sequence analysis of a 14.2 kb fragment of Saccharomyces cerevisiae chromosome XIV that includes the ypt53, tRNALeu and gsr m2 genes and four new open reading frames.", "journal": "Yeast", "date": "1996", "authors": "Garcia-Cantalejo J M, Boskovic J, Jimenez A", "reference": { "type": "PubMed", "id": "8771715", "url": "https://pubmed.ncbi.nlm.nih.gov/8771715" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P48164-1", "protein_name": "Small ribosomal subunit protein eS7B", "gene_name": "RPS7B", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P50947-1", "protein_name": "Transcriptional regulatory protein PHO23", "gene_name": "PHO23", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P53932-1", "protein_name": "Uncharacterized transporter YNL095C", "gene_name": "N2215", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P36019-1", "protein_name": "GTP-binding protein YPT53", "gene_name": "YPT53", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P53935-1", "protein_name": "Stress response protein NST1", "gene_name": "NST1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P53934-1", "protein_name": "Carnosine N-methyltransferase", "gene_name": "N2227", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P53933-1", "protein_name": "Phosphatidate phosphatase APP1", "gene_name": "APP1", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P48164", "url": "https://www.uniprot.org/uniprotkb/P48164" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.8771715", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 7 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The tricalbin C2 domains: lipid-binding properties of a novel, synaptotagmin-like yeast protein family.", "journal": "Biochemistry", "date": "2004-04-06", "authors": "Schulz Timothy A, Creutz Carl E", "reference": { "type": "PubMed", "id": "15049706", "url": "https://pubmed.ncbi.nlm.nih.gov/15049706" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P48231-1", "protein_name": "Tricalbin-2", "gene_name": "TCB2", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q12466-1", "protein_name": "Tricalbin-1", "gene_name": "TCB1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q03640-1", "protein_name": "Tricalbin-3", "gene_name": "TCB3", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P48231", "url": "https://www.uniprot.org/uniprotkb/P48231" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.15049706", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Characterization of the yeast tricalbins: membrane-bound multi-C2-domain proteins that form complexes involved in membrane trafficking.", "journal": "Cellular and molecular life sciences : CMLS", "date": "2004-05", "authors": "Creutz C E, Snyder S L, Schulz T A", "reference": { "type": "PubMed", "id": "15141306", "url": "https://pubmed.ncbi.nlm.nih.gov/15141306" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P48231-1", "protein_name": "Tricalbin-2", "gene_name": "TCB2", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q12466-1", "protein_name": "Tricalbin-1", "gene_name": "TCB1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q03640-1", "protein_name": "Tricalbin-3", "gene_name": "TCB3", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P48231", "url": "https://www.uniprot.org/uniprotkb/P48231" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.15141306", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Topology models for 37 Saccharomyces cerevisiae membrane proteins based on C-terminal reporter fusions and predictions.", "journal": "J. Biol. Chem.", "date": "2003", "authors": "Kim Hyun, Mel\u00e9n Karin, von Heijne Gunnar", "reference": { "type": "PubMed", "id": "12524434", "url": "https://pubmed.ncbi.nlm.nih.gov/12524434" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P48236-1", "protein_name": "Glycerophosphocholine acyltransferase 1", "gene_name": "GPC1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P38842-1", "protein_name": "UPF0641 membrane protein YHR140W", "gene_name": "", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q03193-1", "protein_name": "Uncharacterized membrane protein YDR090C", "gene_name": "", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q08900-1", "protein_name": "Uncharacterized membrane protein YOR376W", "gene_name": "O6736", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q08980-1", "protein_name": "Probable transport protein YPL264C", "gene_name": "", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q12253-1", "protein_name": "Uncharacterized membrane protein YLR046C", "gene_name": "L2111", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q06058-1", "protein_name": "Seipin", "gene_name": "SEI1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q07824-1", "protein_name": "Polyamine transporter 1", "gene_name": "TPO1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P40100-1", "protein_name": "Protoporphyrin uptake protein 1", "gene_name": "PUG1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P56508-1", "protein_name": "Protein SNA2", "gene_name": "SNA2", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q04083-1", "protein_name": "Thiamine-repressible mitochondrial transport protein THI74", "gene_name": "THI74", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q06200-1", "protein_name": "Protein ECM7", "gene_name": "ECM7", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q99393-1", "protein_name": "ADIPOR-like receptor IZH4", "gene_name": "IZH4", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P0CD91-1", "protein_name": "Aquaporin-1", "gene_name": "AQY1", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P48236", "url": "https://www.uniprot.org/uniprotkb/P48236" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.12524434", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 14 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Identification of a novel GPCAT activity and a new pathway for phosphatidylcholine biosynthesis in S. cerevisiae.", "journal": "Journal of lipid research", "date": "2008-08", "authors": "St\u00e5lberg Kjell, Neal Andrea C, Ronne Hans, St\u00e5hl Ulf", "reference": { "type": "PubMed", "id": "18430972", "url": "https://pubmed.ncbi.nlm.nih.gov/18430972" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P48236-1", "protein_name": "Glycerophosphocholine acyltransferase 1", "gene_name": "GPC1", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P48236", "url": "https://www.uniprot.org/uniprotkb/P48236" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.18430972", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Cloning of Glycerophosphocholine Acyltransferase (GPCAT) from Fungi and Plants: A NOVEL ENZYME IN PHOSPHATIDYLCHOLINE SYNTHESIS.", "journal": "The Journal of biological chemistry", "date": "2016-11-25", "authors": "G\u0142\u0105b Bartosz, Beganovic Mirela, Anaokar Sanket, Hao Meng-Shu, Rasmusson Allan G, Patton-Vogt Jana, Bana\u015b Antoni, Stymne Sten, Lager Ida", "reference": { "type": "PubMed", "id": "27758859", "url": "https://pubmed.ncbi.nlm.nih.gov/27758859" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P48236-1", "protein_name": "Glycerophosphocholine acyltransferase 1", "gene_name": "GPC1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q9FJB4-1", "protein_name": "Glycerophosphocholine acyltransferase 1", "gene_name": "GPC1", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P48236", "url": "https://www.uniprot.org/uniprotkb/P48236" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.27758859", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The glycerophosphocholine acyltransferase Gpc1 is part of a phosphatidylcholine (PC)-remodeling pathway that alters PC species in yeast.", "journal": "The Journal of biological chemistry", "date": "2019-01-25", "authors": "Anaokar Sanket, Kodali Ravindra, Jonik Benjamin, Renne Mike F, Brouwers Jos F H M, Lager Ida, de Kroon Anton I P M, Patton-Vogt Jana", "reference": { "type": "PubMed", "id": "30514764", "url": "https://pubmed.ncbi.nlm.nih.gov/30514764" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P48236-1", "protein_name": "Glycerophosphocholine acyltransferase 1", "gene_name": "GPC1", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P48236", "url": "https://www.uniprot.org/uniprotkb/P48236" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.30514764", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Ccm1p/Ygr150cp, a pentatricopeptide repeat protein, is essential to remove the fourth intron of both COB and COX1 pre-mRNAs in Saccharomyces cerevisiae.", "journal": "Current genetics", "date": "2009-08", "authors": "Moreno J Ignacio, Buie Kimberley S, Price Rhonda E, Piva Marta A", "reference": { "type": "PubMed", "id": "19562342", "url": "https://pubmed.ncbi.nlm.nih.gov/19562342" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P48237-1", "protein_name": "Mitochondrial 15S rRNA processing factor CCM1", "gene_name": "CCM1", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P48237", "url": "https://www.uniprot.org/uniprotkb/P48237" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.19562342", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Genome-wide deletion mutant analysis reveals genes required for respiratory growth, mitochondrial genome maintenance and mitochondrial protein synthesis in Saccharomyces cerevisiae.", "journal": "Genome biology", "date": "2009", "authors": "Merz Sandra, Westermann Benedikt", "reference": { "type": "PubMed", "id": "19751518", "url": "https://pubmed.ncbi.nlm.nih.gov/19751518" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P48237-1", "protein_name": "Mitochondrial 15S rRNA processing factor CCM1", "gene_name": "CCM1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q08774-1", "protein_name": "Required for respiratory growth protein 7, mitochondrial", "gene_name": "RRG7", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q12167-1", "protein_name": "Required for respiratory growth protein 1, mitochondrial", "gene_name": "RRG1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q12393-1", "protein_name": "Genetic interactor of prohibitin 5, mitochondrial", "gene_name": "GEP5", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q3E7B2-1", "protein_name": "Cytochrome c oxidase assembly factor 3, mitochondrial", "gene_name": "COA3", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P40156-1", "protein_name": "Required for respiratory growth protein 9, mitochondrial", "gene_name": "RRG9", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q06109-1", "protein_name": "Required for respiratory growth protein 8, mitochondrial", "gene_name": "RRG8", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q07843-1", "protein_name": "Increased recombination centers protein 19", "gene_name": "IRC19", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q08622-1", "protein_name": "Genetic interactor of prohibitins 3, mitochondrial", "gene_name": "GEP3", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P48237", "url": "https://www.uniprot.org/uniprotkb/P48237" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.19751518", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 9 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "DMR1 (CCM1/YGR150C) of Saccharomyces cerevisiae encodes an RNA-binding protein from the pentatricopeptide repeat family required for the maintenance of the mitochondrial 15S ribosomal RNA.", "journal": "Genetics", "date": "2010-04", "authors": "Puchta Olga, Lubas Michal, Lipinski Kamil A, Piatkowski Jakub, Malecki Michal, Golik Pawel", "reference": { "type": "PubMed", "id": "20124025", "url": "https://pubmed.ncbi.nlm.nih.gov/20124025" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P48237-1", "protein_name": "Mitochondrial 15S rRNA processing factor CCM1", "gene_name": "CCM1", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P48237", "url": "https://www.uniprot.org/uniprotkb/P48237" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.20124025", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Revisiting the yeast PPR proteins--application of an Iterative Hidden Markov Model algorithm reveals new members of the rapidly evolving family.", "journal": "Molecular biology and evolution", "date": "2011-10", "authors": "Lipinski Kamil A, Puchta Olga, Surendranath Vineeth, Kudla Marek, Golik Pawel", "reference": { "type": "PubMed", "id": "21546354", "url": "https://pubmed.ncbi.nlm.nih.gov/21546354" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P48237-1", "protein_name": "Mitochondrial 15S rRNA processing factor CCM1", "gene_name": "CCM1", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P48237", "url": "https://www.uniprot.org/uniprotkb/P48237" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "mutagenesis": [ { "start_pos": 351, "end_pos": 351, "sequence_org": "T", "sequence_mut": "A", "comment": "In dmr1-2; mildly impairs respiratory growth and has almost wild-type mitochondrial protein synthesis; when associated with V-785.", "evidence": [ { "database": "UniProtKB", "id": "P48237", "url": "https://www.uniprot.org/uniprotkb/P48237" }, { "database": "PubMed", "id": "21546354", "url": "https://pubmed.ncbi.nlm.nih.gov/21546354" } ], "uniprot_canonical_ac": "P48237-1" }, { "start_pos": 785, "end_pos": 785, "sequence_org": "D", "sequence_mut": "V", "comment": "In dmr1-1; impairs respiratory growth and mitochondrial protein synthesis. In dmr1-2; mildly impairs respiratory growth and has almost wild-type mitochondrial protein synthesis; when associated with A-351.", "evidence": [ { "database": "UniProtKB", "id": "P48237", "url": "https://www.uniprot.org/uniprotkb/P48237" }, { "database": "PubMed", "id": "21546354", "url": "https://pubmed.ncbi.nlm.nih.gov/21546354" } ], "uniprot_canonical_ac": "P48237-1" } ], "record_id": "pubmed.21546354", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Two independent activities define Ccm1p as a moonlighting protein in Saccharomyces cerevisiae.", "journal": "Bioscience reports", "date": "2012-12", "authors": "Moreno J Ignacio, Patlolla Babu, Belton Kerry R, Jenkins Brenita C, Radchenkova Polina V, Piva Marta A", "reference": { "type": "PubMed", "id": "22861139", "url": "https://pubmed.ncbi.nlm.nih.gov/22861139" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P48237-1", "protein_name": "Mitochondrial 15S rRNA processing factor CCM1", "gene_name": "CCM1", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P48237", "url": "https://www.uniprot.org/uniprotkb/P48237" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.22861139", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Mitochondrial-nuclear co-evolution leads to hybrid incompatibility through pentatricopeptide repeat proteins.", "journal": "EMBO Rep.", "date": "2017", "authors": "Jhuang Han-Ying, Lee Hsin-Yi, Leu Jun-Yi", "reference": { "type": "PubMed", "id": "27920033", "url": "https://pubmed.ncbi.nlm.nih.gov/27920033" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P48237-1", "protein_name": "Mitochondrial 15S rRNA processing factor CCM1", "gene_name": "CCM1", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P48237", "url": "https://www.uniprot.org/uniprotkb/P48237" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.27920033", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Ccm1p is a 15S rRNA primary transcript processing factor as elucidated by a novel in vivo system in Saccharomyces cerevisiae.", "journal": "Current genetics", "date": "2020-08", "authors": "Moreno J Ignacio, Coleman Ineshia S, Johnson Classie L, Green Dominique S, Piva Marta A", "reference": { "type": "PubMed", "id": "32152734", "url": "https://pubmed.ncbi.nlm.nih.gov/32152734" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P48237-1", "protein_name": "Mitochondrial 15S rRNA processing factor CCM1", "gene_name": "CCM1", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P48237", "url": "https://www.uniprot.org/uniprotkb/P48237" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.32152734", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Yeast pentatricopeptide protein Dmr1 (Ccm1) binds a repetitive AU-rich motif in the small subunit mitochondrial ribosomal RNA.", "journal": "RNA", "date": "2020", "authors": "Pi\u0105tkowski Jakub, Golik Pawe\u0142", "reference": { "type": "PubMed", "id": "32467310", "url": "https://pubmed.ncbi.nlm.nih.gov/32467310" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P48237-1", "protein_name": "Mitochondrial 15S rRNA processing factor CCM1", "gene_name": "CCM1", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P48237", "url": "https://www.uniprot.org/uniprotkb/P48237" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.32467310", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Principles of mitoribosomal small subunit assembly in eukaryotes.", "journal": "Nature", "date": "2023-02", "authors": "Harper Nathan J, Burnside Chloe, Klinge Sebastian", "reference": { "type": "PubMed", "id": "36482135", "url": "https://pubmed.ncbi.nlm.nih.gov/36482135" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P48237-1", "protein_name": "Mitochondrial 15S rRNA processing factor CCM1", "gene_name": "CCM1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P36056-1", "protein_name": "Ribosome assembly protein RSM22, mitochondrial", "gene_name": "RSM22", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q8WVM0-1", "protein_name": "Dimethyladenosine transferase 1, mitochondrial", "gene_name": "TFB1M", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8IVS2-1", "protein_name": "Malonyl-CoA-acyl carrier protein transacylase, mitochondrial", "gene_name": "MCAT", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H7H0-1", "protein_name": "Ribosome assembly protein METTL17, mitochondrial", "gene_name": "METTL17", "tax_name": "Human" }, { "uniprot_canonical_ac": "P02381-1", "protein_name": "Small ribosomal subunit protein uS3m", "gene_name": "VAR1", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P48237", "url": "https://www.uniprot.org/uniprotkb/P48237" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.36482135", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 6 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Probing genuine strong interactions and post-translational modifications in the heterogeneous yeast exosome protein complex.", "journal": "Molecular & cellular proteomics : MCP", "date": "2006-09", "authors": "Synowsky Silvia A, van den Heuvel Robert H H, Mohammed Shabaz, Pijnappel Pim W W M, Heck Albert J R", "reference": { "type": "PubMed", "id": "16829593", "url": "https://pubmed.ncbi.nlm.nih.gov/16829593" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P48240-1", "protein_name": "Exosome complex component MTR3", "gene_name": "MTR3", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P53256-1", "protein_name": "Exosome complex component RRP46", "gene_name": "RRP46", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q12149-1", "protein_name": "Exosome complex exonuclease RRP6", "gene_name": "RRP6", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P38792-1", "protein_name": "Exosome complex component RRP4", "gene_name": "RRP4", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P25359-1", "protein_name": "Exosome complex component RRP43", "gene_name": "RRP43", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P53859-1", "protein_name": "Exosome complex component CSL4", "gene_name": "CSL4", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q08491-1", "protein_name": "Superkiller protein 7", "gene_name": "SKI7", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P48240", "url": "https://www.uniprot.org/uniprotkb/P48240" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "phosphorylation": [ { "start_pos": 243, "end_pos": 243, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P48240", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P48240" }, { "database": "PubMed", "id": "16829593", "url": "https://pubmed.ncbi.nlm.nih.gov/16829593" } ], "site_lbl": "Ser243", "uniprot_canonical_ac": "P48240-1" }, { "start_pos": 36, "end_pos": 36, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P48240", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P48240" }, { "database": "PubMed", "id": "16829593", "url": "https://pubmed.ncbi.nlm.nih.gov/16829593" }, { "database": "SGD", "id": "S000003390", "url": "https://www.yeastgenome.org/locus/S000003390" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" } ], "site_lbl": "Thr36", "uniprot_canonical_ac": "P48240-1" }, { "start_pos": 218, "end_pos": 218, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P53256", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P53256" }, { "database": "PubMed", "id": "16829593", "url": "https://pubmed.ncbi.nlm.nih.gov/16829593" }, { "database": "SGD", "id": "S000003327", "url": "https://www.yeastgenome.org/locus/S000003327" }, { "database": "PubMed", "id": "30181345", "url": "https://pubmed.ncbi.nlm.nih.gov/30181345" }, { "database": "PubMed", "id": "33481703", "url": "https://pubmed.ncbi.nlm.nih.gov/33481703" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" } ], "site_lbl": "Ser218", "uniprot_canonical_ac": "P53256-1" }, { "start_pos": 520, "end_pos": 520, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine", "evidence": [ { "database": "UniProtKB", "id": "Q12149", "url": "https://www.uniprot.org/uniprotkb/Q12149" }, { "database": "PubMed", "id": "18407956", "url": "https://pubmed.ncbi.nlm.nih.gov/18407956" }, { "database": "iPTMnet", "id": "Q12149", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q12149" }, { "database": "PubMed", "id": "16829593", "url": "https://pubmed.ncbi.nlm.nih.gov/16829593" }, { "database": "SGD", "id": "S000005527", "url": "https://www.yeastgenome.org/locus/S000005527" }, { "database": "PubMed", "id": "30181345", "url": "https://pubmed.ncbi.nlm.nih.gov/30181345" }, { "database": "PubMed", "id": "32597660", "url": "https://pubmed.ncbi.nlm.nih.gov/32597660" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" } ], "site_lbl": "Thr520", "uniprot_canonical_ac": "Q12149-1" }, { "start_pos": 152, "end_pos": 152, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P38792", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P38792" }, { "database": "PubMed", "id": "16829593", "url": "https://pubmed.ncbi.nlm.nih.gov/16829593" }, { "database": "SGD", "id": "S000001111", "url": "https://www.yeastgenome.org/locus/S000001111" }, { "database": "PubMed", "id": "30181345", "url": "https://pubmed.ncbi.nlm.nih.gov/30181345" }, { "database": "PubMed", "id": "32597660", "url": "https://pubmed.ncbi.nlm.nih.gov/32597660" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" } ], "site_lbl": "Ser152", "uniprot_canonical_ac": "P38792-1" }, { "start_pos": 