[ { "title": "The NuA4 core complex acetylates nucleosomal histone H4 through a double recognition mechanism.", "journal": "Mol. Cell", "date": "2016", "authors": "Xu Peng, Li Chengmin, Chen Zhihong, Jiang Shuanying, Fan Shilong, Wang Jiawei, Dai Junbiao, Zhu Ping, Chen Zhucheng", "reference": { "type": "PubMed", "id": "27594449", "url": "https://pubmed.ncbi.nlm.nih.gov/27594449" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P47128-1", "protein_name": "Chromatin modification-related protein EAF6", "gene_name": "EAF6", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P47128", "url": "https://www.uniprot.org/uniprotkb/P47128" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.27594449", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Structure of the NuA4 acetyltransferase complex bound to the nucleosome.", "journal": "Nature", "date": "2022", "authors": "Qu Keke, Chen Kangjing, Wang Hao, Li Xueming, Chen Zhucheng", "reference": { "type": "PubMed", "id": "36198799", "url": "https://pubmed.ncbi.nlm.nih.gov/36198799" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P47128-1", "protein_name": "Chromatin modification-related protein EAF6", "gene_name": "EAF6", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P38811-1", "protein_name": "SAGA complex/NuA4 acetyltransferase complex subunit TRA1", "gene_name": "TRA1", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P47128", "url": "https://www.uniprot.org/uniprotkb/P47128" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.36198799", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Role for yeast inhibitor of apoptosis (IAP)-like proteins in cell division.", "journal": "Proc. Natl. Acad. Sci. U.S.A.", "date": "1999", "authors": "Uren A G, Beilharz T, O'Connell M J, Bugg S J, van Driel R, Vaux D L, Lithgow T", "reference": { "type": "PubMed", "id": "10468581", "url": "https://pubmed.ncbi.nlm.nih.gov/10468581" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P47134-1", "protein_name": "Chromosomal passenger complex protein BIR1", "gene_name": "BIR1", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P47134", "url": "https://www.uniprot.org/uniprotkb/P47134" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.10468581", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Participation of Bir1p, a member of the inhibitor of apoptosis family, in yeast chromosome segregation events.", "journal": "Proc. Natl. Acad. Sci. U.S.A.", "date": "1999", "authors": "Yoon H J, Carbon J", "reference": { "type": "PubMed", "id": "10557299", "url": "https://pubmed.ncbi.nlm.nih.gov/10557299" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P47134-1", "protein_name": "Chromosomal passenger complex protein BIR1", "gene_name": "BIR1", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P47134", "url": "https://www.uniprot.org/uniprotkb/P47134" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.10557299", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Cell division regulation by BIR1, a member of the inhibitor of apoptosis family in yeast.", "journal": "J. Biol. Chem.", "date": "2000", "authors": "Li F, Flanary P L, Altieri D C, Dohlman H G", "reference": { "type": "PubMed", "id": "10702224", "url": "https://pubmed.ncbi.nlm.nih.gov/10702224" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P47134-1", "protein_name": "Chromosomal passenger complex protein BIR1", "gene_name": "BIR1", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P47134", "url": "https://www.uniprot.org/uniprotkb/P47134" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.10702224", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Phosphorylation of the chromosomal passenger protein Bir1 is required for localization of Ndc10 to the spindle during anaphase and full spindle elongation.", "journal": "Molecular biology of the cell", "date": "2006-03", "authors": "Widlund Per O, Lyssand John S, Anderson Scott, Niessen Sherry, Yates John R, Davis Trisha N", "reference": { "type": "PubMed", "id": "16381814", "url": "https://pubmed.ncbi.nlm.nih.gov/16381814" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P47134-1", "protein_name": "Chromosomal passenger complex protein BIR1", "gene_name": "BIR1", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P47134", "url": "https://www.uniprot.org/uniprotkb/P47134" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "phosphorylation": [ { "start_pos": 383, "end_pos": 383, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P47134", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P47134" }, { "database": "PubMed", "id": "16381814", "url": "https://pubmed.ncbi.nlm.nih.gov/16381814" }, { "database": "PubMed", "id": "19795423", "url": "https://pubmed.ncbi.nlm.nih.gov/19795423" }, { "database": "PubMed", "id": "19823750", "url": "https://pubmed.ncbi.nlm.nih.gov/19823750" }, { "database": "SGD", "id": "S000003849", "url": "https://www.yeastgenome.org/locus/S000003849" }, { "database": "PubMed", "id": "23749301", "url": "https://pubmed.ncbi.nlm.nih.gov/23749301" }, { "database": "PubMed", "id": "32597660", "url": "https://pubmed.ncbi.nlm.nih.gov/32597660" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" } ], "site_lbl": "Ser383", "uniprot_canonical_ac": "P47134-1" }, { "start_pos": 