145, "end_pos": 145, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P25359", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P25359" }, { "database": "PubMed", "id": "16829593", "url": "https://pubmed.ncbi.nlm.nih.gov/16829593" } ], "site_lbl": "Thr145", "uniprot_canonical_ac": "P25359-1" }, { "start_pos": 26, "end_pos": 26, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P25359", "url": "https://www.uniprot.org/uniprotkb/P25359" }, { "database": "PubMed", "id": "18407956", "url": "https://pubmed.ncbi.nlm.nih.gov/18407956" }, { "database": "iPTMnet", "id": "P25359", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P25359" }, { "database": "PubMed", "id": "16829593", "url": "https://pubmed.ncbi.nlm.nih.gov/16829593" }, { "database": "SGD", "id": "S000000631", "url": "https://www.yeastgenome.org/locus/S000000631" }, { "database": "PubMed", "id": "30181345", "url": "https://pubmed.ncbi.nlm.nih.gov/30181345" }, { "database": "PubMed", "id": "33481703", "url": "https://pubmed.ncbi.nlm.nih.gov/33481703" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" } ], "site_lbl": "Ser26", "uniprot_canonical_ac": "P25359-1" }, { "start_pos": 94, "end_pos": 94, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P53859", "url": "https://www.uniprot.org/uniprotkb/P53859" }, { "database": "PubMed", "id": "17287358", "url": "https://pubmed.ncbi.nlm.nih.gov/17287358" }, { "database": "PubMed", "id": "18407956", "url": "https://pubmed.ncbi.nlm.nih.gov/18407956" }, { "database": "iPTMnet", "id": "P53859", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P53859" }, { "database": "PubMed", "id": "16829593", "url": "https://pubmed.ncbi.nlm.nih.gov/16829593" }, { "database": "PubMed", "id": "19795423", "url": "https://pubmed.ncbi.nlm.nih.gov/19795423" }, { "database": "PubMed", "id": "19823750", "url": "https://pubmed.ncbi.nlm.nih.gov/19823750" }, { "database": "PubMed", "id": "20702584", "url": "https://pubmed.ncbi.nlm.nih.gov/20702584" }, { "database": "SGD", "id": "S000005176", "url": "https://www.yeastgenome.org/locus/S000005176" }, { "database": "PubMed", "id": "19046973", "url": "https://pubmed.ncbi.nlm.nih.gov/19046973" }, { "database": "PubMed", "id": "30181345", "url": "https://pubmed.ncbi.nlm.nih.gov/30181345" }, { "database": "PubMed", "id": "33481703", "url": "https://pubmed.ncbi.nlm.nih.gov/33481703" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" } ], "site_lbl": "Ser94", "uniprot_canonical_ac": "P53859-1" }, { "start_pos": 307, "end_pos": 307, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q08491", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q08491" }, { "database": "PubMed", "id": "16829593", "url": "https://pubmed.ncbi.nlm.nih.gov/16829593" }, { "database": "SGD", "id": "S000005602", "url": "https://www.yeastgenome.org/locus/S000005602" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" } ], "site_lbl": "Ser307", "uniprot_canonical_ac": "Q08491-1" }, { "start_pos": 88, "end_pos": 88, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "Q08491", "url": "https://www.uniprot.org/uniprotkb/Q08491" }, { "database": "PubMed", "id": "17287358", "url": "https://pubmed.ncbi.nlm.nih.gov/17287358" }, { "database": "iPTMnet", "id": "Q08491", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q08491" }, { "database": "PubMed", "id": "16829593", "url": "https://pubmed.ncbi.nlm.nih.gov/16829593" }, { "database": "PubMed", "id": "18407956", "url": "https://pubmed.ncbi.nlm.nih.gov/18407956" }, { "database": "SGD", "id": "S000005602", "url": "https://www.yeastgenome.org/locus/S000005602" }, { "database": "PubMed", "id": "19046973", "url": "https://pubmed.ncbi.nlm.nih.gov/19046973" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" } ], "site_lbl": "Ser88", "uniprot_canonical_ac": "Q08491-1" }, { "start_pos": 90, "end_pos": 90, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "Q08491", "url": "https://www.uniprot.org/uniprotkb/Q08491" }, { "database": "PubMed", "id": "17287358", "url": "https://pubmed.ncbi.nlm.nih.gov/17287358" }, { "database": "iPTMnet", "id": "Q08491", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q08491" }, { "database": "PubMed", "id": "16829593", "url": "https://pubmed.ncbi.nlm.nih.gov/16829593" }, { "database": "PubMed", "id": "18407956", "url": "https://pubmed.ncbi.nlm.nih.gov/18407956" }, { "database": "SGD", "id": "S000005602", "url": "https://www.yeastgenome.org/locus/S000005602" }, { "database": "PubMed", "id": "19046973", "url": "https://pubmed.ncbi.nlm.nih.gov/19046973" }, { "database": "PubMed", "id": "32597660", "url": "https://pubmed.ncbi.nlm.nih.gov/32597660" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" } ], "site_lbl": "Ser90", "uniprot_canonical_ac": "Q08491-1" } ], "record_id": "pubmed.16829593", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 7 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 11 }, { "field": "total_sites", "count": 11 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "A single subunit, Dis3, is essentially responsible for yeast exosome core activity.", "journal": "Nature structural & molecular biology", "date": "2007-01", "authors": "Dziembowski Andrzej, Lorentzen Esben, Conti Elena, S\u00e9raphin Bertrand", "reference": { "type": "PubMed", "id": "17173052", "url": "https://pubmed.ncbi.nlm.nih.gov/17173052" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P48240-1", "protein_name": "Exosome complex component MTR3", "gene_name": "MTR3", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P53256-1", "protein_name": "Exosome complex component RRP46", "gene_name": "RRP46", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q05636-1", "protein_name": "Exosome complex component RRP45", "gene_name": "RRP45", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q08162-1", "protein_name": "Exosome complex exonuclease DIS3", "gene_name": "DIS3", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q08285-1", "protein_name": "Exosome complex component RRP40", "gene_name": "RRP40", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q12149-1", "protein_name": "Exosome complex exonuclease RRP6", "gene_name": "RRP6", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q12277-1", "protein_name": "Exosome complex component RRP42", "gene_name": "RRP42", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P38792-1", "protein_name": "Exosome complex component RRP4", "gene_name": "RRP4", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P25359-1", "protein_name": "Exosome complex component RRP43", "gene_name": "RRP43", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P46948-1", "protein_name": "Exosome complex component SKI6", "gene_name": "SKI6", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P53859-1", "protein_name": "Exosome complex component CSL4", "gene_name": "CSL4", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q08491-1", "protein_name": "Superkiller protein 7", "gene_name": "SKI7", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P48240", "url": "https://www.uniprot.org/uniprotkb/P48240" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "mutagenesis": [ { "start_pos": 551, "end_pos": 551, "sequence_org": "D", "sequence_mut": "N", "comment": "Exoribonucleolytic activity abolished. Accumulation of partially processed 5.8S rRNA and partially degraded 5' ETS. No growth; when associated with A-171. No growth; when associated with A-198.", "evidence": [ { "database": "UniProtKB", "id": "Q08162", "url": "https://www.uniprot.org/uniprotkb/Q08162" }, { "database": "PubMed", "id": "17173052", "url": "https://pubmed.ncbi.nlm.nih.gov/17173052" }, { "database": "PubMed", "id": "18374646", "url": "https://pubmed.ncbi.nlm.nih.gov/18374646" }, { "database": "PubMed", "id": "19060898", "url": "https://pubmed.ncbi.nlm.nih.gov/19060898" } ], "uniprot_canonical_ac": "Q08162-1" } ], "record_id": "pubmed.17173052", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 12 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Effects of Acetylation and Phosphorylation on Subunit Interactions in Three Large Eukaryotic Complexes.", "journal": "Molecular & cellular proteomics : MCP", "date": "2018-12", "authors": "\u0160o\u0161tari\u0107 Nikolina, O'Reilly Francis J, Giansanti Piero, Heck Albert J R, Gavin Anne-Claude, van Noort Vera", "reference": { "type": "PubMed", "id": "30181345", "url": "https://pubmed.ncbi.nlm.nih.gov/30181345" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P48240-1", "protein_name": "Exosome complex component MTR3", "gene_name": "MTR3", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P53256-1", "protein_name": "Exosome complex component RRP46", "gene_name": "RRP46", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q08162-1", "protein_name": "Exosome complex exonuclease DIS3", "gene_name": "DIS3", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q08723-1", "protein_name": "26S proteasome regulatory subunit RPN8", "gene_name": "RPN8", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q12149-1", "protein_name": "Exosome complex exonuclease RRP6", "gene_name": "RRP6", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P38764-1", "protein_name": "26S proteasome regulatory subunit RPN1", "gene_name": "RPN1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P38792-1", "protein_name": "Exosome complex component RRP4", "gene_name": "RRP4", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P40422-1", "protein_name": "DNA-directed RNA polymerases I, II, and III subunit RPABC4", "gene_name": "RPC10", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P20435-1", "protein_name": "DNA-directed RNA polymerases I, II, and III subunit RPABC2", "gene_name": "RPO26", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P25359-1", "protein_name": "Exosome complex component RRP43", "gene_name": "RRP43", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P46948-1", "protein_name": "Exosome complex component SKI6", "gene_name": "SKI6", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P53859-1", "protein_name": "Exosome complex component CSL4", "gene_name": "CSL4", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "O13563-1", "protein_name": "26S proteasome regulatory subunit RPN13", "gene_name": "RPN13", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P04050-1", "protein_name": "DNA-directed RNA polymerase II subunit RPB1", "gene_name": "RPO21", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P08518-1", "protein_name": "DNA-directed RNA polymerase II subunit RPB2", "gene_name": "RPB2", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P20436-1", "protein_name": "DNA-directed RNA polymerases I, II, and III subunit RPABC3", "gene_name": "RPB8", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q01939-1", "protein_name": "26S proteasome regulatory subunit 8 homolog", "gene_name": "RPT6", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P48240", "url": "https://www.uniprot.org/uniprotkb/P48240" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "phosphorylation": [ { "start_pos": 75, "end_pos": 75, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "SGD", "id": "S000003390", "url": "https://www.yeastgenome.org/locus/S000003390" }, { "database": "iPTMnet", "id": "P48240", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P48240" }, { "database": "PubMed", "id": "30181345", "url": "https://pubmed.ncbi.nlm.nih.gov/30181345" } ], "site_lbl": "Thr75", "uniprot_canonical_ac": "P48240-1" }, { "start_pos": 218, "end_pos": 218, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P53256", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P53256" }, { "database": "PubMed", "id": "16829593", "url": "https://pubmed.ncbi.nlm.nih.gov/16829593" }, { "database": "SGD", "id": "S000003327", "url": "https://www.yeastgenome.org/locus/S000003327" }, { "database": "PubMed", "id": "30181345", "url": "https://pubmed.ncbi.nlm.nih.gov/30181345" }, { "database": "PubMed", "id": "33481703", "url": "https://pubmed.ncbi.nlm.nih.gov/33481703" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" } ], "site_lbl": "Ser218", "uniprot_canonical_ac": "P53256-1" }, { "start_pos": 75, "end_pos": 75, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "SGD", "id": "S000003327", "url": "https://www.yeastgenome.org/locus/S000003327" }, { "database": "iPTMnet", "id": "P53256", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P53256" }, { "database": "PubMed", "id": "30181345", "url": "https://pubmed.ncbi.nlm.nih.gov/30181345" } ], "site_lbl": "Thr75", "uniprot_canonical_ac": "P53256-1" }, { "start_pos": 49, "end_pos": 49, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "SGD", "id": "S000005381", "url": "https://www.yeastgenome.org/locus/S000005381" }, { "database": "iPTMnet", "id": "Q08162", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q08162" }, { "database": "PubMed", "id": "30181345", "url": "https://pubmed.ncbi.nlm.nih.gov/30181345" } ], "site_lbl": "Ser49", "uniprot_canonical_ac": "Q08162-1" }, { "start_pos": 317, "end_pos": 317, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "Q08723", "url": "https://www.uniprot.org/uniprotkb/Q08723" }, { "database": "PubMed", "id": "19779198", "url": "https://pubmed.ncbi.nlm.nih.gov/19779198" }, { "database": "iPTMnet", "id": "Q08723", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q08723" }, { "database": "PubMed", "id": "17330950", "url": "https://pubmed.ncbi.nlm.nih.gov/17330950" }, { "database": "PubMed", "id": "17563356", "url": "https://pubmed.ncbi.nlm.nih.gov/17563356" }, { "database": "PubMed", "id": "18407956", "url": "https://pubmed.ncbi.nlm.nih.gov/18407956" }, { "database": "PubMed", "id": "19684113", "url": "https://pubmed.ncbi.nlm.nih.gov/19684113" }, { "database": "PubMed", "id": "19795423", "url": "https://pubmed.ncbi.nlm.nih.gov/19795423" }, { "database": "PubMed", "id": "19823750", "url": "https://pubmed.ncbi.nlm.nih.gov/19823750" }, { "database": "PubMed", "id": "20486117", "url": "https://pubmed.ncbi.nlm.nih.gov/20486117" }, { "database": "PubMed", "id": "20702584", "url": "https://pubmed.ncbi.nlm.nih.gov/20702584" }, { "database": "PubMed", "id": "21177495", "url": "https://pubmed.ncbi.nlm.nih.gov/21177495" }, { "database": "SGD", "id": "S000005787", "url": "https://www.yeastgenome.org/locus/S000005787" }, { "database": "PubMed", "id": "23749301", "url": "https://pubmed.ncbi.nlm.nih.gov/23749301" }, { "database": "PubMed", "id": "30181345", "url": "https://pubmed.ncbi.nlm.nih.gov/30181345" }, { "database": "PubMed", "id": "32597660", "url": "https://pubmed.ncbi.nlm.nih.gov/32597660" }, { "database": "PubMed", "id": "33481703", "url": "https://pubmed.ncbi.nlm.nih.gov/33481703" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" } ], "site_lbl": "Ser317", "uniprot_canonical_ac": "Q08723-1" }, { "start_pos": 520, "end_pos": 520, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine", "evidence": [ { "database": "UniProtKB", "id": "Q12149", "url": "https://www.uniprot.org/uniprotkb/Q12149" }, { "database": "PubMed", "id": "18407956", "url": "https://pubmed.ncbi.nlm.nih.gov/18407956" }, { "database": "iPTMnet", "id": "Q12149", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q12149" }, { "database": "PubMed", "id": "16829593", "url": "https://pubmed.ncbi.nlm.nih.gov/16829593" }, { "database": "SGD", "id": "S000005527", "url": "https://www.yeastgenome.org/locus/S000005527" }, { "database": "PubMed", "id": "30181345", "url": "https://pubmed.ncbi.nlm.nih.gov/30181345" }, { "database": "PubMed", "id": "32597660", "url": "https://pubmed.ncbi.nlm.nih.gov/32597660" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" } ], "site_lbl": "Thr520", "uniprot_canonical_ac": "Q12149-1" }, { "start_pos": 19, "end_pos": 19, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P38764", "url": "https://www.uniprot.org/uniprotkb/P38764" }, { "database": "PubMed", "id": "18407956", "url": "https://pubmed.ncbi.nlm.nih.gov/18407956" }, { "database": "PubMed", "id": "19779198", "url": "https://pubmed.ncbi.nlm.nih.gov/19779198" }, { "database": "iPTMnet", "id": "P38764", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P38764" }, { "database": "PubMed", "id": "17563356", "url": "https://pubmed.ncbi.nlm.nih.gov/17563356" }, { "database": "PubMed", "id": "19795423", "url": "https://pubmed.ncbi.nlm.nih.gov/19795423" }, { "database": "PubMed", "id": "19823750", "url": "https://pubmed.ncbi.nlm.nih.gov/19823750" }, { "database": "PubMed", "id": "20486117", "url": "https://pubmed.ncbi.nlm.nih.gov/20486117" }, { "database": "PubMed", "id": "20702584", "url": "https://pubmed.ncbi.nlm.nih.gov/20702584" }, { "database": "PubMed", "id": "21177495", "url": "https://pubmed.ncbi.nlm.nih.gov/21177495" }, { "database": "SGD", "id": "S000001069", "url": "https://www.yeastgenome.org/locus/S000001069" }, { "database": "PubMed", "id": "22218487", "url": "https://pubmed.ncbi.nlm.nih.gov/22218487" }, { "database": "PubMed", "id": "23749301", "url": "https://pubmed.ncbi.nlm.nih.gov/23749301" }, { "database": "PubMed", "id": "27821475", "url": "https://pubmed.ncbi.nlm.nih.gov/27821475" }, { "database": "PubMed", "id": "30181345", "url": "https://pubmed.ncbi.nlm.nih.gov/30181345" }, { "database": "PubMed", "id": "32597660", "url": "https://pubmed.ncbi.nlm.nih.gov/32597660" }, { "database": "PubMed", "id": "33481703", "url": "https://pubmed.ncbi.nlm.nih.gov/33481703" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" } ], "site_lbl": "Ser19", "uniprot_canonical_ac": "P38764-1" }, { "start_pos": 152, "end_pos": 152, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P38792", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P38792" }, { "database": "PubMed", "id": "16829593", "url": "https://pubmed.ncbi.nlm.nih.gov/16829593" }, { "database": "SGD", "id": "S000001111", "url": "https://www.yeastgenome.org/locus/S000001111" }, { "database": "PubMed", "id": "30181345", "url": "https://pubmed.ncbi.nlm.nih.gov/30181345" }, { "database": "PubMed", "id": "32597660", "url": "https://pubmed.ncbi.nlm.nih.gov/32597660" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" } ], "site_lbl": "Ser152", "uniprot_canonical_ac": "P38792-1" }, { "start_pos": 26, "end_pos": 26, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "SGD", "id": "S000001185", "url": "https://www.yeastgenome.org/locus/S000001185" }, { "database": "iPTMnet", "id": "P40422", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P40422" }, { "database": "PubMed", "id": "30181345", "url": "https://pubmed.ncbi.nlm.nih.gov/30181345" } ], "site_lbl": "Thr26", "uniprot_canonical_ac": "P40422-1" }, { "start_pos": 24, "end_pos": 24, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P20435", "url": "https://www.uniprot.org/uniprotkb/P20435" }, { "database": "PubMed", "id": "18407956", "url": "https://pubmed.ncbi.nlm.nih.gov/18407956" }, { "database": "iPTMnet", "id": "P20435", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P20435" }, { "database": "PubMed", "id": "19795423", "url": "https://pubmed.ncbi.nlm.nih.gov/19795423" }, { "database": "PubMed", "id": "19823750", "url": "https://pubmed.ncbi.nlm.nih.gov/19823750" }, { "database": "SGD", "id": "S000006391", "url": "https://www.yeastgenome.org/locus/S000006391" }, { "database": "PubMed", "id": "30181345", "url": "https://pubmed.ncbi.nlm.nih.gov/30181345" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" }, { "database": "PubMed", "id": "33502312", "url": "https://pubmed.ncbi.nlm.nih.gov/33502312" } ], "site_lbl": "Ser24", "uniprot_canonical_ac": "P20435-1" }, { "start_pos": 88, "end_pos": 88, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "", "evidence": [ { "database": "SGD", "id": "S000006391", "url": "https://www.yeastgenome.org/locus/S000006391" }, { "database": "iPTMnet", "id": "P20435", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P20435" }, { "database": "PubMed", "id": "30181345", "url": "https://pubmed.ncbi.nlm.nih.gov/30181345" } ], "site_lbl": "Tyr88", "uniprot_canonical_ac": "P20435-1" }, { "start_pos": 26, "end_pos": 26, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P25359", "url": "https://www.uniprot.org/uniprotkb/P25359" }, { "database": "PubMed", "id": "18407956", "url": "https://pubmed.ncbi.nlm.nih.gov/18407956" }, { "database": "iPTMnet", "id": "P25359", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P25359" }, { "database": "PubMed", "id": "16829593", "url": "https://pubmed.ncbi.nlm.nih.gov/16829593" }, { "database": "SGD", "id": "S000000631", "url": "https://www.yeastgenome.org/locus/S000000631" }, { "database": "PubMed", "id": "30181345", "url": "https://pubmed.ncbi.nlm.nih.gov/30181345" }, { "database": "PubMed", "id": "33481703", "url": "https://pubmed.ncbi.nlm.nih.gov/33481703" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" } ], "site_lbl": "Ser26", "uniprot_canonical_ac": "P25359-1" }, { "start_pos": 2, "end_pos": 2, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "SGD", "id": "S000003427", "url": "https://www.yeastgenome.org/locus/S000003427" }, { "database": "iPTMnet", "id": "P46948", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P46948" }, { "database": "PubMed", "id": "30181345", "url": "https://pubmed.ncbi.nlm.nih.gov/30181345" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" } ], "site_lbl": "Ser2", "uniprot_canonical_ac": "P46948-1" }, { "start_pos": 144, "end_pos": 144, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "SGD", "id": "S000005176", "url": "https://www.yeastgenome.org/locus/S000005176" }, { "database": "iPTMnet", "id": "P53859", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P53859" }, { "database": "PubMed", "id": "30181345", "url": "https://pubmed.ncbi.nlm.nih.gov/30181345" } ], "site_lbl": "Thr144", "uniprot_canonical_ac": "P53859-1" }, { "start_pos": 90, "end_pos": 90, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P53859", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P53859" }, { "database": "PubMed", "id": "19795423", "url": "https://pubmed.ncbi.nlm.nih.gov/19795423" }, { "database": "PubMed", "id": "19823750", "url": "https://pubmed.ncbi.nlm.nih.gov/19823750" }, { "database": "PubMed", "id": "21126336", "url": "https://pubmed.ncbi.nlm.nih.gov/21126336" }, { "database": "SGD", "id": "S000005176", "url": "https://www.yeastgenome.org/locus/S000005176" }, { "database": "PubMed", "id": "22218487", "url": "https://pubmed.ncbi.nlm.nih.gov/22218487" }, { "database": "PubMed", "id": "30181345", "url": "https://pubmed.ncbi.nlm.nih.gov/30181345" }, { "database": "PubMed", "id": "33481703", "url": "https://pubmed.ncbi.nlm.nih.gov/33481703" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" } ], "site_lbl": "Ser90", "uniprot_canonical_ac": "P53859-1" }, { "start_pos": 94, "end_pos": 94, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P53859", "url": "https://www.uniprot.org/uniprotkb/P53859" }, { "database": "PubMed", "id": "17287358", "url": "https://pubmed.ncbi.nlm.nih.gov/17287358" }, { "database": "PubMed", "id": "18407956", "url": "https://pubmed.ncbi.nlm.nih.gov/18407956" }, { "database": "iPTMnet", "id": "P53859", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P53859" }, { "database": "PubMed", "id": "16829593", "url": "https://pubmed.ncbi.nlm.nih.gov/16829593" }, { "database": "PubMed", "id": "19795423", "url": "https://pubmed.ncbi.nlm.nih.gov/19795423" }, { "database": "PubMed", "id": "19823750", "url": "https://pubmed.ncbi.nlm.nih.gov/19823750" }, { "database": "PubMed", "id": "20702584", "url": "https://pubmed.ncbi.nlm.nih.gov/20702584" }, { "database": "SGD", "id": "S000005176", "url": "https://www.yeastgenome.org/locus/S000005176" }, { "database": "PubMed", "id": "19046973", "url": "https://pubmed.ncbi.nlm.nih.gov/19046973" }, { "database": "PubMed", "id": "30181345", "url": "https://pubmed.ncbi.nlm.nih.gov/30181345" }, { "database": "PubMed", "id": "33481703", "url": "https://pubmed.ncbi.nlm.nih.gov/33481703" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" } ], "site_lbl": "Ser94", "uniprot_canonical_ac": "P53859-1" }, { "start_pos": 99, "end_pos": 99, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "SGD", "id": "S000005176", "url": "https://www.yeastgenome.org/locus/S000005176" }, { "database": "iPTMnet", "id": "P53859", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P53859" }, { "database": "PubMed", "id": "30181345", "url": "https://pubmed.ncbi.nlm.nih.gov/30181345" } ], "site_lbl": "Thr99", "uniprot_canonical_ac": "P53859-1" }, { "start_pos": 132, "end_pos": 132, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O13563", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O13563" }, { "database": "PubMed", "id": "17330950", "url": "https://pubmed.ncbi.nlm.nih.gov/17330950" }, { "database": "PubMed", "id": "17563356", "url": "https://pubmed.ncbi.nlm.nih.gov/17563356" }, { "database": "PubMed", "id": "18407956", "url": "https://pubmed.ncbi.nlm.nih.gov/18407956" }, { "database": "PubMed", "id": "19779198", "url": "https://pubmed.ncbi.nlm.nih.gov/19779198" }, { "database": "PubMed", "id": "20702584", "url": "https://pubmed.ncbi.nlm.nih.gov/20702584" }, { "database": "PubMed", "id": "21126336", "url": "https://pubmed.ncbi.nlm.nih.gov/21126336" }, { "database": "PubMed", "id": "21177495", "url": "https://pubmed.ncbi.nlm.nih.gov/21177495" }, { "database": "SGD", "id": "S000004413", "url": "https://www.yeastgenome.org/locus/S000004413" }, { "database": "PubMed", "id": "20486117", "url": "https://pubmed.ncbi.nlm.nih.gov/20486117" }, { "database": "PubMed", "id": "23749301", "url": "https://pubmed.ncbi.nlm.nih.gov/23749301" }, { "database": "PubMed", "id": "24909858", "url": "https://pubmed.ncbi.nlm.nih.gov/24909858" }, { "database": "PubMed", "id": "30181345", "url": "https://pubmed.ncbi.nlm.nih.gov/30181345" }, { "database": "PubMed", "id": "33481703", "url": "https://pubmed.ncbi.nlm.nih.gov/33481703" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" } ], "site_lbl": "Ser132", "uniprot_canonical_ac": "O13563-1" }, { "start_pos": 135, "end_pos": 135, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "O13563", "url": "https://www.uniprot.org/uniprotkb/O13563" }, { "database": "PubMed", "id": "18407956", "url": "https://pubmed.ncbi.nlm.nih.gov/18407956" }, { "database": "PubMed", "id": "17330950", "url": "https://pubmed.ncbi.nlm.nih.gov/17330950" }, { "database": "PubMed", "id": "19779198", "url": "https://pubmed.ncbi.nlm.nih.gov/19779198" }, { "database": "iPTMnet", "id": "O13563", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O13563" }, { "database": "PubMed", "id": "17563356", "url": "https://pubmed.ncbi.nlm.nih.gov/17563356" }, { "database": "PubMed", "id": "19684113", "url": "https://pubmed.ncbi.nlm.nih.gov/19684113" }, { "database": "PubMed", "id": "19795423", "url": "https://pubmed.ncbi.nlm.nih.gov/19795423" }, { "database": "PubMed", "id": "19823750", "url": "https://pubmed.ncbi.nlm.nih.gov/19823750" }, { "database": "PubMed", "id": "20486117", "url": "https://pubmed.ncbi.nlm.nih.gov/20486117" }, { "database": "PubMed", "id": "20702584", "url": "https://pubmed.ncbi.nlm.nih.gov/20702584" }, { "database": "PubMed", "id": "21177495", "url": "https://pubmed.ncbi.nlm.nih.gov/21177495" }, { "database": "SGD", "id": "S000004413", "url": "https://www.yeastgenome.org/locus/S000004413" }, { "database": "PubMed", "id": "22218487", "url": "https://pubmed.ncbi.nlm.nih.gov/22218487" }, { "database": "PubMed", "id": "23749301", "url": "https://pubmed.ncbi.nlm.nih.gov/23749301" }, { "database": "PubMed", "id": "30181345", "url": "https://pubmed.ncbi.nlm.nih.gov/30181345" }, { "database": "PubMed", "id": "30516470", "url": "https://pubmed.ncbi.nlm.nih.gov/30516470" }, { "database": "PubMed", "id": "32597660", "url": "https://pubmed.ncbi.nlm.nih.gov/32597660" }, { "database": "PubMed", "id": "33481703", "url": "https://pubmed.ncbi.nlm.nih.gov/33481703" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" } ], "site_lbl": "Ser135", "uniprot_canonical_ac": "O13563-1" }, { "start_pos": 153, "end_pos": 153, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O13563", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O13563" }, { "database": "PubMed", "id": "21126336", "url": "https://pubmed.ncbi.nlm.nih.gov/21126336" }, { "database": "SGD", "id": "S000004413", "url": "https://www.yeastgenome.org/locus/S000004413" }, { "database": "PubMed", "id": "23749301", "url": "https://pubmed.ncbi.nlm.nih.gov/23749301" }, { "database": "PubMed", "id": "30181345", "url": "https://pubmed.ncbi.nlm.nih.gov/30181345" }, { "database": "PubMed", "id": "32597660", "url": "https://pubmed.ncbi.nlm.nih.gov/32597660" }, { "database": "PubMed", "id": "33481703", "url": "https://pubmed.ncbi.nlm.nih.gov/33481703" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" } ], "site_lbl": "Ser153", "uniprot_canonical_ac": "O13563-1" }, { "start_pos": 1266, "end_pos": 1266, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "SGD", "id": "S000002299", "url": "https://www.yeastgenome.org/locus/S000002299" }, { "database": "iPTMnet", "id": "P04050", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P04050" }, { "database": "PubMed", "id": "30181345", "url": "https://pubmed.ncbi.nlm.nih.gov/30181345" } ], "site_lbl": "Thr1266", "uniprot_canonical_ac": "P04050-1" }, { "start_pos": 1293, "end_pos": 1293, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P04050", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P04050" }, { "database": "PubMed", "id": "17330950", "url": "https://pubmed.ncbi.nlm.nih.gov/17330950" }, { "database": "PubMed", "id": "21126336", "url": "https://pubmed.ncbi.nlm.nih.gov/21126336" }, { "database": "SGD", "id": "S000002299", "url": "https://www.yeastgenome.org/locus/S000002299" }, { "database": "PubMed", "id": "30181345", "url": "https://pubmed.ncbi.nlm.nih.gov/30181345" }, { "database": "PubMed", "id": "33481703", "url": "https://pubmed.ncbi.nlm.nih.gov/33481703" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" } ], "site_lbl": "Ser1293", "uniprot_canonical_ac": "P04050-1" }, { "start_pos": 1471, "end_pos": 1471, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine", "evidence": [ { "database": "UniProtKB", "id": "P04050", "url": "https://www.uniprot.org/uniprotkb/P04050" }, { "database": "PubMed", "id": "18407956", "url": "https://pubmed.ncbi.nlm.nih.gov/18407956" }, { "database": "iPTMnet", "id": "P04050", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P04050" }, { "database": "PubMed", "id": "20489023", "url": "https://pubmed.ncbi.nlm.nih.gov/20489023" }, { "database": "PubMed", "id": "28826505", "url": "https://pubmed.ncbi.nlm.nih.gov/28826505" }, { "database": "PubMed", "id": "31085683", "url": "https://pubmed.ncbi.nlm.nih.gov/31085683" }, { "database": "SGD", "id": "S000002299", "url": "https://www.yeastgenome.org/locus/S000002299" }, { "database": "PubMed", "id": "27821475", "url": "https://pubmed.ncbi.nlm.nih.gov/27821475" }, { "database": "PubMed", "id": "30181345", "url": "https://pubmed.ncbi.nlm.nih.gov/30181345" }, { "database": "PubMed", "id": "33481703", "url": "https://pubmed.ncbi.nlm.nih.gov/33481703" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" } ], "site_lbl": "Thr1471", "uniprot_canonical_ac": "P04050-1" }, { "start_pos": 2, "end_pos": 2, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "SGD", "id": "S000005677", "url": "https://www.yeastgenome.org/locus/S000005677" }, { "database": "iPTMnet", "id": "P08518", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P08518" }, { "database": "PubMed", "id": "30181345", "url": "https://pubmed.ncbi.nlm.nih.gov/30181345" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" } ], "site_lbl": "Ser2", "uniprot_canonical_ac": "P08518-1" }, { "start_pos": 970, "end_pos": 970, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "SGD", "id": "S000005677", "url": "https://www.yeastgenome.org/locus/S000005677" }, { "database": "iPTMnet", "id": "P08518", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P08518" }, { "database": "PubMed", "id": "30181345", "url": "https://pubmed.ncbi.nlm.nih.gov/30181345" } ], "site_lbl": "Thr970", "uniprot_canonical_ac": "P08518-1" }, { "start_pos": 971, "end_pos": 971, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "SGD", "id": "S000005677", "url": "https://www.yeastgenome.org/locus/S000005677" }, { "database": "iPTMnet", "id": "P08518", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P08518" }, { "database": "PubMed", "id": "30181345", "url": "https://pubmed.ncbi.nlm.nih.gov/30181345" } ], "site_lbl": "Thr971", "uniprot_canonical_ac": "P08518-1" }, { "start_pos": 68, "end_pos": 68, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine", "evidence": [ { "database": "UniProtKB", "id": "P20436", "url": "https://www.uniprot.org/uniprotkb/P20436" }, { "database": "PubMed", "id": "18407956", "url": "https://pubmed.ncbi.nlm.nih.gov/18407956" }, { "database": "iPTMnet", "id": "P20436", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P20436" }, { "database": "SGD", "id": "S000005750", "url": "https://www.yeastgenome.org/locus/S000005750" }, { "database": "PubMed", "id": "30181345", "url": "https://pubmed.ncbi.nlm.nih.gov/30181345" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" } ], "site_lbl": "Thr68", "uniprot_canonical_ac": "P20436-1" }, { "start_pos": 332, "end_pos": 332, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "SGD", "id": "S000003016", "url": "https://www.yeastgenome.org/locus/S000003016" }, { "database": "iPTMnet", "id": "Q01939", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q01939" }, { "database": "PubMed", "id": "30181345", "url": "https://pubmed.ncbi.nlm.nih.gov/30181345" } ], "site_lbl": "Ser332", "uniprot_canonical_ac": "Q01939-1" } ], "record_id": "pubmed.30181345", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 17 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 28 }, { "field": "total_sites", "count": 26 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Mutations in nucleolar proteins lead to nucleolar accumulation of polyA+ RNA in Saccharomyces cerevisiae.", "journal": "Molecular biology of the cell", "date": "1995-09", "authors": "Kadowaki T, Schneiter R, Hitomi M, Tartakoff A M", "reference": { "type": "PubMed", "id": "8534909", "url": "https://pubmed.ncbi.nlm.nih.gov/8534909" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P48240-1", "protein_name": "Exosome complex component MTR3", "gene_name": "MTR3", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P48240", "url": "https://www.uniprot.org/uniprotkb/P48240" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.8534909", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Adrenodoxin reductase homolog (Arh1p) of yeast mitochondria required for iron homeostasis.", "journal": "The Journal of biological chemistry", "date": "2001-01-12", "authors": "Li J, Saxena S, Pain D, Dancis A", "reference": { "type": "PubMed", "id": "11035018", "url": "https://pubmed.ncbi.nlm.nih.gov/11035018" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P48360-1", "protein_name": "Probable NADPH:adrenodoxin oxidoreductase, mitochondrial", "gene_name": "ARH1", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P48360", "url": "https://www.uniprot.org/uniprotkb/P48360" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.11035018", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Involvement of mitochondrial ferredoxin and Cox15p in hydroxylation of heme O.", "journal": "FEBS letters", "date": "2001", "authors": "Barros MH, Carlson CG, Glerum DM, Tzagoloff A", "reference": { "type": "PubMed", "id": "11248251", "url": "https://pubmed.ncbi.nlm.nih.gov/11248251" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P48360-1", "protein_name": "Probable NADPH:adrenodoxin oxidoreductase, mitochondrial", "gene_name": "ARH1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q12184-1", "protein_name": "Adrenodoxin homolog, mitochondrial", "gene_name": "YAH1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P40086-1", "protein_name": "Heme A synthase COX15", "gene_name": "COX15", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P48360", "url": "https://www.uniprot.org/uniprotkb/P48360" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.11248251", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "BCS1, a novel gene required for the expression of functional Rieske iron-sulfur protein in Saccharomyces cerevisiae.", "journal": "EMBO J.", "date": "1992", "authors": "Nobrega F G, Nobrega M P, Tzagoloff A", "reference": { "type": "PubMed", "id": "1327750", "url": "https://pubmed.ncbi.nlm.nih.gov/1327750" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P48360-1", "protein_name": "Probable NADPH:adrenodoxin oxidoreductase, mitochondrial", "gene_name": "ARH1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P32839-1", "protein_name": "Mitochondrial chaperone BCS1", "gene_name": "BCS1", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P48360", "url": "https://www.uniprot.org/uniprotkb/P48360" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.1327750", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Predictive reconstruction of the mitochondrial iron-sulfur cluster assembly metabolism: I. The role of the protein pair ferredoxin-ferredoxin reductase (Yah1-Arh1).", "journal": "Proteins", "date": "2004-08-01", "authors": "Alves Rui, Herrero Enrique, Sorribas Albert", "reference": { "type": "PubMed", "id": "15211518", "url": "https://pubmed.ncbi.nlm.nih.gov/15211518" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P48360-1", "protein_name": "Probable NADPH:adrenodoxin oxidoreductase, mitochondrial", "gene_name": "ARH1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q12184-1", "protein_name": "Adrenodoxin homolog, mitochondrial", "gene_name": "YAH1", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P48360", "url": "https://www.uniprot.org/uniprotkb/P48360" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.15211518", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Involvement of mitochondrial ferredoxin and para-aminobenzoic acid in yeast coenzyme Q biosynthesis.", "journal": "Chemistry & biology", "date": "2010-05-28", "authors": "Pierrel Fabien, Hamelin Olivier, Douki Thierry, Kieffer-Jaquinod Sylvie, M\u00fchlenhoff Ulrich, Ozeir Mohammad, Lill Roland, Fontecave Marc", "reference": { "type": "PubMed", "id": "20534343", "url": "https://pubmed.ncbi.nlm.nih.gov/20534343" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P48360-1", "protein_name": "Probable NADPH:adrenodoxin oxidoreductase, mitochondrial", "gene_name": "ARH1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q12184-1", "protein_name": "Adrenodoxin homolog, mitochondrial", "gene_name": "YAH1", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P48360", "url": "https://www.uniprot.org/uniprotkb/P48360" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.20534343", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "A gene encoding a yeast equivalent of mammalian NADPH-adrenodoxin oxidoreductases.", "journal": "Gene", "date": "1996", "authors": "Lacour T, Dumas B", "reference": { "type": "PubMed", "id": "8890749", "url": "https://pubmed.ncbi.nlm.nih.gov/8890749" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P48360-1", "protein_name": "Probable NADPH:adrenodoxin oxidoreductase, mitochondrial", "gene_name": "ARH1", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P48360", "url": "https://www.uniprot.org/uniprotkb/P48360" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.8890749", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Characterization of recombinant adrenodoxin reductase homologue (Arh1p) from yeast. Implication in in vitro cytochrome p45011beta monooxygenase system.", "journal": "The Journal of biological chemistry", "date": "1998-09-11", "authors": "Lacour T, Achstetter T, Dumas B", "reference": { "type": "PubMed", "id": "9727014", "url": "https://pubmed.ncbi.nlm.nih.gov/9727014" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P48360-1", "protein_name": "Probable NADPH:adrenodoxin oxidoreductase, mitochondrial", "gene_name": "ARH1", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P48360", "url": "https://www.uniprot.org/uniprotkb/P48360" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.9727014", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "ARH1 of Saccharomyces cerevisiae: a new essential gene that codes for a protein homologous to the human adrenodoxin reductase.", "journal": "Yeast", "date": "1998", "authors": "Manzella L, Barros M H, Nobrega F G", "reference": { "type": "PubMed", "id": "9818721", "url": "https://pubmed.ncbi.nlm.nih.gov/9818721" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P48360-1", "protein_name": "Probable NADPH:adrenodoxin oxidoreductase, mitochondrial", "gene_name": "ARH1", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P48360", "url": "https://www.uniprot.org/uniprotkb/P48360" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.9818721", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "A novel protein complex promoting formation of functional alpha- and gamma-tubulin.", "journal": "EMBO J.", "date": "1998", "authors": "Geissler S, Siegers K, Schiebel E", "reference": { "type": "PubMed", "id": "9463374", "url": "https://pubmed.ncbi.nlm.nih.gov/9463374" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P48363-1", "protein_name": "Prefoldin subunit 3", "gene_name": "PAC10", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P53900-1", "protein_name": "Prefoldin subunit 4", "gene_name": "GIM3", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q04493-1", "protein_name": "Prefoldin subunit 5", "gene_name": "GIM5", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P52553-1", "protein_name": "Prefoldin subunit 6", "gene_name": "YKE2", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P40005-1", "protein_name": "Prefoldin subunit 2", "gene_name": "GIM4", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P48363", "url": "https://www.uniprot.org/uniprotkb/P48363" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.9463374", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 5 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Compartmentation of protein folding in vivo: sequestration of non-native polypeptide by the chaperonin-GimC system.", "journal": "EMBO J.", "date": "1999", "authors": "Siegers K, Waldmann T, Leroux M R, Grein K, Shevchenko A, Schiebel E, Hartl F U", "reference": { "type": "PubMed", "id": "9878052", "url": "https://pubmed.ncbi.nlm.nih.gov/9878052" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P48363-1", "protein_name": "Prefoldin subunit 3", "gene_name": "PAC10", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P53900-1", "protein_name": "Prefoldin subunit 4", "gene_name": "GIM3", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q04493-1", "protein_name": "Prefoldin subunit 5", "gene_name": "GIM5", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P52553-1", "protein_name": "Prefoldin subunit 6", "gene_name": "YKE2", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P40005-1", "protein_name": "Prefoldin subunit 2", "gene_name": "GIM4", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P46988-1", "protein_name": "Prefoldin subunit 1", "gene_name": "PFD1", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P48363", "url": "https://www.uniprot.org/uniprotkb/P48363" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.9878052", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 6 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Identification of an additional gene required for eukaryotic nonsense mRNA turnover.", "journal": "Proc. Natl. Acad. Sci. U.S.A.", "date": "1995", "authors": "Lee B S, Culbertson M R", "reference": { "type": "PubMed", "id": "7479783", "url": "https://pubmed.ncbi.nlm.nih.gov/7479783" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P48412-1", "protein_name": "Nonsense-mediated mRNA decay protein 3", "gene_name": "UPF3", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P48412", "url": "https://www.uniprot.org/uniprotkb/P48412" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.7479783", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The oligosaccharyltransferase complex from Saccharomyces cerevisiae. Isolation of the OST6 gene, its synthetic interaction with OST3, and analysis of the native complex.", "journal": "J. Biol. Chem.", "date": "1999", "authors": "Knauer R, Lehle L", "reference": { "type": "PubMed", "id": "10358084", "url": "https://pubmed.ncbi.nlm.nih.gov/10358084" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P48439-1", "protein_name": "Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 3", "gene_name": "OST3", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q03723-1", "protein_name": "Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit OST6", "gene_name": "OST6", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P48439", "url": "https://www.uniprot.org/uniprotkb/P48439" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.10358084", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Studies on the role of the hydrophobic domain of Ost4p in interactions with other subunits of yeast oligosaccharyl