395, "end_pos": 395, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P47134", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P47134" }, { "database": "PubMed", "id": "16381814", "url": "https://pubmed.ncbi.nlm.nih.gov/16381814" } ], "site_lbl": "Ser395", "uniprot_canonical_ac": "P47134-1" }, { "start_pos": 552, "end_pos": 552, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P47134", "url": "https://www.uniprot.org/uniprotkb/P47134" }, { "database": "PubMed", "id": "18407956", "url": "https://pubmed.ncbi.nlm.nih.gov/18407956" }, { "database": "iPTMnet", "id": "P47134", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P47134" }, { "database": "PubMed", "id": "16381814", "url": "https://pubmed.ncbi.nlm.nih.gov/16381814" }, { "database": "PubMed", "id": "19779198", "url": "https://pubmed.ncbi.nlm.nih.gov/19779198" }, { "database": "SGD", "id": "S000003849", "url": "https://www.yeastgenome.org/locus/S000003849" }, { "database": "PubMed", "id": "33481703", "url": "https://pubmed.ncbi.nlm.nih.gov/33481703" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" } ], "site_lbl": "Ser552", "uniprot_canonical_ac": "P47134-1" }, { "start_pos": 587, "end_pos": 587, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P47134", "url": "https://www.uniprot.org/uniprotkb/P47134" }, { "database": "PubMed", "id": "17287358", "url": "https://pubmed.ncbi.nlm.nih.gov/17287358" }, { "database": "iPTMnet", "id": "P47134", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P47134" }, { "database": "PubMed", "id": "16381814", "url": "https://pubmed.ncbi.nlm.nih.gov/16381814" }, { "database": "PubMed", "id": "18407956", "url": "https://pubmed.ncbi.nlm.nih.gov/18407956" }, { "database": "PubMed", "id": "19779198", "url": "https://pubmed.ncbi.nlm.nih.gov/19779198" }, { "database": "PubMed", "id": "20702584", "url": "https://pubmed.ncbi.nlm.nih.gov/20702584" }, { "database": "PubMed", "id": "21126336", "url": "https://pubmed.ncbi.nlm.nih.gov/21126336" }, { "database": "SGD", "id": "S000003849", "url": "https://www.yeastgenome.org/locus/S000003849" }, { "database": "PubMed", "id": "23749301", "url": "https://pubmed.ncbi.nlm.nih.gov/23749301" }, { "database": "PubMed", "id": "32597660", "url": "https://pubmed.ncbi.nlm.nih.gov/32597660" }, { "database": "PubMed", "id": "33481703", "url": "https://pubmed.ncbi.nlm.nih.gov/33481703" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" } ], "site_lbl": "Ser587", "uniprot_canonical_ac": "P47134-1" }, { "start_pos": 667, "end_pos": 667, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P47134", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P47134" }, { "database": "PubMed", "id": "16381814", "url": "https://pubmed.ncbi.nlm.nih.gov/16381814" } ], "site_lbl": "Ser667", "uniprot_canonical_ac": "P47134-1" }, { "start_pos": 684, "end_pos": 684, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P47134", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P47134" }, { "database": "PubMed", "id": "16381814", "url": "https://pubmed.ncbi.nlm.nih.gov/16381814" } ], "site_lbl": "Thr684", "uniprot_canonical_ac": "P47134-1" }, { "start_pos": 688, "end_pos": 688, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P47134", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P47134" }, { "database": "PubMed", "id": "16381814", "url": "https://pubmed.ncbi.nlm.nih.gov/16381814" } ], "site_lbl": "Ser688", "uniprot_canonical_ac": "P47134-1" }, { "start_pos": 735, "end_pos": 735, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P47134", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P47134" }, { "database": "PubMed", "id": "16381814", "url": "https://pubmed.ncbi.nlm.nih.gov/16381814" }, { "database": "SGD", "id": "S000003849", "url": "https://www.yeastgenome.org/locus/S000003849" }, { "database": "PubMed", "id": "23749301", "url": "https://pubmed.ncbi.nlm.nih.gov/23749301" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" } ], "site_lbl": "Thr735", "uniprot_canonical_ac": "P47134-1" }, { "start_pos": 747, "end_pos": 747, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P47134", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P47134" }, { "database": "PubMed", "id": "16381814", "url": "https://pubmed.ncbi.nlm.nih.gov/16381814" }, { "database": "SGD", "id": "S000003849", "url": "https://www.yeastgenome.org/locus/S000003849" }, { "database": "PubMed", "id": "23749301", "url": "https://pubmed.ncbi.nlm.nih.gov/23749301" }, { "database": "PubMed", "id": "33481703", "url": "https://pubmed.ncbi.nlm.nih.gov/33481703" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" } ], "site_lbl": "Thr747", "uniprot_canonical_ac": "P47134-1" } ], "record_id": "pubmed.16381814", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 