transferase.", "journal": "Proc. Natl. Acad. Sci. U.S.A.", "date": "2000", "authors": "Kim H, Park H, Montalvo L, Lennarz W J", "reference": { "type": "PubMed", "id": "10677492", "url": "https://pubmed.ncbi.nlm.nih.gov/10677492" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P48439-1", "protein_name": "Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 3", "gene_name": "OST3", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q99380-1", "protein_name": "Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit OST4", "gene_name": "OST4", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P39007-1", "protein_name": "Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3", "gene_name": "STT3", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P48439", "url": "https://www.uniprot.org/uniprotkb/P48439" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "mutagenesis": [ { "start_pos": 18, "end_pos": 18, "sequence_org": "M", "sequence_mut": "K", "comment": "Severe growth defect; abolishes interaction with OST3 and STT3.", "evidence": [ { "database": "UniProtKB", "id": "Q99380", "url": "https://www.uniprot.org/uniprotkb/Q99380" }, { "database": "PubMed", "id": "10677492", "url": "https://pubmed.ncbi.nlm.nih.gov/10677492" }, { "database": "PubMed", "id": "12810948", "url": "https://pubmed.ncbi.nlm.nih.gov/12810948" } ], "uniprot_canonical_ac": "Q99380-1" }, { "start_pos": 18, "end_pos": 18, "sequence_org": "M", "sequence_mut": "L", "comment": "No effect on interaction between OST3 and STT3.", "evidence": [ { "database": "UniProtKB", "id": "Q99380", "url": "https://www.uniprot.org/uniprotkb/Q99380" }, { "database": "PubMed", "id": "10677492", "url": "https://pubmed.ncbi.nlm.nih.gov/10677492" }, { "database": "PubMed", "id": "12810948", "url": "https://pubmed.ncbi.nlm.nih.gov/12810948" } ], "uniprot_canonical_ac": "Q99380-1" }, { "start_pos": 19, "end_pos": 19, "sequence_org": "M", "sequence_mut": "K", "comment": "Severe growth defect; abolishes interaction with OST3.", "evidence": [ { "database": "UniProtKB", "id": "Q99380", "url": "https://www.uniprot.org/uniprotkb/Q99380" }, { "database": "PubMed", "id": "10677492", "url": "https://pubmed.ncbi.nlm.nih.gov/10677492" }, { "database": "PubMed", "id": "12810948", "url": "https://pubmed.ncbi.nlm.nih.gov/12810948" } ], "uniprot_canonical_ac": "Q99380-1" }, { "start_pos": 19, "end_pos": 19, "sequence_org": "M", "sequence_mut": "L", "comment": "Disrupts interaction between OST3 and STT3.", "evidence": [ { "database": "UniProtKB", "id": "Q99380", "url": "https://www.uniprot.org/uniprotkb/Q99380" }, { "database": "PubMed", "id": "10677492", "url": "https://pubmed.ncbi.nlm.nih.gov/10677492" }, { "database": "PubMed", "id": "12810948", "url": "https://pubmed.ncbi.nlm.nih.gov/12810948" } ], "uniprot_canonical_ac": "Q99380-1" }, { "start_pos": 20, "end_pos": 20, "sequence_org": "T", "sequence_mut": "D", "comment": "Severe growth defect.", "evidence": [ { "database": "UniProtKB", "id": "Q99380", "url": "https://www.uniprot.org/uniprotkb/Q99380" }, { "database": "PubMed", "id": "10677492", "url": "https://pubmed.ncbi.nlm.nih.gov/10677492" }, { "database": "PubMed", "id": "12810948", "url": "https://pubmed.ncbi.nlm.nih.gov/12810948" } ], "uniprot_canonical_ac": "Q99380-1" }, { "start_pos": 20, "end_pos": 20, "sequence_org": "T", "sequence_mut": "K", "comment": "Severe growth defect; abolishes interaction with OST3; disrupts interaction between OST3 and STT3.", "evidence": [ { "database": "UniProtKB", "id": "Q99380", "url": "https://www.uniprot.org/uniprotkb/Q99380" }, { "database": "PubMed", "id": "10677492", "url": "https://pubmed.ncbi.nlm.nih.gov/10677492" }, { "database": "PubMed", "id": "12810948", "url": "https://pubmed.ncbi.nlm.nih.gov/12810948" } ], "uniprot_canonical_ac": "Q99380-1" }, { "start_pos": 21, "end_pos": 21, "sequence_org": "L", "sequence_mut": "K", "comment": "Abolishes interaction with OST3 and STT3; disrupts interaction between OST3 and STT3.", "evidence": [ { "database": "UniProtKB", "id": "Q99380", "url": "https://www.uniprot.org/uniprotkb/Q99380" }, { "database": "PubMed", "id": "10677492", "url": "https://pubmed.ncbi.nlm.nih.gov/10677492" }, { "database": "PubMed", "id": "12810948", "url": "https://pubmed.ncbi.nlm.nih.gov/12810948" } ], "uniprot_canonical_ac": "Q99380-1" }, { "start_pos": 23, "end_pos": 23, "sequence_org": "V", "sequence_mut": "D", "comment": "Severe growth defect.", "evidence": [ { "database": "UniProtKB", "id": "Q99380", "url": "https://www.uniprot.org/uniprotkb/Q99380" }, { "database": "PubMed", "id": "10677492", "url": "https://pubmed.ncbi.nlm.nih.gov/10677492" }, { "database": "PubMed", "id": "12810948", "url": "https://pubmed.ncbi.nlm.nih.gov/12810948" } ], "uniprot_canonical_ac": "Q99380-1" }, { "start_pos": 23, "end_pos": 23, "sequence_org": "V", "sequence_mut": "K", "comment": "Severe growth defect; abolishes interaction with OST3; disrupts interaction between OST3 and STT3.", "evidence": [ { "database": "UniProtKB", "id": "Q99380", "url": "https://www.uniprot.org/uniprotkb/Q99380" }, { "database": "PubMed", "id": "10677492", "url": "https://pubmed.ncbi.nlm.nih.gov/10677492" }, { "database": "PubMed", "id": "12810948", "url": "https://pubmed.ncbi.nlm.nih.gov/12810948" } ], "uniprot_canonical_ac": "Q99380-1" }, { "start_pos": 24, "end_pos": 24, "sequence_org": "I", "sequence_mut": "D", "comment": "Severe growth defect.", "evidence": [ { "database": "UniProtKB", "id": "Q99380", "url": "https://www.uniprot.org/uniprotkb/Q99380" }, { "database": "PubMed", "id": "10677492", "url": "https://pubmed.ncbi.nlm.nih.gov/10677492" }, { "database": "PubMed", "id": "12810948", "url": "https://pubmed.ncbi.nlm.nih.gov/12810948" } ], "uniprot_canonical_ac": "Q99380-1" }, { "start_pos": 24, "end_pos": 24, "sequence_org": "I", "sequence_mut": "K", "comment": "Disrupts interaction between OST3 and STT3.", "evidence": [ { "database": "UniProtKB", "id": "Q99380", "url": "https://www.uniprot.org/uniprotkb/Q99380" }, { "database": "PubMed", "id": "10677492", "url": "https://pubmed.ncbi.nlm.nih.gov/10677492" }, { "database": "PubMed", "id": "12810948", "url": "https://pubmed.ncbi.nlm.nih.gov/12810948" } ], "uniprot_canonical_ac": "Q99380-1" }, { "start_pos": 25, "end_pos": 25, "sequence_org": "Y", "sequence_mut": "D", "comment": "Severe growth defect.", "evidence": [ { "database": "UniProtKB", "id": "Q99380", "url": "https://www.uniprot.org/uniprotkb/Q99380" }, { "database": "PubMed", "id": "10677492", "url": "https://pubmed.ncbi.nlm.nih.gov/10677492" } ], "uniprot_canonical_ac": "Q99380-1" } ], "record_id": "pubmed.10677492", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Allosteric regulation provides a molecular mechanism for preferential utilization of the fully assembled dolichol-linked oligosaccharide by the yeast oligosaccharyltransferase.", "journal": "Biochemistry", "date": "2001-10-09", "authors": "Karaoglu D, Kelleher D J, Gilmore R", "reference": { "type": "PubMed", "id": "11580295", "url": "https://pubmed.ncbi.nlm.nih.gov/11580295" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P48439-1", "protein_name": "Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 3", "gene_name": "OST3", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P33767-1", "protein_name": "Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit WBP1", "gene_name": "WBP1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P41543-1", "protein_name": "Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 1", "gene_name": "OST1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P46964-1", "protein_name": "Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit OST2", "gene_name": "OST2", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q03723-1", "protein_name": "Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit OST6", "gene_name": "OST6", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q92316-1", "protein_name": "Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit OST5", "gene_name": "OST5", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q02795-1", "protein_name": "Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit SWP1", "gene_name": "SWP1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q99380-1", "protein_name": "Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit OST4", "gene_name": "OST4", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P39007-1", "protein_name": "Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3", "gene_name": "STT3", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P48439", "url": "https://www.uniprot.org/uniprotkb/P48439" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.11580295", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 9 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Studies of yeast oligosaccharyl transferase subunits using the split-ubiquitin system: topological features and in vivo interactions.", "journal": "Proc. Natl. Acad. Sci. U.S.A.", "date": "2005", "authors": "Yan Aixin, Wu Elain, Lennarz William J", "reference": { "type": "PubMed", "id": "15886282", "url": "https://pubmed.ncbi.nlm.nih.gov/15886282" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P48439-1", "protein_name": "Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 3", "gene_name": "OST3", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P33767-1", "protein_name": "Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit WBP1", "gene_name": "WBP1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P41543-1", "protein_name": "Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 1", "gene_name": "OST1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P46964-1", "protein_name": "Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit OST2", "gene_name": "OST2", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q03723-1", "protein_name": "Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit OST6", "gene_name": "OST6", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q92316-1", "protein_name": "Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit OST5", "gene_name": "OST5", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q02795-1", "protein_name": "Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit SWP1", "gene_name": "SWP1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q99380-1", "protein_name": "Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit OST4", "gene_name": "OST4", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P39007-1", "protein_name": "Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3", "gene_name": "STT3", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P48439", "url": "https://www.uniprot.org/uniprotkb/P48439" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.15886282", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 9 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Two oligosaccharyl transferase complexes exist in yeast and associate with two different translocons.", "journal": "Glycobiology", "date": "2005", "authors": "Yan Aixin, Lennarz William J", "reference": { "type": "PubMed", "id": "16096345", "url": "https://pubmed.ncbi.nlm.nih.gov/16096345" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P48439-1", "protein_name": "Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 3", "gene_name": "OST3", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P33767-1", "protein_name": "Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit WBP1", "gene_name": "WBP1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P41543-1", "protein_name": "Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 1", "gene_name": "OST1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P46964-1", "protein_name": "Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit OST2", "gene_name": "OST2", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q03723-1", "protein_name": "Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit OST6", "gene_name": "OST6", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q92316-1", "protein_name": "Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit OST5", "gene_name": "OST5", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q02795-1", "protein_name": "Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit SWP1", "gene_name": "SWP1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q99380-1", "protein_name": "Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit OST4", "gene_name": "OST4", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P39007-1", "protein_name": "Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3", "gene_name": "STT3", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P48439", "url": "https://www.uniprot.org/uniprotkb/P48439" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.16096345", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 9 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The 3.4-kDa Ost4 protein is required for the assembly of two distinct oligosaccharyltransferase complexes in yeast.", "journal": "Glycobiology", "date": "2005", "authors": "Spirig Urs, Bodmer Daniel, Wacker Michael, Burda Patricie, Aebi Markus", "reference": { "type": "PubMed", "id": "16096346", "url": "https://pubmed.ncbi.nlm.nih.gov/16096346" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P48439-1", "protein_name": "Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 3", "gene_name": "OST3", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P33767-1", "protein_name": "Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit WBP1", "gene_name": "WBP1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P41543-1", "protein_name": "Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 1", "gene_name": "OST1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P46964-1", "protein_name": "Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit OST2", "gene_name": "OST2", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q03723-1", "protein_name": "Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit OST6", "gene_name": "OST6", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q92316-1", "protein_name": "Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit OST5", "gene_name": "OST5", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q02795-1", "protein_name": "Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit SWP1", "gene_name": "SWP1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q99380-1", "protein_name": "Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit OST4", "gene_name": "OST4", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P39007-1", "protein_name": "Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3", "gene_name": "STT3", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P48439", "url": "https://www.uniprot.org/uniprotkb/P48439" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.16096346", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 9 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Yeast oligosaccharyltransferase consists of two functionally distinct sub-complexes, specified by either the Ost3p or Ost6p subunit.", "journal": "FEBS Lett.", "date": "2005", "authors": "Schwarz Markus, Knauer Roland, Lehle Ludwig", "reference": { "type": "PubMed", "id": "16297388", "url": "https://pubmed.ncbi.nlm.nih.gov/16297388" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P48439-1", "protein_name": "Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 3", "gene_name": "OST3", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P33767-1", "protein_name": "Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit WBP1", "gene_name": "WBP1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P41543-1", "protein_name": "Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 1", "gene_name": "OST1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P46964-1", "protein_name": "Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit OST2", "gene_name": "OST2", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q03723-1", "protein_name": "Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit OST6", "gene_name": "OST6", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q92316-1", "protein_name": "Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit OST5", "gene_name": "OST5", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q02795-1", "protein_name": "Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit SWP1", "gene_name": "SWP1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q99380-1", "protein_name": "Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit OST4", "gene_name": "OST4", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P39007-1", "protein_name": "Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3", "gene_name": "STT3", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P48439", "url": "https://www.uniprot.org/uniprotkb/P48439" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.16297388", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 9 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Structure of the yeast oligosaccharyltransferase complex gives insight into eukaryotic N-glycosylation.", "journal": "Science", "date": "2018", "authors": "Wild Rebekka, Kowal Julia, Eyring Jillianne, Ngwa Elsy M, Aebi Markus, Locher Kaspar P", "reference": { "type": "PubMed", "id": "29301962", "url": "https://pubmed.ncbi.nlm.nih.gov/29301962" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P48439-1", "protein_name": "Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 3", "gene_name": "OST3", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P33767-1", "protein_name": "Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit WBP1", "gene_name": "WBP1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P41543-1", "protein_name": "Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 1", "gene_name": "OST1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P46964-1", "protein_name": "Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit OST2", "gene_name": "OST2", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q92316-1", "protein_name": "Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit OST5", "gene_name": "OST5", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q02795-1", "protein_name": "Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit SWP1", "gene_name": "SWP1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q99380-1", "protein_name": "Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit OST4", "gene_name": "OST4", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P39007-1", "protein_name": "Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3", "gene_name": "STT3", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P48439", "url": "https://www.uniprot.org/uniprotkb/P48439" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "glycosylation": [ { "glytoucan_ac": "", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "icn3d_view": { "label": "iCn3D", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?bcifid=7OCI&bu=0&command=select+.G:332;+center+selection;+zoom+selection" }, "start_pos": 332, "start_aa": "Asn", "end_pos": 332, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn332", "evidence": [ { "id": "P33767", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P33767#ptm_processing" }, { "id": "29301962", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29301962" }, { "id": "7OCI", "database": "PDB", "url": "https://www.rcsb.org/structure/7OCI" }, { "id": "6EZN", "database": "PDB", "url": "https://www.rcsb.org/structure/6EZN" } ], "filter_code": "001000000000000000000.00010000000000.00.01000", "uniprot_canonical_ac": "P33767-1" }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "icn3d_view": { "label": "iCn3D", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?bcifid=6C26&bu=0&command=select+.B:60;+center+selection;+zoom+selection" }, "start_pos": 60, "start_aa": "Asn", "end_pos": 60, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn60", "evidence": [ { "id": "P33767", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P33767#ptm_processing" }, { "id": "29301962", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29301962" }, { "id": "6C26", "database": "PDB", "url": "https://www.rcsb.org/structure/6C26" }, { "id": "7OCI", "database": "PDB", "url": "https://www.rcsb.org/structure/7OCI" } ], "filter_code": "001000000000000000000.00010000000000.00.01000", "uniprot_canonical_ac": "P33767-1" }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "icn3d_view": {}, "start_pos": 336, "start_aa": "Asn", "end_pos": 336, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn336", "evidence": [ { "id": "P41543", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P41543#ptm_processing" }, { "id": "29301962", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29301962" } ], "filter_code": "001000000000000000000.00010000000000.00.01000", "uniprot_canonical_ac": "P41543-1" }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "icn3d_view": { "label": "iCn3D", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?bcifid=7OCI&bu=0&command=select+.A:400;+center+selection;+zoom+selection" }, "start_pos": 400, "start_aa": "Asn", "end_pos": 400, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn400", "evidence": [ { "id": "P41543", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P41543#ptm_processing" }, { "id": "29301962", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29301962" }, { "id": "7OCI", "database": "PDB", "url": "https://www.rcsb.org/structure/7OCI" } ], "filter_code": "001000000000000000000.00010000000000.00.01000", "uniprot_canonical_ac": "P41543-1" }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "High mannose", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true, "automatic_literature_mining": true }, "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) (high mannose) asparagine;High mannose", "icn3d_view": {}, "start_pos": 539, "start_aa": "Asn", "end_pos": 539, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn539", "evidence": [ { "id": "P39007", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P39007#ptm_processing" }, { "id": "29301962", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29301962" }, { "id": "15507441", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/15507441" }, { "id": "", "database": "GlyGen", "url": "https://data.glygen.org/" } ], "mining_tool": "GlycoSiteMiner_1.0", "mining_tool_list": [ { "label": "GlycoSiteMiner_1.0" } ], "filter_code": "001000000000000000000.00000000000000.00.01000", "uniprot_canonical_ac": "P39007-1" } ], "mutagenesis": [ { "start_pos": 166, "end_pos": 166, "sequence_org": "D", "sequence_mut": "A", "comment": "Lethal; impairs the catalytic activity.", "evidence": [ { "database": "UniProtKB", "id": "P39007", "url": "https://www.uniprot.org/uniprotkb/P39007" }, { "database": "PubMed", "id": "29301962", "url": "https://pubmed.ncbi.nlm.nih.gov/29301962" } ], "uniprot_canonical_ac": "P39007-1" }, { "start_pos": 168, "end_pos": 168, "sequence_org": "E", "sequence_mut": "Q", "comment": "Lethal; impairs the catalytic activity.", "evidence": [ { "database": "UniProtKB", "id": "P39007", "url": "https://www.uniprot.org/uniprotkb/P39007" }, { "database": "PubMed", "id": "29301962", "url": "https://pubmed.ncbi.nlm.nih.gov/29301962" } ], "uniprot_canonical_ac": "P39007-1" }, { "start_pos": 350, "end_pos": 350, "sequence_org": "E", "sequence_mut": "A", "comment": "Lethal; impairs the catalytic activity.", "evidence": [ { "database": "UniProtKB", "id": "P39007", "url": "https://www.uniprot.org/uniprotkb/P39007" }, { "database": "PubMed", "id": "29301962", "url": "https://pubmed.ncbi.nlm.nih.gov/29301962" } ], "uniprot_canonical_ac": "P39007-1" }, { "start_pos": 404, "end_pos": 404, "sequence_org": "R", "sequence_mut": "A", "comment": "Lethal; abolishes interaction with OST1 and WBP1.", "evidence": [ { "database": "UniProtKB", "id": "P39007", "url": "https://www.uniprot.org/uniprotkb/P39007" }, { "database": "PubMed", "id": "15781470", "url": "https://pubmed.ncbi.nlm.nih.gov/15781470" }, { "database": "PubMed", "id": "29301962", "url": "https://pubmed.ncbi.nlm.nih.gov/29301962" } ], "uniprot_canonical_ac": "P39007-1" }, { "start_pos": 47, "end_pos": 47, "sequence_org": "D", "sequence_mut": "A", "comment": "Lethal; impairs the catalytic activity.", "evidence": [ { "database": "UniProtKB", "id": "P39007", "url": "https://www.uniprot.org/uniprotkb/P39007" }, { "database": "PubMed", "id": "29301962", "url": "https://pubmed.ncbi.nlm.nih.gov/29301962" } ], "uniprot_canonical_ac": "P39007-1" }, { "start_pos": 586, "end_pos": 586, "sequence_org": "K", "sequence_mut": "A", "comment": "Temperature sensitive.", "evidence": [ { "database": "UniProtKB", "id": "P39007", "url": "https://www.uniprot.org/uniprotkb/P39007" }, { "database": "PubMed", "id": "29301962", "url": "https://pubmed.ncbi.nlm.nih.gov/29301962" } ], "uniprot_canonical_ac": "P39007-1" } ], "record_id": "pubmed.29301962", "abstract": "", "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 8 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 5 }, { "field": "total_sites", "count": 5 }, { "field": "n_linked_sites", "count": 5 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "exact_sites", "count": 5 }, { "field": "exact_n_linked_sites", "count": 5 }, { "field": "fuzzy_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "icn3d_view.label", "icn3d_view.url", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl", "filter_code", "uniprot_canonical_ac", "mining_tool" ] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 5 }, { "field": "total_sites", "count": 5 }, { "field": "n_linked_sites", "count": 5 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "exact_sites", "count": 5 }, { "field": "exact_n_linked_sites", "count": 5 }, { "field": "fuzzy_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "icn3d_view.label", "icn3d_view.url", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl", "filter_code", "uniprot_canonical_ac", "mining_tool" ] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_sites", "count": 1 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "exact_sites", "count": 1 }, { "field": "exact_n_linked_sites", "count": 1 }, { "field": "fuzzy_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "icn3d_view.label", "icn3d_view.url", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl", "filter_code", "uniprot_canonical_ac", "mining_tool" ] } ] }, { "title": "The atomic structure of a eukaryotic oligosaccharyltransferase complex.", "journal": "Nature", "date": "2018", "authors": "Bai Lin, Wang Tong, Zhao Gongpu, Kovach Amanda, Li Huilin", "reference": { "type": "PubMed", "id": "29466327", "url": "https://pubmed.ncbi.nlm.nih.gov/29466327" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P48439-1", "protein_name": "Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 3", "gene_name": "OST3", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P33767-1", "protein_name": "Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit WBP1", "gene_name": "WBP1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P41543-1", "protein_name": "Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 1", "gene_name": "OST1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P46964-1", "protein_name": "Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit OST2", "gene_name": "OST2", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q92316-1", "protein_name": "Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit OST5", "gene_name": "OST5", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q02795-1", "protein_name": "Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit SWP1", "gene_name": "SWP1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q99380-1", "protein_name": "Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit OST4", "gene_name": "OST4", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P39007-1", "protein_name": "Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3", "gene_name": "STT3", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P48439", "url": "https://www.uniprot.org/uniprotkb/P48439" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.29466327", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 8 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Functional characterization of Ost3p. Loss of the 34-kD subunit of the Saccharomyces cerevisiae oligosaccharyltransferase results in biased underglycosylation of acceptor substrates.", "journal": "J. Cell Biol.", "date": "1995", "authors": "Karaoglu D, Kelleher D J, Gilmore R", "reference": { "type": "PubMed", "id": "7622558", "url": "https://pubmed.ncbi.nlm.nih.gov/7622558" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P48439-1", "protein_name": "Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 3", "gene_name": "OST3", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P48439", "url": "https://www.uniprot.org/uniprotkb/P48439" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.7622558", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The Saccharomyces cerevisiae oligosaccharyltransferase is a protein complex composed of Wbp1p, Swp1p, and four additional polypeptides.", "journal": "J. Biol. Chem.", "date": "1994", "authors": "Kelleher D J, Gilmore R", "reference": { "type": "PubMed", "id": "8175708", "url": "https://pubmed.ncbi.nlm.nih.gov/8175708" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P48439-1", "protein_name": "Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 3", "gene_name": "OST3", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P33767-1", "protein_name": "Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit WBP1", "gene_name": "WBP1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P41543-1", "protein_name": "Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 1", "gene_name": "OST1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P46964-1", "protein_name": "Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit OST2", "gene_name": "OST2", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q92316-1", "protein_name": "Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit OST5", "gene_name": "OST5", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q02795-1", "protein_name": "Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit SWP1", "gene_name": "SWP1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q99380-1", "protein_name": "Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit OST4", "gene_name": "OST4", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P48439", "url": "https://www.uniprot.org/uniprotkb/P48439" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.8175708", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 7 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The highly conserved Stt3 protein is a subunit of the yeast oligosaccharyltransferase and forms a subcomplex with Ost3p and Ost4p.", "journal": "J. Biol. Chem.", "date": "1997", "authors": "Karaoglu D, Kelleher D J, Gilmore R", "reference": { "type": "PubMed", "id": "9405463", "url": "https://pubmed.ncbi.nlm.nih.gov/9405463" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P48439-1", "protein_name": "Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 3", "gene_name": "OST3", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P33767-1", "protein_name": "Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit WBP1", "gene_name": "WBP1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P41543-1", "protein_name": "Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 1", "gene_name": "OST1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P46964-1", "protein_name": "Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit OST2", "gene_name": "OST2", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q92316-1", "protein_name": "Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit OST5", "gene_name": "OST5", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q02795-1", "protein_name": "Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit SWP1", "gene_name": "SWP1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q99380-1", "protein_name": "Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit OST4", "gene_name": "OST4", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P39007-1", "protein_name": "Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3", "gene_name": "STT3", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P48439", "url": "https://www.uniprot.org/uniprotkb/P48439" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.9405463", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 8 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The oligosaccharyltransferase complex from yeast.", "journal": "Biochim. Biophys. Acta", "date": "1999", "authors": "Knauer R, Lehle L", "reference": { "type": "PubMed", "id": "9878773", "url": "https://pubmed.ncbi.nlm.nih.gov/9878773" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P48439-1", "protein_name": "Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 3", "gene_name": "OST3", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P33767-1", "protein_name": "Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit WBP1", "gene_name": "WBP1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P41543-1", "protein_name": "Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 1", "gene_name": "OST1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P46964-1", "protein_name": "Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit OST2", "gene_name": "OST2", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q03723-1", "protein_name": "Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit OST6", "gene_name": "OST6", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q92316-1", "protein_name": "Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit OST5", "gene_name": "OST5", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q02795-1", "protein_name": "Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit SWP1", "gene_name": "SWP1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q99380-1", "protein_name": "Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit OST4", "gene_name": "OST4", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P48439", "url": "https://www.uniprot.org/uniprotkb/P48439" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.9878773", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 8 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The gene encoding the biotin-apoprotein ligase of Saccharomyces cerevisiae.", "journal": "FEMS Microbiol. Lett.", "date": "1995", "authors": "Cronan J E, Wallace J C", "reference": { "type": "PubMed", "id": "7649444", "url": "https://pubmed.ncbi.nlm.nih.gov/7649444" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P48445-1", "protein_name": "Biotin--protein ligase", "gene_name": "BPL1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P04050-1", "protein_name": "DNA-directed RNA polymerase II subunit RPB1", "gene_name": "RPO21", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P48445", "url": "https://www.uniprot.org/uniprotkb/P48445" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.7649444", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Analysis of a 26,756 bp segment from the left arm of yeast chromosome IV.", "journal": "Yeast", "date": "1996", "authors": "W\u00f6lfl S, Hanemann V, Saluz H P", "reference": { "type": "PubMed", "id": "8972577", "url": "https://pubmed.ncbi.nlm.nih.gov/8972577" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P48445-1", "protein_name": "Biotin--protein ligase", "gene_name": "BPL1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q12334-1", "protein_name": "Protein SCM3", "gene_name": "SCM3", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q12122-1", "protein_name": "Homocitrate synthase, mitochondrial", "gene_name": "LYS21", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q12516-1", "protein_name": "Regulator of phospholipase D SRF1", "gene_name": "SRF1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P23594-1", "protein_name": "Serine/threonine-protein phosphatase PP2A-1 catalytic subunit", "gene_name": "PPH21", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q12434-1", "protein_name": "Rho GDP-dissociation inhibitor", "gene_name": "RDI1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P04050-1", "protein_name": "DNA-directed RNA polymerase II subunit RPB1", "gene_name": "RPO21", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P0CX85-1", "protein_name": "Large ribosomal subunit protein uL29B", "gene_name": "RPL35B", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P19146-1", "protein_name": "ADP-ribosylation factor 2", "gene_name": "ARF2", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q12018-1", "protein_name": "Cell division control protein 53", "gene_name": "CDC53", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q12300-1", "protein_name": "High glucose sensor RGT2", "gene_name": "RGT2", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P0CX87-1", "protein_name": "Small ribosomal subunit protein eS32B", "gene_name": "RPL41B", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P48445", "url": "https://www.uniprot.org/uniprotkb/P48445" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.8972577", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 12 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "A yeast BH3-only protein mediates the mitochondrial pathway of apoptosis.", "journal": "The EMBO journal", "date": "2011-06-14", "authors": "B\u00fcttner Sabrina, Ruli Doris, V\u00f6gtle F-Nora, Galluzzi Lorenzo, Moitzi Barbara, Eisenberg Tobias, Kepp Oliver, Habernig Lukas, Carmona-Gutierrez Didac, Rockenfeller Patrick, Laun Peter, Breitenbach Michael, Khoury Chamel, Fr\u00f6hlich Kai-Uwe, Rechberger Gerald, Meisinger Chris, Kroemer Guido, Madeo Frank", "reference": { "type": "PubMed", "id": "21673659", "url": "https://pubmed.ncbi.nlm.nih.gov/21673659" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P48558-1", "protein_name": "Bax inhibitor 1", "gene_name": "BXI1", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P48558", "url": "https://www.uniprot.org/uniprotkb/P48558" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.21673659", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Yeast Bax inhibitor, Bxi1p, is an ER-localized protein that links the unfolded protein response and programmed cell death in Saccharomyces cerevisiae.", "journal": "PloS one", "date": "2011", "authors": "Cebulski James, Malouin Joshua, Pinches Nathan, Cascio Vincent, Austriaco Nicanor", "reference": { "type": "PubMed", "id": "21673967", "url": "https://pubmed.ncbi.nlm.nih.gov/21673967" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P48558-1", "protein_name": "Bax inhibitor 1", "gene_name": "BXI1", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P48558", "url": "https://www.uniprot.org/uniprotkb/P48558" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.21673967", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Saccharomyces cerevisiae Pra1p/Yip3p interacts with Yip1p and Rab proteins.", "journal": "Biochem. Biophys. Res. Commun.", "date": "2002", "authors": "Calero Monica, Collins Ruth N", "reference": { "type": "PubMed", "id": "11785952", "url": "https://pubmed.ncbi.nlm.nih.gov/11785952" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P48559-1", "protein_name": "GTP-binding protein YPT11", "gene_name": "YPT11", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P51996-1", "protein_name": "GTP-binding protein YPT32/YPT11", "gene_name": "YPT32", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q99260-1", "protein_name": "GTP-binding protein YPT6", "gene_name": "YPT6", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P32939-1", "protein_name": "Ypt/Rab-type GTPase YPT7", "gene_name": "YPT7", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P36018-1", "protein_name": "GTP-binding protein YPT52", "gene_name": "YPT52", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P38146-1", "protein_name": "GTP-binding protein YPT10", "gene_name": "YPT10", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P53039-1", "protein_name": "Protein transport protein YIP1", "gene_name": "YIP1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P38555-1", "protein_name": "GTP-binding protein YPT31/YPT8", "gene_name": "YPT31", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P01123-1", "protein_name": "GTP-binding protein YPT1", "gene_name": "YPT1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P07560-1", "protein_name": "Ras-related protein SEC4", "gene_name": "SEC4", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P53633-1", "protein_name": "Prenylated Rab acceptor 1", "gene_name": "YIP3", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P48559", "url": "https://www.uniprot.org/uniprotkb/P48559" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.11785952", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 11 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Identification of the novel proteins Yip4p and Yip5p as Rab GTPase interacting factors.", "journal": "FEBS Lett.", "date": "2002", "authors": "Calero M, Winand NJ, Collins RN", "reference": { "type": "PubMed", "id": "11943201", "url": "https://pubmed.ncbi.nlm.nih.gov/11943201" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P48559-1", "protein_name": "GTP-binding protein YPT11", "gene_name": "YPT11", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P51996-1", "protein_name": "GTP-binding protein YPT32/YPT11", "gene_name": "YPT32", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P53108-1", "protein_name": "Protein YIP5", "gene_name": "YIP5", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q99260-1", "protein_name": "GTP-binding protein YPT6", "gene_name": "YPT6", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P32939-1", "protein_name": "Ypt/Rab-type GTPase YPT7", "gene_name": "YPT7", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P36018-1", "protein_name": "GTP-binding protein YPT52", "gene_name": "YPT52", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P38146-1", "protein_name": "GTP-binding protein YPT10", "gene_name": "YPT10", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P38555-1", "protein_name": "GTP-binding protein YPT31/YPT8", "gene_name": "YPT31", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P01123-1", "protein_name": "GTP-binding protein YPT1", "gene_name": "YPT1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P07560-1", "protein_name": "Ras-related protein SEC4", "gene_name": "SEC4", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P53093-1", "protein_name": "Protein YIP4", "gene_name": "YIP4", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P53845-1", "protein_name": "Protein transport protein YIF1", "gene_name": "YIF1", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P48559", "url": "https://www.uniprot.org/uniprotkb/P48559" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.11943201", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 12 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Complex formation with Ypt11p, a rab-type small GTPase, is essential to facilitate the function of Myo2p, a class V myosin, in mitochondrial distribution in Saccharomyces cerevisiae.", "journal": "Molecular and cellular biology", "date": "2002-11", "authors": "Itoh Takashi, Watabe Akiko, Toh-E Akio, Matsui Yasushi", "reference": { "type": "PubMed", "id": "12391144", "url": "https://pubmed.ncbi.nlm.nih.gov/12391144" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P48559-1", "protein_name": "GTP-binding protein YPT11", "gene_name": "YPT11", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P19524-1", "protein_name": "Myosin-2", "gene_name": "MYO2", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P48559", "url": "https://www.uniprot.org/uniprotkb/P48559" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "mutagenesis": [ { "start_pos": 102, "end_pos": 102, "sequence_org": "G", "sequence_mut": "D", "comment": "Impairs interaction with MYO2.", "evidence": [ { "database": "UniProtKB", "id": "P48559", "url": "https://www.uniprot.org/uniprotkb/P48559" }, { "database": "PubMed", "id": "12391144", "url": "https://pubmed.ncbi.nlm.nih.gov/12391144" } ], "uniprot_canonical_ac": "P48559-1" }, { "start_pos": 206, "end_pos": 206, "sequence_org": "I", "sequence_mut": "N", "comment": "Abolishes interaction with MYO2.", "evidence": [ { "database": "UniProtKB", "id": "P48559", "url": "https://www.uniprot.org/uniprotkb/P48559" }, { "database": "PubMed", "id": "12391144", "url": "https://pubmed.ncbi.nlm.nih.gov/12391144" } ], "uniprot_canonical_ac": "P48559-1" }, { "start_pos": 1189, "end_pos": 1189, "sequence_org": "V", "sequence_mut": "A", "comment": "In MYO2-573; causes a mitochondria inheritance defect; when associated with G-1288; M-1500; S-1529; G-1546 and R-1559.", "evidence": [ { "database": "UniProtKB", "id": "P19524", "url": "https://www.uniprot.org/uniprotkb/P19524" }, { "database": "PubMed", "id": "12391144", "url": "https://pubmed.ncbi.nlm.nih.gov/12391144" } ], "uniprot_canonical_ac": "P19524-1" }, { "start_pos": 