9 }, { "field": "total_sites", "count": 9 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "A proteome-wide analysis of kinase-substrate network in the DNA damage response.", "journal": "The Journal of biological chemistry", "date": "2010-04-23", "authors": "Chen Sheng-hong, Albuquerque Claudio P, Liang Jason, Suhandynata Raymond T, Zhou Huilin", "reference": { "type": "PubMed", "id": "20190278", "url": "https://pubmed.ncbi.nlm.nih.gov/20190278" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P47134-1", "protein_name": "Chromosomal passenger complex protein BIR1", "gene_name": "BIR1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P52910-1", "protein_name": "Acetyl-coenzyme A synthetase 2", "gene_name": "ACS2", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P53115-1", "protein_name": "Chromatin-remodeling ATPase INO80", "gene_name": "INO80", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P53165-1", "protein_name": "SAGA complex subunit SGF73", "gene_name": "SGF73", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P53303-1", "protein_name": "Zinc finger chaperone ZPR1", "gene_name": "ZPR1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q05027-1", "protein_name": "SAGA complex/transcription factor TFIID complex subunit TAF9", "gene_name": "TAF9", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q06680-1", "protein_name": "Condensin complex subunit 3", "gene_name": "YCG1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q12248-1", "protein_name": "DASH complex subunit DAD1", "gene_name": "DAD1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P31380-1", "protein_name": "Chromatin remodeling protein FUN30", "gene_name": "FUN30", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P32499-1", "protein_name": "Nucleoporin NUP2", "gene_name": "NUP2", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P32783-1", "protein_name": "mRNA cap guanine-N(7) methyltransferase", "gene_name": "ABD1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P33322-1", "protein_name": "H/ACA ribonucleoprotein complex subunit CBF5", "gene_name": "CBF5", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P35177-1", "protein_name": "SAGA complex subunit SPT7", "gene_name": "SPT7", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P35817-1", "protein_name": "Bromodomain-containing factor 1", "gene_name": "BDF1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P38111-1", "protein_name": "Serine/threonine-protein kinase MEC1", "gene_name": "MEC1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P38193-1", "protein_name": "Serine/threonine-protein phosphatase 4 regulatory subunit 2", "gene_name": "PSY4", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P39705-1", "protein_name": "Nucleoporin NUP60", "gene_name": "NUP60", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P40010-1", "protein_name": "Nuclear GTP-binding protein NUG1", "gene_name": "NUG1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P40352-1", "protein_name": "DNA repair and recombination protein RAD26", "gene_name": "RAD26", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P40693-1", "protein_name": "Ribosome biogenesis protein RLP7", "gene_name": "RLP7", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P46676-1", "protein_name": "Suppressor of mar1-1 protein", "gene_name": "SUM1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P43579-1", "protein_name": "Ino eighty subunit 1", "gene_name": "IES1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P53920-1", "protein_name": "Pro-apoptotic serine protease NMA111", "gene_name": "NMA111", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P69850-1", "protein_name": "DASH complex subunit DAD3", "gene_name": "DAD3", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q02206-1", "protein_name": "Chromatin structure-remodeling complex subunit RSC4", "gene_name": "RSC4", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q04779-1", "protein_name": "Transcriptional regulatory protein RCO1", "gene_name": "RCO1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q06224-1", "protein_name": "Endoribonuclease YSH1", "gene_name": "YSH1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q06488-1", "protein_name": "Chromatin structure-remodeling complex subunit RSC2", "gene_name": "RSC2", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q08773-1", "protein_name": "ISWI chromatin-remodeling complex ATPase ISW2", "gene_name": "ISW2", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q08887-1", "protein_name": "Nuclear division defective protein 1", "gene_name": "NDD1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q12406-1", "protein_name": "Actin-related protein 7", "gene_name": "ARP7", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P35719-1", "protein_name": "Uncharacterized protein