1288, "end_pos": 1288, "sequence_org": "V", "sequence_mut": "A", "comment": "Intragenic suppressor of MYO2-2.", "evidence": [ { "database": "UniProtKB", "id": "P19524", "url": "https://www.uniprot.org/uniprotkb/P19524" }, { "database": "PubMed", "id": "12642614", "url": "https://pubmed.ncbi.nlm.nih.gov/12642614" }, { "database": "PubMed", "id": "12391144", "url": "https://pubmed.ncbi.nlm.nih.gov/12391144" } ], "uniprot_canonical_ac": "P19524-1" }, { "start_pos": 1288, "end_pos": 1288, "sequence_org": "V", "sequence_mut": "G", "comment": "In MYO2-573; causes a mitochondria inheritance defect; when associated with A-1189; M-1500; S-1529; G-1546 and R-1559.", "evidence": [ { "database": "UniProtKB", "id": "P19524", "url": "https://www.uniprot.org/uniprotkb/P19524" }, { "database": "PubMed", "id": "12391144", "url": "https://pubmed.ncbi.nlm.nih.gov/12391144" }, { "database": "PubMed", "id": "12642614", "url": "https://pubmed.ncbi.nlm.nih.gov/12642614" } ], "uniprot_canonical_ac": "P19524-1" }, { "start_pos": 1474, "end_pos": 1474, "sequence_org": "L", "sequence_mut": "S", "comment": "In MYO2-338; abolishes interaction with YPT11; when associated with G-1484 and G-1511.", "evidence": [ { "database": "UniProtKB", "id": "P19524", "url": "https://www.uniprot.org/uniprotkb/P19524" }, { "database": "PubMed", "id": "12391144", "url": "https://pubmed.ncbi.nlm.nih.gov/12391144" } ], "uniprot_canonical_ac": "P19524-1" }, { "start_pos": 1484, "end_pos": 1484, "sequence_org": "E", "sequence_mut": "G", "comment": "In MYO2-338; abolishes interaction with YPT11; when associated with S-1474 and G-1511.", "evidence": [ { "database": "UniProtKB", "id": "P19524", "url": "https://www.uniprot.org/uniprotkb/P19524" }, { "database": "PubMed", "id": "12391144", "url": "https://pubmed.ncbi.nlm.nih.gov/12391144" } ], "uniprot_canonical_ac": "P19524-1" }, { "start_pos": 1500, "end_pos": 1500, "sequence_org": "K", "sequence_mut": "M", "comment": "In MYO2-573; causes a mitochondria inheritance defect; when associated with A-1189; G-1288; S-1529; G-1546 and R-1559.", "evidence": [ { "database": "UniProtKB", "id": "P19524", "url": "https://www.uniprot.org/uniprotkb/P19524" }, { "database": "PubMed", "id": "12391144", "url": "https://pubmed.ncbi.nlm.nih.gov/12391144" } ], "uniprot_canonical_ac": "P19524-1" }, { "start_pos": 1511, "end_pos": 1511, "sequence_org": "D", "sequence_mut": "G", "comment": "In MYO2-338; abolishes interaction with YPT11; when associated with S-1474 and G-1484.", "evidence": [ { "database": "UniProtKB", "id": "P19524", "url": "https://www.uniprot.org/uniprotkb/P19524" }, { "database": "PubMed", "id": "12391144", "url": "https://pubmed.ncbi.nlm.nih.gov/12391144" } ], "uniprot_canonical_ac": "P19524-1" }, { "start_pos": 1529, "end_pos": 1529, "sequence_org": "P", "sequence_mut": "S", "comment": "In MYO2-573; causes a mitochondria inheritance defect; when associated with A-1189; G-1288; M-1500; G-1546 and R-1559.", "evidence": [ { "database": "UniProtKB", "id": "P19524", "url": "https://www.uniprot.org/uniprotkb/P19524" }, { "database": "PubMed", "id": "12391144", "url": "https://pubmed.ncbi.nlm.nih.gov/12391144" } ], "uniprot_canonical_ac": "P19524-1" }, { "start_pos": 1546, "end_pos": 1546, "sequence_org": "E", "sequence_mut": "G", "comment": "In MYO2-573; causes a mitochondria inheritance defect; when associated with A-1189; G-1288; M-1500; S-1529 and R-1559.", "evidence": [ { "database": "UniProtKB", "id": "P19524", "url": "https://www.uniprot.org/uniprotkb/P19524" }, { "database": "PubMed", "id": "12391144", "url": "https://pubmed.ncbi.nlm.nih.gov/12391144" } ], "uniprot_canonical_ac": "P19524-1" }, { "start_pos": 1559, "end_pos": 1559, "sequence_org": "K", "sequence_mut": "R", "comment": "In MYO2-573; causes a mitochondria inheritance defect; when associated with A-1189; G-1288; M-1500; S-1529 and G-1546.", "evidence": [ { "database": "UniProtKB", "id": "P19524", "url": "https://www.uniprot.org/uniprotkb/P19524" }, { "database": "PubMed", "id": "12391144", "url": "https://pubmed.ncbi.nlm.nih.gov/12391144" } ], "uniprot_canonical_ac": "P19524-1" } ], "record_id": "pubmed.12391144", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Finding functional features in Saccharomyces genomes by phylogenetic footprinting.", "journal": "Science", "date": "2003", "authors": "Cliften Paul, Sudarsanam Priya, Desikan Ashwin, Fulton Lucinda, Fulton Bob, Majors John, Waterston Robert, Cohen Barak A, Johnston Mark", "reference": { "type": "PubMed", "id": "12775844", "url": "https://pubmed.ncbi.nlm.nih.gov/12775844" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P48559-1", "protein_name": "GTP-binding protein YPT11", "gene_name": "YPT11", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q3E7Y6-1", "protein_name": "N-terminal-borealin-like protein", "gene_name": "NBL1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P36143-1", "protein_name": "Glycogenin-1", "gene_name": "GLG1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P38086-1", "protein_name": "DNA repair and recombination protein RDH54", "gene_name": "RDH54", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P25565-1", "protein_name": "Putative uncharacterized protein YCL002C", "gene_name": "YCL2C", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P38239-1", "protein_name": "Uncharacterized RING finger protein YBR062C", "gene_name": "YBR0528", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P38740-1", "protein_name": "Uncharacterized protein YHL026C", "gene_name": "", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q02981-1", "protein_name": "ABC1 family protein YPL109C, mitochondrial", "gene_name": "LPH17C", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q06089-1", "protein_name": "Uncharacterized mitochondrial outer membrane protein YPR098C", "gene_name": "", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q2V2P0-1", "protein_name": "Uncharacterized protein YPR145C-A", "gene_name": "", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q2V2P1-1", "protein_name": "Coiled-coil domain-containing protein YLR146W-A", "gene_name": "", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q2V2P2-1", "protein_name": "Uncharacterized protein YKL065W-A", "gene_name": "", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q2V2P3-1", "protein_name": "Uncharacterized protein YKL023C-A", "gene_name": "", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q2V2P4-1", "protein_name": "Mitofissin", "gene_name": "ATG44", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q2V2P5-1", "protein_name": "Uncharacterized protein YIL102C-A", "gene_name": "", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q2V2P6-1", "protein_name": "Uncharacterized protein YGL194C-A", "gene_name": "", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q2V2P7-1", "protein_name": "Uncharacterized protein YDR461C-A", "gene_name": "", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q2V2P8-1", "protein_name": "Inner kinetochore subunit WIP1", "gene_name": "WIP1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q2V2Q0-1", "protein_name": "Putative uncharacterized protein YDL007C-A", "gene_name": "", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P36004-1", "protein_name": "Probable serine/threonine-protein kinase KKQ8", "gene_name": "KKQ8", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P36039-1", "protein_name": "ER membrane protein complex subunit 3", "gene_name": "EMC3", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q00947-1", "protein_name": "Transcription factor STP1", "gene_name": "STP1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q07418-1", "protein_name": "Peroxisomal membrane protein import receptor PEX19", "gene_name": "PEX19", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q08601-1", "protein_name": "Metacaspase-1", "gene_name": "MCA1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q12468-1", "protein_name": "COP9 signalosome complex subunit 5", "gene_name": "RRI1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P53330-1", "protein_name": "Regulator of Ty1 transposition protein 102", "gene_name": "RTT102", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P40511-1", "protein_name": "Sporulation-specific protein 22", "gene_name": "SPO22", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P40858-1", "protein_name": "Large ribosomal subunit protein bL21m", "gene_name": "MRPL49", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P47084-1", "protein_name": "MIOREX complex component 12", "gene_name": "MRX12", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P53961-1", "protein_name": "Phosphatidylinositol N-acetylglucosaminyltransferase subunit GPI15", "gene_name": "GPI15", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q05778-1", "protein_name": "Proteasome chaperone 1", "gene_name": "PBA1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q2V2P9-1", "protein_name": "Cytochrome c oxidase subunit 26, mitochondrial", "gene_name": "COX26", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q3E833-1", "protein_name": "EKC/KEOPS complex subunit PCC1", "gene_name": "PCC1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P26188-1", "protein_name": "Methylated-DNA--protein-cysteine methyltransferase", "gene_name": "MGT1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P38164-1", "protein_name": "SEH-associated protein 4", "gene_name": "SEA4", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P0C5R9-1", "protein_name": "V-type proton ATPase subunit f", "gene_name": "", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P48559", "url": "https://www.uniprot.org/uniprotkb/P48559" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.12775844", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 36 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Mmr1p is a mitochondrial factor for Myo2p-dependent inheritance of mitochondria in the budding yeast.", "journal": "The EMBO journal", "date": "2004-07-07", "authors": "Itoh Takashi, Toh-E Akio, Matsui Yasushi", "reference": { "type": "PubMed", "id": "15201867", "url": "https://pubmed.ncbi.nlm.nih.gov/15201867" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P48559-1", "protein_name": "GTP-binding protein YPT11", "gene_name": "YPT11", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q06324-1", "protein_name": "Mitochondrial MYO2 receptor-related protein 1", "gene_name": "MMR1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P19524-1", "protein_name": "Myosin-2", "gene_name": "MYO2", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P48559", "url": "https://www.uniprot.org/uniprotkb/P48559" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.15201867", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "A type V myosin (Myo2p) and a Rab-like G-protein (Ypt11p) are required for retention of newly inherited mitochondria in yeast cells during cell division.", "journal": "Molecular biology of the cell", "date": "2004-09", "authors": "Boldogh Istvan R, Ramcharan Sharmilee L, Yang Hyeong-Cheol, Pon Liza A", "reference": { "type": "PubMed", "id": "15215313", "url": "https://pubmed.ncbi.nlm.nih.gov/15215313" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P48559-1", "protein_name": "GTP-binding protein YPT11", "gene_name": "YPT11", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P48559", "url": "https://www.uniprot.org/uniprotkb/P48559" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.15215313", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Bioinformatic and comparative localization of Rab proteins reveals functional insights into the uncharacterized GTPases Ypt10p and Ypt11p.", "journal": "Molecular and cellular biology", "date": "2006-10", "authors": "Buvelot Frei St\u00e9phanie, Rahl Peter B, Nussbaum Maria, Briggs Benjamin J, Calero Monica, Janeczko Stephanie, Regan Andrew D, Chen Catherine Z, Barral Yves, Whittaker Gary R, Collins Ruth N", "reference": { "type": "PubMed", "id": "16980630", "url": "https://pubmed.ncbi.nlm.nih.gov/16980630" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P48559-1", "protein_name": "GTP-binding protein YPT11", "gene_name": "YPT11", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P48559", "url": "https://www.uniprot.org/uniprotkb/P48559" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.16980630", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Multiple pathways influence mitochondrial inheritance in budding yeast.", "journal": "Genetics", "date": "2008-02", "authors": "Frederick Rebecca L, Okamoto Koji, Shaw Janet M", "reference": { "type": "PubMed", "id": "18245340", "url": "https://pubmed.ncbi.nlm.nih.gov/18245340" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P48559-1", "protein_name": "GTP-binding protein YPT11", "gene_name": "YPT11", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P53171-1", "protein_name": "Genetic interactor of prohibitin 7, mitochondrial", "gene_name": "GEP7", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P48559", "url": "https://www.uniprot.org/uniprotkb/P48559" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.18245340", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Mitochondrial association, protein phosphorylation, and degradation regulate the availability of the active Rab GTPase Ypt11 for mitochondrial inheritance.", "journal": "Molecular biology of the cell", "date": "2013-04", "authors": "Lewandowska Agnieszka, Macfarlane Jane, Shaw Janet M", "reference": { "type": "PubMed", "id": "23427260", "url": "https://pubmed.ncbi.nlm.nih.gov/23427260" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P48559-1", "protein_name": "GTP-binding protein YPT11", "gene_name": "YPT11", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P48559", "url": "https://www.uniprot.org/uniprotkb/P48559" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "phosphorylation": [ { "start_pos": 158, "end_pos": 158, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P48559", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P48559" }, { "database": "PubMed", "id": "20702584", "url": "https://pubmed.ncbi.nlm.nih.gov/20702584" }, { "database": "PubMed", "id": "23427260", "url": "https://pubmed.ncbi.nlm.nih.gov/23427260" }, { "database": "SGD", "id": "S000005248", "url": "https://www.yeastgenome.org/locus/S000005248" }, { "database": "PubMed", "id": "18407956", "url": "https://pubmed.ncbi.nlm.nih.gov/18407956" }, { "database": "PubMed", "id": "23749301", "url": "https://pubmed.ncbi.nlm.nih.gov/23749301" }, { "database": "PubMed", "id": "32597660", "url": "https://pubmed.ncbi.nlm.nih.gov/32597660" }, { "database": "PubMed", "id": "33481703", "url": "https://pubmed.ncbi.nlm.nih.gov/33481703" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" } ], "site_lbl": "Ser158", "uniprot_canonical_ac": "P48559-1" }, { "start_pos": 159, "end_pos": 159, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P48559", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P48559" }, { "database": "PubMed", "id": "19779198", "url": "https://pubmed.ncbi.nlm.nih.gov/19779198" }, { "database": "PubMed", "id": "23427260", "url": "https://pubmed.ncbi.nlm.nih.gov/23427260" }, { "database": "SGD", "id": "S000005248", "url": "https://www.yeastgenome.org/locus/S000005248" }, { "database": "PubMed", "id": "33481703", "url": "https://pubmed.ncbi.nlm.nih.gov/33481703" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" } ], "site_lbl": "Ser159", "uniprot_canonical_ac": "P48559-1" } ], "record_id": "pubmed.23427260", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Pol kappa: A DNA polymerase required for sister chromatid cohesion.", "journal": "Science (New York, N.Y.)", "date": "2000", "authors": "Wang Z, Castano IB, De Las Penas A, Adams C, Christman MF", "reference": { "type": "PubMed", "id": "10926539", "url": "https://pubmed.ncbi.nlm.nih.gov/10926539" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P48561-1", "protein_name": "Poly(A) RNA polymerase protein 1", "gene_name": "TRF5", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q5XG87-1", "protein_name": "Terminal nucleotidyltransferase 4A", "gene_name": "TENT4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P53632-1", "protein_name": "Poly(A) RNA polymerase protein 2", "gene_name": "PAP2", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P48561", "url": "https://www.uniprot.org/uniprotkb/P48561" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "mutagenesis": [ { "start_pos": 236, "end_pos": 238, "sequence_org": "DID", "sequence_mut": "AIA", "comment": "In TRF4-236; lethal.", "evidence": [ { "database": "UniProtKB", "id": "P53632", "url": "https://www.uniprot.org/uniprotkb/P53632" }, { "database": "PubMed", "id": "16431988", "url": "https://pubmed.ncbi.nlm.nih.gov/16431988" }, { "database": "PubMed", "id": "10926539", "url": "https://pubmed.ncbi.nlm.nih.gov/10926539" }, { "database": "PubMed", "id": "11861546", "url": "https://pubmed.ncbi.nlm.nih.gov/11861546" } ], "uniprot_canonical_ac": "P53632-1" } ], "record_id": "pubmed.10926539", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Eukaryotic DNA polymerases: proposal for a revised nomenclature.", "journal": "J. Biol. Chem.", "date": "2001", "authors": "Burgers P M, Koonin E V, Bruford E, Blanco L, Burtis K C, Christman M F, Copeland W C, Friedberg E C, Hanaoka F, Hinkle D C, Lawrence C W, Nakanishi M, Ohmori H, Prakash L, Prakash S, Reynaud C A, Sugino A, Todo T, Wang Z, Weill J C, Woodgate R", "reference": { "type": "PubMed", "id": "11579108", "url": "https://pubmed.ncbi.nlm.nih.gov/11579108" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P48561-1", "protein_name": "Poly(A) RNA polymerase protein 1", "gene_name": "TRF5", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P53632-1", "protein_name": "Poly(A) RNA polymerase protein 2", "gene_name": "PAP2", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P48561", "url": "https://www.uniprot.org/uniprotkb/P48561" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.11579108", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Saccharomyces cerevisiae DNA polymerase epsilon and polymerase sigma interact physically and functionally, suggesting a role for polymerase epsilon in sister chromatid cohesion.", "journal": "Molecular and cellular biology", "date": "2003-04", "authors": "Edwards Shaune, Li Caroline M, Levy Daniel L, Brown Jessica, Snow Peter M, Campbell Judith L", "reference": { "type": "PubMed", "id": "12665575", "url": "https://pubmed.ncbi.nlm.nih.gov/12665575" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P48561-1", "protein_name": "Poly(A) RNA polymerase protein 1", "gene_name": "TRF5", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P53632-1", "protein_name": "Poly(A) RNA polymerase protein 2", "gene_name": "PAP2", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P48561", "url": "https://www.uniprot.org/uniprotkb/P48561" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.12665575", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Trf4 and Trf5 proteins of Saccharomyces cerevisiae exhibit poly(A) RNA polymerase activity but no DNA polymerase activity.", "journal": "Molecular and cellular biology", "date": "2005-11", "authors": "Haracska Lajos, Johnson Robert E, Prakash Louise, Prakash Satya", "reference": { "type": "PubMed", "id": "16260630", "url": "https://pubmed.ncbi.nlm.nih.gov/16260630" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P48561-1", "protein_name": "Poly(A) RNA polymerase protein 1", "gene_name": "TRF5", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P53632-1", "protein_name": "Poly(A) RNA polymerase protein 2", "gene_name": "PAP2", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P48561", "url": "https://www.uniprot.org/uniprotkb/P48561" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.16260630", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Contributions of Trf4p- and Trf5p-dependent polyadenylation to the processing and degradative functions of the yeast nuclear exosome.", "journal": "RNA (New York, N.Y.)", "date": "2006-01", "authors": "Egecioglu Defne E, Henras Anthony K, Chanfreau Guillaume F", "reference": { "type": "PubMed", "id": "16373491", "url": "https://pubmed.ncbi.nlm.nih.gov/16373491" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P48561-1", "protein_name": "Poly(A) RNA polymerase protein 1", "gene_name": "TRF5", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P53632-1", "protein_name": "Poly(A) RNA polymerase protein 2", "gene_name": "PAP2", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P48561", "url": "https://www.uniprot.org/uniprotkb/P48561" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.16373491", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Yeast Trf5p is a nuclear poly(A) polymerase.", "journal": "EMBO reports", "date": "2006-02", "authors": "Houseley Jonathan, Tollervey David", "reference": { "type": "PubMed", "id": "16374505", "url": "https://pubmed.ncbi.nlm.nih.gov/16374505" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P48561-1", "protein_name": "Poly(A) RNA polymerase protein 1", "gene_name": "TRF5", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P40507-1", "protein_name": "Protein AIR1", "gene_name": "AIR1", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P48561", "url": "https://www.uniprot.org/uniprotkb/P48561" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.16374505", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Nuclear RNA surveillance in Saccharomyces cerevisiae: Trf4p-dependent polyadenylation of nascent hypomethylated tRNA and an aberrant form of 5S rRNA.", "journal": "RNA (New York, N.Y.)", "date": "2006-03", "authors": "Kadaba Sujatha, Wang Xuying, Anderson James T", "reference": { "type": "PubMed", "id": "16431988", "url": "https://pubmed.ncbi.nlm.nih.gov/16431988" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P48561-1", "protein_name": "Poly(A) RNA polymerase protein 1", "gene_name": "TRF5", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P53632-1", "protein_name": "Poly(A) RNA polymerase protein 2", "gene_name": "PAP2", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P48561", "url": "https://www.uniprot.org/uniprotkb/P48561" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "mutagenesis": [ { "start_pos": 236, "end_pos": 238, "sequence_org": "DID", "sequence_mut": "AIA", "comment": "In TRF4-236; lethal.", "evidence": [ { "database": "UniProtKB", "id": "P53632", "url": "https://www.uniprot.org/uniprotkb/P53632" }, { "database": "PubMed", "id": "16431988", "url": "https://pubmed.ncbi.nlm.nih.gov/16431988" }, { "database": "PubMed", "id": "10926539", "url": "https://pubmed.ncbi.nlm.nih.gov/10926539" }, { "database": "PubMed", "id": "11861546", "url": "https://pubmed.ncbi.nlm.nih.gov/11861546" } ], "uniprot_canonical_ac": "P53632-1" } ], "record_id": "pubmed.16431988", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Contribution of Trf4/5 and the nuclear exosome to genome stability through regulation of histone mRNA levels in Saccharomyces cerevisiae.", "journal": "Genetics", "date": "2007-03", "authors": "Reis Clara C, Campbell Judith L", "reference": { "type": "PubMed", "id": "17179095", "url": "https://pubmed.ncbi.nlm.nih.gov/17179095" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P48561-1", "protein_name": "Poly(A) RNA polymerase protein 1", "gene_name": "TRF5", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P53632-1", "protein_name": "Poly(A) RNA polymerase protein 2", "gene_name": "PAP2", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P48561", "url": "https://www.uniprot.org/uniprotkb/P48561" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.17179095", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "A novel family of TRF (DNA topoisomerase I-related function) genes required for proper nuclear segregation.", "journal": "Nucleic acids research", "date": "1996-06-15", "authors": "Casta\u00f1o I B, Heath-Pagliuso S, Sadoff B U, Fitzhugh D J, Christman M F", "reference": { "type": "PubMed", "id": "8710513", "url": "https://pubmed.ncbi.nlm.nih.gov/8710513" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P48561-1", "protein_name": "Poly(A) RNA polymerase protein 1", "gene_name": "TRF5", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P53632-1", "protein_name": "Poly(A) RNA polymerase protein 2", "gene_name": "PAP2", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P48561", "url": "https://www.uniprot.org/uniprotkb/P48561" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.8710513", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Yeast Ysl2p, homologous to Sec7 domain guanine nucleotide exchange factors, functions in endocytosis and maintenance of vacuole integrity and interacts with the Arf-Like small GTPase Arl1p.", "journal": "Molecular and cellular biology", "date": "2002-07", "authors": "Jochum Alexandra, Jackson David, Schwarz Heinz, Pipkorn R\u00fcdiger, Singer-Kr\u00fcger Birgit", "reference": { "type": "PubMed", "id": "12052896", "url": "https://pubmed.ncbi.nlm.nih.gov/12052896" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P48563-1", "protein_name": "Protein MON2", "gene_name": "MON2", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P38116-1", "protein_name": "ADP-ribosylation factor-like protein 1", "gene_name": "ARL1", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P48563", "url": "https://www.uniprot.org/uniprotkb/P48563" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.12052896", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Genomic screen for vacuolar protein sorting genes in Saccharomyces cerevisiae.", "journal": "Molecular biology of the cell", "date": "2002-07", "authors": "Bonangelino Cecilia J, Chavez Edna M, Bonifacino Juan S", "reference": { "type": "PubMed", "id": "12134085", "url": "https://pubmed.ncbi.nlm.nih.gov/12134085" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P48563-1", "protein_name": "Protein MON2", "gene_name": "MON2", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P53129-1", "protein_name": "Vacuolar fusion protein MON1", "gene_name": "MON1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P36116-1", "protein_name": "Vacuolar protein sorting-associated protein 51", "gene_name": "VPS51", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "O13549-1", "protein_name": "Uncharacterized protein VPS63", "gene_name": "VPS63", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P53853-1", "protein_name": "Vacuolar protein sorting-associated protein 75", "gene_name": "VPS75", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q03388-1", "protein_name": "Vacuolar protein sorting-associated protein 72", "gene_name": "VPS72", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q03944-1", "protein_name": "Vacuolar protein sorting-associated protein 64", "gene_name": "VPS64", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q06385-1", "protein_name": "Vacuolar protein sorting-associated protein 74", "gene_name": "VPS74", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q06508-1", "protein_name": "Lysophosphatidic acid:oleoyl-CoA acyltransferase 1", "gene_name": "LOA1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q03433-1", "protein_name": "Vacuolar protein sorting-associated protein 71", "gene_name": "VPS71", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P47161-1", "protein_name": "Vacuolar protein sorting-associated protein 70", "gene_name": "VPS70", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P53142-1", "protein_name": "Vacuolar protein sorting-associated protein 73", "gene_name": "VPS73", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P53285-1", "protein_name": "Vacuolar protein sorting-associated protein 62", "gene_name": "VPS62", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q12016-1", "protein_name": "Vacuolar protein sorting-associated protein 68", "gene_name": "VPS68", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P48563", "url": "https://www.uniprot.org/uniprotkb/P48563" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.12134085", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 14 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Molecular interactions of yeast Neo1p, an essential member of the Drs2 family of aminophospholipid translocases, and its role in membrane trafficking within the endomembrane system.", "journal": "Mol. Cell. Biol.", "date": "2004", "authors": "Wicky Sidonie, Schwarz Heinz, Singer-Kr\u00fcger Birgit", "reference": { "type": "PubMed", "id": "15314152", "url": "https://pubmed.ncbi.nlm.nih.gov/15314152" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P48563-1", "protein_name": "Protein MON2", "gene_name": "MON2", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P40527-1", "protein_name": "Phospholipid-transporting ATPase NEO1", "gene_name": "NEO1", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P48563", "url": "https://www.uniprot.org/uniprotkb/P48563" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.15314152", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Yeast Mon2p is a highly conserved protein that functions in the cytoplasm-to-vacuole transport pathway and is required for Golgi homeostasis.", "journal": "Journal of cell science", "date": "2005-10-15", "authors": "Efe Jem A, Plattner Fabienne, Hulo Nicolas, Kressler Dieter, Emr Scott D, Deloche Olivier", "reference": { "type": "PubMed", "id": "16219684", "url": "https://pubmed.ncbi.nlm.nih.gov/16219684" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P48563-1", "protein_name": "Protein MON2", "gene_name": "MON2", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q80TL7-1", "protein_name": "Protein MON2 homolog", "gene_name": "Mon2", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "Q7Z3U7-1", "protein_name": "Protein MON2 homolog", "gene_name": "MON2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q03921-1", "protein_name": "Protein DOP1", "gene_name": "DOP1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q9VLT1-1", "protein_name": "Protein MON2 homolog", "gene_name": "mon2", "tax_name": "Fruit fly" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P48563", "url": "https://www.uniprot.org/uniprotkb/P48563" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.16219684", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 5 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Mon2, a relative of large Arf exchange factors, recruits Dop1 to the Golgi apparatus.", "journal": "The Journal of biological chemistry", "date": "2006-01-27", "authors": "Gillingham Alison K, Whyte James R C, Panic Bojana, Munro Sean", "reference": { "type": "PubMed", "id": "16301316", "url": "https://pubmed.ncbi.nlm.nih.gov/16301316" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P48563-1", "protein_name": "Protein MON2", "gene_name": "MON2", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q7Z3U7-1", "protein_name": "Protein MON2 homolog", "gene_name": "MON2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q03921-1", "protein_name": "Protein DOP1", "gene_name": "DOP1", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P48563", "url": "https://www.uniprot.org/uniprotkb/P48563" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.16301316", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Quantitative high-content imaging identifies novel regulators of Neo1 trafficking at endosomes.", "journal": "Mol. Biol. Cell", "date": "2017", "authors": "Dalton Lauren E, Bean Bj\u00f6rn D M, Davey Michael, Conibear Elizabeth", "reference": { "type": "PubMed", "id": "28404745", "url": "https://pubmed.ncbi.nlm.nih.gov/28404745" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P48563-1", "protein_name": "Protein MON2", "gene_name": "MON2", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P38116-1", "protein_name": "ADP-ribosylation factor-like protein 1", "gene_name": "ARL1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q07878-1", "protein_name": "Intermembrane lipid transfer protein VPS13", "gene_name": "VPS13", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q08826-1", "protein_name": "Sorting nexin-3", "gene_name": "SNX3", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P40527-1", "protein_name": "Phospholipid-transporting ATPase NEO1", "gene_name": "NEO1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q03921-1", "protein_name": "Protein DOP1", "gene_name": "DOP1", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P48563", "url": "https://www.uniprot.org/uniprotkb/P48563" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "mutagenesis": [ { "start_pos": 1627, "end_pos": 1627, "sequence_org": "L", "sequence_mut": "S", "comment": "Increases localization to peroxisomes. Decreases localization to nuclear envelope-vacuole contact sites and endosomes. Does not appear to affect sorting at early and late endosomes.", "evidence": [ { "database": "UniProtKB", "id": "Q07878", "url": "https://www.uniprot.org/uniprotkb/Q07878" }, { "database": "PubMed", "id": "28864540", "url": "https://pubmed.ncbi.nlm.nih.gov/28864540" }, { "database": "PubMed", "id": "28404745", "url": "https://pubmed.ncbi.nlm.nih.gov/28404745" }, { "database": "PubMed", "id": "26370498", "url": "https://pubmed.ncbi.nlm.nih.gov/26370498" } ], "uniprot_canonical_ac": "Q07878-1" }, { "start_pos": 716, "end_pos": 716, "sequence_org": "D", "sequence_mut": "H", "comment": "Decreases localization to nuclear envelope-vacuole contact sites. Does not appear to affect sorting at early and late endosomes.", "evidence": [ { "database": "UniProtKB", "id": "Q07878", "url": "https://www.uniprot.org/uniprotkb/Q07878" }, { "database": "PubMed", "id": "28404745", "url": "https://pubmed.ncbi.nlm.nih.gov/28404745" }, { "database": "PubMed", "id": "26370498", "url": "https://pubmed.ncbi.nlm.nih.gov/26370498" } ], "uniprot_canonical_ac": "Q07878-1" }, { "start_pos": 65, "end_pos": 67, "sequence_org": "FEM", "sequence_mut": "AAA", "comment": "Sensitive to neomycin and trifluoperazine; sensitivity is suppressed by knockout of ANY1.", "evidence": [ { "database": "UniProtKB", "id": "P40527", "url": "https://www.uniprot.org/uniprotkb/P40527" }, { "database": "PubMed", "id": "28404745", "url": "https://pubmed.ncbi.nlm.nih.gov/28404745" } ], "uniprot_canonical_ac": "P40527-1" } ], "record_id": "pubmed.28404745", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 6 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Identification of novel, evolutionarily conserved Cdc42p-interacting proteins and of redundant pathways linking Cdc24p and Cdc42p to actin polarization in yeast.", "journal": "Molecular biology of the cell", "date": "2000-02", "authors": "Bi E, Chiavetta J B, Chen H, Chen G C, Chan C S, Pringle J R", "reference": { "type": "PubMed", "id": "10679030", "url": "https://pubmed.ncbi.nlm.nih.gov/10679030" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P48566-1", "protein_name": "GTPase-activating protein GYP3", "gene_name": "MSB3", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q12317-1", "protein_name": "GTPase-activating protein MSB4", "gene_name": "MSB4", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q12344-1", "protein_name": "GTPase-activating protein GYP5", "gene_name": "GYP5", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P48566", "url": "https://www.uniprot.org/uniprotkb/P48566" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.10679030", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The GAP activity of Msb3p and Msb4p for the Rab GTPase Sec4p is required for efficient exocytosis and actin organization.", "journal": "The Journal of cell biology", "date": "2003-08-18", "authors": "Gao Xiang-Dong, Albert Stefan, Tcheperegine Serguei E, Burd Christopher G, Gallwitz Dieter, Bi Erfei", "reference": { "type": "PubMed", "id": "12913108", "url": "https://pubmed.ncbi.nlm.nih.gov/12913108" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P48566-1", "protein_name": "GTPase-activating protein GYP3", "gene_name": "MSB3", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q12317-1", "protein_name": "GTPase-activating protein MSB4", "gene_name": "MSB4", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P48566", "url": "https://www.uniprot.org/uniprotkb/P48566" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "mutagenesis": [ { "start_pos": 282, "end_pos": 282, "sequence_org": "R", "sequence_mut": "F", "comment": "Reduced GAP activity.", "evidence": [ { "database": "UniProtKB", "id": "P48566", "url": "https://www.uniprot.org/uniprotkb/P48566" }, { "database": "PubMed", "id": "12913108", "url": "https://pubmed.ncbi.nlm.nih.gov/12913108" } ], "uniprot_canonical_ac": "P48566-1" }, { "start_pos": 282, "end_pos": 282, "sequence_org": "R", "sequence_mut": "K", "comment": "Reduced GAP activity.", "evidence": [ { "database": "UniProtKB", "id": "P48566", "url": "https://www.uniprot.org/uniprotkb/P48566" }, { "database": "PubMed", "id": "12913108", "url": "https://pubmed.ncbi.nlm.nih.gov/12913108" } ], "uniprot_canonical_ac": "P48566-1" }, { "start_pos": 200, "end_pos": 200, "sequence_org": "R", "sequence_mut": "F", "comment": "Reduced GAP activity.", "evidence": [ { "database": "UniProtKB", "id": "Q12317", "url": "https://www.uniprot.org/uniprotkb/Q12317" }, { "database": "PubMed", "id": "12913108", "url": "https://pubmed.ncbi.nlm.nih.gov/12913108" } ], "uniprot_canonical_ac": "Q12317-1" }, { "start_pos": 200, "end_pos": 200, "sequence_org": "R", "sequence_mut": "K", "comment": "Reduced GAP activity.", "evidence": [ { "database": "UniProtKB", "id": "Q12317", "url": "https://www.uniprot.org/uniprotkb/Q12317" }, { "database": "PubMed", "id": "12913108", "url": "https://pubmed.ncbi.nlm.nih.gov/12913108" } ], "uniprot_canonical_ac": "Q12317-1" } ], "record_id": "pubmed.12913108", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "A dominant-negative MEC3 mutant uncovers new functions for the Rad17 complex and Tel1.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2002-10-01", "authors": "Giannattasio Michele, Sommariva Elena, Vercillo Raffaella, Lippi-Boncambi Filippo, Liberi Giordano, Foiani Marco, Plevani Paolo, Muzi-Falconi Marco", "reference": { "type": "PubMed", "id": "12271137", "url": "https://pubmed.ncbi.nlm.nih.gov/12271137" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P48581-1", "protein_name": "DNA damage checkpoint control protein RAD17", "gene_name": "RAD17", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q02574-1", "protein_name": "DNA damage checkpoint control protein MEC3", "gene_name": "MEC3", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q08949-1", "protein_name": "DNA damage checkpoint protein 1", "gene_name": "DDC1", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P48581", "url": "https://www.uniprot.org/uniprotkb/P48581" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.12271137", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Yeast Rad17/Mec3/Ddc1: a sliding clamp for the DNA damage checkpoint.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2003-03-04", "authors": "Majka Jerzy, Burgers Peter M J", "reference": { "type": "PubMed", "id": "12604797", "url": "https://pubmed.ncbi.nlm.nih.gov/12604797" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P48581-1", "protein_name": "DNA damage checkpoint control protein RAD17", "gene_name": "RAD17", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q02574-1", "protein_name": "DNA damage checkpoint control protein MEC3", "gene_name": "MEC3", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q08949-1", "protein_name": "DNA damage checkpoint protein 1", "gene_name": "DDC1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P32641-1", "protein_name": "Checkpoint protein RAD24", "gene_name": "RAD24", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P38251-1", "protein_name": "Replication factor C subunit 5", "gene_name": "RFC5", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P38629-1", "protein_name": "Replication factor C subunit 3", "gene_name": "RFC3", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P40339-1", "protein_name": "Replication factor C subunit 4", "gene_name": "RFC4", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P40348-1", "protein_name": "Replication factor C subunit 2", "gene_name": "RFC2", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P48581", "url": "https://www.uniprot.org/uniprotkb/P48581" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.12604797", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 8 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Correlation between checkpoint activation and in vivo assembly of the yeast checkpoint complex Rad17-Mec3-Ddc1.", "journal": "The Journal of biological chemistry", "date": "2003-06-20", "authors": "Giannattasio Michele, Sabbioneda Simone, Minuzzo Mario, Plevani Paolo, Muzi-Falconi Marco", "reference": { "type": "PubMed", "id": "12672803", "url": "https://pubmed.ncbi.nlm.nih.gov/12672803" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P48581-1", "protein_name": "DNA damage checkpoint control protein RAD17", "gene_name": "RAD17", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q02574-1", "protein_name": "DNA damage checkpoint control protein MEC3", "gene_name": "MEC3", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q08949-1", "protein_name": "DNA damage checkpoint protein 1", "gene_name": "DDC1", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P48581", "url": "https://www.uniprot.org/uniprotkb/P48581" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.12672803", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Requirement for ATP by the DNA damage checkpoint clamp loader.", "journal": "J. Biol. Chem.", "date": "2004", "authors": "Majka Jerzy, Chung Brian Y, Burgers Peter M J", "reference": { "type": "PubMed", "id": "15014082", "url": "https://pubmed.ncbi.nlm.nih.gov/15014082" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P48581-1", "protein_name": "DNA damage checkpoint control protein RAD17", "gene_name": "RAD17", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q02574-1", "protein_name": "DNA damage checkpoint control protein MEC3", "gene_name": "MEC3", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q08949-1", "protein_name": "DNA damage checkpoint protein 1", "gene_name": "DDC1", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P48581", "url": "https://www.uniprot.org/uniprotkb/P48581" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.15014082", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Function of Rad17/Mec3/Ddc1 and its partial complexes in the DNA damage checkpoint.", "journal": "DNA repair", "date": "2005-09-28", "authors": "Majka Jerzy, Burgers Peter M", "reference": { "type": "PubMed", "id": "16137930", "url": "https://pubmed.ncbi.nlm.nih.gov/16137930" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P48581-1", "protein_name": "DNA damage checkpoint control protein RAD17", "gene_name": "RAD17", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q02574-1", "protein_name": "DNA damage checkpoint control protein MEC3", "gene_name": "MEC3", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q08949-1", "protein_name": "DNA damage checkpoint protein 1", "gene_name": "DDC1", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P48581", "url": "https://www.uniprot.org/uniprotkb/P48581" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.16137930", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The 9-1-1 checkpoint clamp physically interacts with polzeta and is partially required for spontaneous polzeta-dependent mutagenesis in Saccharomyces cerevisiae.", "journal": "The Journal of biological chemistry", "date": "2005-11-18", "authors": "Sabbioneda Simone, Minesinger Brenda K, Giannattasio Michele, Plevani Paolo, Muzi-Falconi Marco, Jinks-Robertson Sue", "reference": { "type": "PubMed", "id": "16169844", "url": "https://pubmed.ncbi.nlm.nih.gov/16169844" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P48581-1", "protein_name": "DNA damage checkpoint control protein RAD17", "gene_name": "RAD17", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q02574-1", "protein_name": "DNA damage checkpoint control protein MEC3", "gene_name": "MEC3", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q08949-1", "protein_name": "DNA damage checkpoint protein 1", "gene_name": "DDC1", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P48581", "url": "https://www.uniprot.org/uniprotkb/P48581" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.16169844", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Psoralen-sensitive mutant pso9-1 of Saccharomyces cerevisiae contains a mutant allele of the DNA damage checkpoint gene MEC3.", "journal": "DNA Repair", "date": "2006", "authors": "Cardone J M, Revers L F, Machado R M, Bonatto D, Brendel M, Henriques J A P", "reference": { "type": "PubMed", "id": "16202664", "url": "https://pubmed.ncbi.nlm.nih.gov/16202664" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P48581-1", "protein_name": "DNA damage checkpoint control protein RAD17", "gene_name": "RAD17", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q02574-1", "protein_name": "DNA damage checkpoint control protein MEC3", "gene_name": "MEC3", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q08949-1", "protein_name": "DNA damage checkpoint protein 1", "gene_name": "DDC1", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P48581", "url": "https://www.uniprot.org/uniprotkb/P48581" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.16202664", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Yeast checkpoint genes in DNA damage processing: implications for repair and arrest.", "journal": "Science (New York, N.Y.)", "date": "1995-12-01", "authors": "Lydall D, Weinert T", "reference": { "type": "PubMed", "id": "7491494", "url": "https://pubmed.ncbi.nlm.nih.gov/7491494" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P48581-1", "protein_name": "DNA damage checkpoint control protein RAD17", "gene_name": "RAD17", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q02574-1", "protein_name": "DNA damage checkpoint control protein MEC3", "gene_name": "MEC3", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P48581", "url": "https://www.uniprot.org/uniprotkb/P48581" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.7491494", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Cloning and characterization of RAD17, a gene controlling cell cycle responses to DNA damage in Saccharomyces cerevisiae.", "journal": "Nucleic acids research", "date": "1996-05-01", "authors": "Siede W, Nusspaumer G, Portillo V, Rodriguez R, Friedberg E C", "reference": { "type": "PubMed", "id": "8649984", "url": "https://pubmed.ncbi.nlm.nih.gov/8649984" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P48581-1", "protein_name": "DNA damage checkpoint control protein RAD17", "gene_name": "RAD17", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P48589-1", "protein_name": "Small ribosomal subunit protein eS12", "gene_name": "RPS12", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P48581", "url": "https://www.uniprot.org/uniprotkb/P48581" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "mutagenesis": [ { "start_pos": 128, "end_pos": 128, "sequence_org": "E", "sequence_mut": "K", "comment": "In RAD17-1; UV-sensitive.", "evidence": [ { "database": "UniProtKB", "id": "P48581", "url": "https://www.uniprot.org/uniprotkb/P48581" }, { "database": "PubMed", "id": "8649984", "url": "https://pubmed.ncbi.nlm.nih.gov/8649984" } ], "uniprot_canonical_ac": "P48581-1" } ], "record_id": "pubmed.8649984", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Role of a complex containing Rad17, Mec3, and Ddc1 in the yeast DNA damage checkpoint pathway.", "journal": "Molecular and cellular biology", "date": "1999-02", "authors": "Kondo T, Matsumoto K, Sugimoto K", "reference": { "type": "PubMed", "id": "9891048", "url": "https://pubmed.ncbi.nlm.nih.gov/9891048" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P48581-1", "protein_name": "DNA damage checkpoint control protein RAD17", "gene_name": "RAD17", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q02574-1", "protein_name": "DNA damage checkpoint control protein MEC3", "gene_name": "MEC3", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q08949-1", "protein_name": "DNA damage checkpoint protein 1", "gene_name": "DDC1", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P48581", "url": "https://www.uniprot.org/uniprotkb/P48581" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.9891048", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Yeast Coq5 C-methyltransferase is required for stability of other polypeptides involved in coenzyme Q biosynthesis.", "journal": "J. Biol. Chem.", "date": "2004", "authors": "Baba Suzie W, Belogrudov Grigory I, Lee Justine C, Lee Peter T, Strahan Jeff, Shepherd Jennifer N, Clarke Catherine F", "reference": { "type": "PubMed", "id": "14701817", "url": "https://pubmed.ncbi.nlm.nih.gov/14701817" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P49017-1", "protein_name": "2-methoxy-6-polyprenyl-1,4-benzoquinol methylase, mitochondrial", "gene_name": "COQ5", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P49017", "url": "https://www.uniprot.org/uniprotkb/P49017" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.14701817", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Crystal structures and catalytic mechanism of the C-methyltransferase Coq5 provide insights into a key step of the yeast coenzyme Q synthesis pathway.", "journal": "Acta Crystallogr. D", "date": "2014", "authors": "Dai Ya-Nan, Zhou Kang, Cao Dong-Dong, Jiang Yong-Liang, Meng Fei, Chi Chang-Biao, Ren Yan-Min, Chen Yuxing, Zhou Cong-Zhao", "reference": { "type": "PubMed", "id": "25084328", "url": "https://pubmed.ncbi.nlm.nih.gov/25084328" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P49017-1", "protein_name": "2-methoxy-6-polyprenyl-1,4-benzoquinol methylase, mitochondrial", "gene_name": "COQ5", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P49017", "url": "https://www.uniprot.org/uniprotkb/P49017" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.25084328", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The COQ5 gene encodes a yeast mitochondrial protein necessary for ubiquinone biosynthesis and the assembly of the respiratory chain.", "journal": "The Journal of biological chemistry", "date": "1997-04-04", "authors": "Dibrov E, Robinson K M, Lemire B D", "reference": { "type": "PubMed", "id": "9083048", "url": "https://pubmed.ncbi.nlm.nih.gov/9083048" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P49017-1", "protein_name": "2-methoxy-6-polyprenyl-1,4-benzoquinol methylase, mitochondrial", "gene_name": "COQ5", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P49017", "url": "https://www.uniprot.org/uniprotkb/P49017" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.9083048", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Active site determination of Gpi8p, a caspase-related enzyme required for glycosylphosphatidylinositol anchor addition to proteins.", "journal": "Biochemistry", "date": "2000", "authors": "Meyer U, Benghezal M, Imhof I, Conzelmann A", "reference": { "type": "PubMed", "id": "10727241", "url": "https://pubmed.ncbi.nlm.nih.gov/10727241" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P49018-1", "protein_name": "GPI-anchor transamidase", "gene_name": "GPI8", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P49018", "url": "https://www.uniprot.org/uniprotkb/P49018" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "mutagenesis": [ { "start_pos": 157, "end_pos": 157, "sequence_org": "H", "sequence_mut": "A", "comment": "Loss of activity.", "evidence": [ { "database": "UniProtKB", "id": "P49018", "url": "https://www.uniprot.org/uniprotkb/P49018" }, { "database": "PubMed", "id": "10727241", "url": "https://pubmed.ncbi.nlm.nih.gov/10727241" }, { "database": "PubMed", "id": "10793132", "url": "https://pubmed.ncbi.nlm.nih.gov/10793132" } ], "uniprot_canonical_ac": "P49018-1" }, { "start_pos": 199, "end_pos": 199, "sequence_org": "C", "sequence_mut": "A", "comment": "Loss of activity.", "evidence": [ { "database": "UniProtKB", "id": "P49018", "url": "https://www.uniprot.org/uniprotkb/P49018" }, { "database": "PubMed", "id": "10727241", "url": "https://pubmed.ncbi.nlm.nih.gov/10727241" }, { "database": "PubMed", "id": "10793132", "url": "https://pubmed.ncbi.nlm.nih.gov/10793132" } ], "uniprot_canonical_ac": "P49018-1" }, { "start_pos": 54, "end_pos": 54, "sequence_org": "H", "sequence_mut": "A", "comment": "Partial loss of activity.", "evidence": [ { "database": "UniProtKB", "id": "P49018", "url": "https://www.uniprot.org/uniprotkb/P49018" }, { "database": "PubMed", "id": "10727241", "url": "https://pubmed.ncbi.nlm.nih.gov/10727241" } ], "uniprot_canonical_ac": "P49018-1" }, { "start_pos": 60, "end_pos": 60, "sequence_org": "S", "sequence_mut": "A", "comment": "No loss of activity.", "evidence": [ { "database": "UniProtKB", "id": "P49018", "url": "https://www.uniprot.org/uniprotkb/P49018" }, { "database": "PubMed", "id": "10727241", "url": "https://pubmed.ncbi.nlm.nih.gov/10727241" } ], "uniprot_canonical_ac": "P49018-1" }, { "start_pos": 60, "end_pos": 60, "sequence_org": "S", "sequence_mut": "C", "comment": "No loss of activity.", "evidence": [ { "database": "UniProtKB", "id": "P49018", "url": "https://www.uniprot.org/uniprotkb/P49018" }, { "database": "PubMed", "id": "10727241", "url": "https://pubmed.ncbi.nlm.nih.gov/10727241" } ], "uniprot_canonical_ac": "P49018-1" }, { "start_pos": 85, "end_pos": 85, "sequence_org": "C", "sequence_mut": "A", "comment": "No loss of activity.", "evidence": [ { "database": "UniProtKB", "id": "P49018", "url": "https://www.uniprot.org/uniprotkb/P49018" }, { "database": "PubMed", "id": "10727241", "url": "https://pubmed.ncbi.nlm.nih.gov/10727241" } ], "uniprot_canonical_ac": "P49018-1" } ], "record_id": "pubmed.10727241", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Gaa1p and gpi8p are components of a glycosylphosphatidylinositol (GPI) transamidase that mediates attachment of GPI to proteins.", "journal": "Molecular biology of the cell", "date": "2000", "authors": "Ohishi K, Inoue N, Maeda Y, Takeda J, Riezman H, Kinoshita T", "reference": { "type": "PubMed", "id": "10793132", "url": "https://pubmed.ncbi.nlm.nih.gov/10793132" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P49018-1", "protein_name": "GPI-anchor transamidase", "gene_name": "GPI8", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q92643-1", "protein_name": "GPI-anchor transamidase", "gene_name": "PIGK", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9WTK3-1", "protein_name": "GPI-anchor transamidase component GPAA1", "gene_name": "Gpaa1", "tax_name": "Mouse" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P49018", "url": "https://www.uniprot.org/uniprotkb/P49018" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "mutagenesis": [ { "start_pos": 157, "end_pos": 157, "sequence_org": "H", "sequence_mut": "A", "comment": "Loss of activity.", "evidence": [ { "database": "UniProtKB", "id": "P49018", "url": "https://www.uniprot.org/uniprotkb/P49018" }, { "database": "PubMed", "id": "10727241", "url": "https://pubmed.ncbi.nlm.nih.gov/10727241" }, { "database": "PubMed", "id": "10793132", "url": "https://pubmed.ncbi.nlm.nih.gov/10793132" } ], "uniprot_canonical_ac": "P49018-1" }, { "start_pos": 199, "end_pos": 199, "sequence_org": "C", "sequence_mut": "A", "comment": "Loss of activity.", "evidence": [ { "database": "UniProtKB", "id": "P49018", "url": "https://www.uniprot.org/uniprotkb/P49018" }, { "database": "PubMed", "id": "10727241", "url": "https://pubmed.ncbi.nlm.nih.gov/10727241" }, { "database": "PubMed", "id": "10793132", "url": "https://pubmed.ncbi.nlm.nih.gov/10793132" } ], "uniprot_canonical_ac": "P49018-1" }, { "start_pos": 164, "end_pos": 164, "sequence_org": "H", "sequence_mut": "A", "comment": "Loss of function in GPI-anchor attachment to protein. Abolishes GPI-anchor transamidase activity.", "evidence": [ { "database": "UniProtKB", "id": "Q92643", "url": "https://www.uniprot.org/uniprotkb/Q92643" }, { "database": "PubMed", "id": "10793132", "url": "https://pubmed.ncbi.nlm.nih.gov/10793132" }, { "database": "PubMed", "id": "35165458", "url": "https://pubmed.ncbi.nlm.nih.gov/35165458" }, { "database": "PubMed", "id": "35551457", "url": "https://pubmed.ncbi.nlm.nih.gov/35551457" }, { "database": "PubMed", "id": "34576938", "url": "https://pubmed.ncbi.nlm.nih.gov/34576938" } ], "uniprot_canonical_ac": "Q92643-1" }, { "start_pos": 206, "end_pos": 206, "sequence_org": "C", "sequence_mut": "A", "comment": "Loss of function in GPI-anchor attachment to protein. Abolishes GPI-anchor transamidase activity.", "evidence": [ { "database": "UniProtKB", "id": "Q92643", "url": "https://www.uniprot.org/uniprotkb/Q92643" }, { "database": "PubMed", "id": "10793132", "url": "https://pubmed.ncbi.nlm.nih.gov/10793132" }, { "database": "PubMed", "id": "35165458", "url": "https://pubmed.ncbi.nlm.nih.gov/35165458" }, { "database": "PubMed", "id": "35551457", "url": "https://pubmed.ncbi.nlm.nih.gov/35551457" } ], "uniprot_canonical_ac": "Q92643-1" }, { "start_pos": 311, "end_pos": 395, "sequence_org": "EITTETIKLQQDSEIMESSYKEDQMDEKLMEPLKYAEQLPVAQIIHQKPKLKDWHPPGGFILGLWALIIMVFFKTYGIKHMKFIF", "sequence_mut": "", "comment": "Loss of activity.", "evidence": [ { "database": "UniProtKB", "id": "Q92643", "url": "https://www.uniprot.org/uniprotkb/Q92643" }, { "database": "PubMed", "id": "10793132", "url": "https://pubmed.ncbi.nlm.nih.gov/10793132" } ], "uniprot_canonical_ac": "Q92643-1" }, { "start_pos": 92, "end_pos": 92, "sequence_org": "C", "sequence_mut": "A", "comment": "Decreased function in GPI-anchor attachment to protein. Decreases GPI-anchor transamidase activity by approximately 40%.", "evidence": [ { "database": "UniProtKB", "id": "Q92643", "url": "https://www.uniprot.org/uniprotkb/Q92643" }, { "database": "PubMed", "id": "10793132", "url": "https://pubmed.ncbi.nlm.nih.gov/10793132" }, { "database": "PubMed", "id": "12582175", "url": "https://pubmed.ncbi.nlm.nih.gov/12582175" }, { "database": "PubMed", "id": "35551457", "url": "https://pubmed.ncbi.nlm.nih.gov/35551457" } ], "uniprot_canonical_ac": "Q92643-1" }, { "start_pos": 92, "end_pos": 92, "sequence_org": "C", "sequence_mut": "S", "comment": "Decreased function in GPI-anchor attachment to protein.", "evidence": [ { "database": "UniProtKB", "id": "Q92643", "url": "https://www.uniprot.org/uniprotkb/Q92643" }, { "database": "PubMed", "id": "10793132", "url": "https://pubmed.ncbi.nlm.nih.gov/10793132" }, { "database": "PubMed", "id": "12582175", "url": "https://pubmed.ncbi.nlm.nih.gov/12582175" }, { "database": "PubMed", "id": "34576938", "url": "https://pubmed.ncbi.nlm.nih.gov/34576938" } ], "uniprot_canonical_ac": "Q92643-1" } ], "record_id": "pubmed.10793132", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The GPI transamidase complex of Saccharomyces cerevisiae contains Gaa1p, Gpi8p, and Gpi16p.", "journal": "Mol. Biol. Cell", "date": "2001", "authors": "Fraering P, Imhof I, Meyer U, Strub J M, van Dorsselaer A, Vionnet C, Conzelmann A", "reference": { "type": "PubMed", "id": "11598210", "url": "https://pubmed.ncbi.nlm.nih.gov/11598210" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P49018-1", "protein_name": "GPI-anchor transamidase", "gene_name": "GPI8", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P38875-1", "protein_name": "GPI transamidase component GPI16", "gene_name": "GPI16", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P39012-1", "protein_name": "GPI transamidase component GAA1", "gene_name": "GAA1", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P49018", "url": "https://www.uniprot.org/uniprotkb/P49018" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "glycosylation": [ { "glytoucan_ac": "", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "icn3d_view": {}, "start_pos": 184, "start_aa": "Asn", "end_pos": 184, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn184", "evidence": [ { "id": "P38875", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P38875#ptm_processing" }, { "id": "11598210", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/11598210" } ], "filter_code": "001000000000000000000.00010000000000.00.01000", "uniprot_canonical_ac": "P38875-1" } ], "record_id": "pubmed.11598210", "abstract": "", "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_sites", "count": 1 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "exact_sites", "count": 1 }, { "field": "exact_n_linked_sites", "count": 1 }, { "field": "fuzzy_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl", "filter_code", "uniprot_canonical_ac" ] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_sites", "count": 1 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "exact_sites", "count": 1 }, { "field": "exact_n_linked_sites", "count": 1 }, { "field": "fuzzy_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl", "filter_code", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Yeast Gpi8p is essential for GPI anchor attachment onto proteins.", "journal": "EMBO J.", "date": "1996", "authors": "Benghezal M, Benachour A, Rusconi S, Aebi M, Conzelmann A", "reference": { "type": "PubMed", "id": "8978684", "url": "https://pubmed.ncbi.nlm.nih.gov/8978684" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P49018-1", "protein_name": "GPI-anchor transamidase", "gene_name": "GPI8", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q92643-1", "protein_name": "GPI-anchor transamidase", "gene_name": "PIGK", "tax_name": "Human" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P49018", "url": "https://www.uniprot.org/uniprotkb/P49018" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.8978684", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Specific induction by glycine of the gene for the P-subunit of glycine decarboxylase from Saccharomyces cerevisiae.", "journal": "Mol. Microbiol.", "date": "1996", "authors": "Sinclair D A, Hong S P, Dawes I W", "reference": { "type": "PubMed", "id": "8830251", "url": "https://pubmed.ncbi.nlm.nih.gov/8830251" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P49095-1", "protein_name": "Glycine dehydrogenase (decarboxylating), mitochondrial", "gene_name": "GCV2", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P49095", "url": "https://www.uniprot.org/uniprotkb/P49095" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.8830251", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Lysine biosynthesis and metabolism in fungi.", "journal": "Natural product reports", "date": "2000-02", "authors": "Zabriskie T M, Jackson M D", "reference": { "type": "PubMed", "id": "10714900", "url": "https://pubmed.ncbi.nlm.nih.gov/10714900" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P49367-1", "protein_name": "Homoaconitase, mitochondrial", "gene_name": "LYS4", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P49367", "url": "https://www.uniprot.org/uniprotkb/P49367" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.10714900", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The fungal alpha-aminoadipate pathway for lysine biosynthesis requires two enzymes of the aconitase family for the isomerization of homocitrate to homoisocitrate.", "journal": "Molecular microbiology", "date": "2012", "authors": "Fazius F, Shelest E, Gebhardt P, Brock M", "reference": { "type": "PubMed", "id": "23106124", "url": "https://pubmed.ncbi.nlm.nih.gov/23106124" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P49367-1", "protein_name": "Homoaconitase, mitochondrial", "gene_name": "LYS4", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P39533-1", "protein_name": "Homocitrate dehydratase, mitochondrial", "gene_name": "ACO2", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P19414-1", "protein_name": "Aconitate hydratase, mitochondrial", "gene_name": "ACO1", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P49367", "url": "https://www.uniprot.org/uniprotkb/P49367" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "mutagenesis": [ { "start_pos": 610, "end_pos": 610, "sequence_org": "K", "sequence_mut": "R", "comment": "Reduces catalytic activity towards homoaconitate by 45% and increases the activity towards aconitate by a factor 116.", "evidence": [ { "database": "UniProtKB", "id": "P39533", "url": "https://www.uniprot.org/uniprotkb/P39533" }, { "database": "PubMed", "id": "23106124", "url": "https://pubmed.ncbi.nlm.nih.gov/23106124" } ], "uniprot_canonical_ac": "P39533-1" }, { "start_pos": 604, "end_pos": 604, "sequence_org": "R", "sequence_mut": "K", "comment": "Strongly diminishes the catalytic activity towards both known substrates, aconitate and homoaconitate.", "evidence": [ { "database": "UniProtKB", "id": "P19414", "url": "https://www.uniprot.org/uniprotkb/P19414" }, { "database": "PubMed", "id": "23106124", "url": "https://pubmed.ncbi.nlm.nih.gov/23106124" } ], "uniprot_canonical_ac": "P19414-1" } ], "record_id": "pubmed.23106124", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Cloning and physical characterization of linked lysine genes (lys4, lys15) of Saccharomyces cerevisiae.", "journal": "Current genetics", "date": "1989-07", "authors": "Wang L, Okamoto S, Bhattacharjee J K", "reference": { "type": "PubMed", "id": "2507177", "url": "https://pubmed.ncbi.nlm.nih.gov/2507177" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P49367-1", "protein_name": "Homoaconitase, mitochondrial", "gene_name": "LYS4", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P49367", "url": "https://www.uniprot.org/uniprotkb/P49367" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.2507177", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Homocitric acid accumulation by a lysine-requiring yeast mutant.", "journal": "The Journal of biological chemistry", "date": "1966-02-10", "authors": "Maragoudakis M E, Strassman M", "reference": { "type": "PubMed", "id": "5908136", "url": "https://pubmed.ncbi.nlm.nih.gov/5908136" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P49367-1", "protein_name": "Homoaconitase, mitochondrial", "gene_name": "LYS4", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P49367", "url": "https://www.uniprot.org/uniprotkb/P49367" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.5908136", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Homoaconitic acid accumulation by a lysine-requiring yeast mutant.", "journal": "Journal of bacteriology", "date": "1967-10", "authors": "Maragoudakis M E", "reference": { "type": "PubMed", "id": "6051343", "url": "https://pubmed.ncbi.nlm.nih.gov/6051343" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P49367-1", "protein_name": "Homoaconitase, mitochondrial", "gene_name": "LYS4", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P49367", "url": "https://www.uniprot.org/uniprotkb/P49367" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.6051343", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "A unique fungal lysine biosynthesis enzyme shares a common ancestor with tricarboxylic acid cycle and leucine biosynthetic enzymes found in diverse organisms.", "journal": "J. Mol. Evol.", "date": "1998", "authors": "Irvin S D, Bhattacharjee J K", "reference": { "type": "PubMed", "id": "9541534", "url": "https://pubmed.ncbi.nlm.nih.gov/9541534" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P49367-1", "protein_name": "Homoaconitase, mitochondrial", "gene_name": "LYS4", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P49367", "url": "https://www.uniprot.org/uniprotkb/P49367" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.9541534", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] } ]