MRP8", "gene_name": "MRP8", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P38167-1", "protein_name": "Protein ECM21", "gene_name": "ECM21", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P38439-1", "protein_name": "RNA polymerase-associated protein LEO1", "gene_name": "LEO1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P38781-1", "protein_name": "Chromatin structure-remodeling complex protein RSC30", "gene_name": "RSC30", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P38850-1", "protein_name": "Regulator of Ty1 transposition protein 107", "gene_name": "RTT107", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P39956-1", "protein_name": "DNA damage-responsive transcriptional repressor RPH1", "gene_name": "RPH1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P40340-1", "protein_name": "ATPase histone chaperone YTA7", "gene_name": "YTA7", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P40477-1", "protein_name": "Nucleoporin NUP159", "gene_name": "NUP159", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P40541-1", "protein_name": "Cohesin subunit SCC3", "gene_name": "IRR1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q01448-1", "protein_name": "Histone promoter control protein 2", "gene_name": "HPC2", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q02455-1", "protein_name": "Protein MLP1", "gene_name": "MLP1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q03761-1", "protein_name": "SAGA complex/transcription factor TFIID complex subunit TAF12", "gene_name": "TAF12", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q05471-1", "protein_name": "Chromatin remodeling protein SWR1", "gene_name": "SWR1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q12072-1", "protein_name": "ISWI one complex protein 2", "gene_name": "IOC2", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q12158-1", "protein_name": "Sister chromatid cohesion protein 1", "gene_name": "MCD1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P38772-1", "protein_name": "Box C/D snoRNA protein 1", "gene_name": "BCD1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P40467-1", "protein_name": "Activator of stress genes 1", "gene_name": "ASG1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P46151-1", "protein_name": "Methylenetetrahydrofolate reductase 1", "gene_name": "MET12", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P53312-1", "protein_name": "Succinate--CoA ligase [ADP-forming] subunit beta, mitochondrial", "gene_name": "LSC2", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P54838-1", "protein_name": "Dihydroxyacetone kinase 1", "gene_name": "DAK1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q03661-1", "protein_name": "Silent chromatin protein ESC1", "gene_name": "ESC1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q04383-1", "protein_name": "Protein PLM2", "gene_name": "PLM2", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q08561-1", "protein_name": "Ino eighty subunit 4", "gene_name": "IES4", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q12455-1", "protein_name": "Spermine synthase SPE4", "gene_name": "SPE4", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P13382-1", "protein_name": "DNA polymerase alpha catalytic subunit A", "gene_name": "POL1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P14737-1", "protein_name": "DNA repair protein RAD9", "gene_name": "RAD9", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P15992-1", "protein_name": "Heat shock protein 26", "gene_name": "HSP26", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P16861-1", "protein_name": "ATP-dependent 6-phosphofructokinase subunit alpha", "gene_name": "PFK1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P17106-1", "protein_name": "Centromere-binding protein 1", "gene_name": "CBF1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P17442-1", "protein_name": "Phosphate system positive regulatory protein PHO81", "gene_name": "PHO81", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P17629-1", "protein_name": "THO complex subunit HPR1", "gene_name": "HPR1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P20676-1", "protein_name": "Nucleoporin NUP1", "gene_name": "NUP1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P21672-1", "protein_name": "Ribonucleoside-diphosphate reductase large chain 2", "gene_name": "RNR3", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P22216-1", "protein_name": "Serine/threonine-protein kinase RAD53", "gene_name": "RAD53", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P22336-1", "protein_name": "Replication factor A protein 1", "gene_name": "RFA1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P22579-1", "protein_name": "Transcriptional regulatory protein SIN3", "gene_name": "SIN3", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P22943-1", "protein_name": "12 kDa heat shock protein", "gene_name": "HSP12", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P25588-1", "protein_name": "Mediator of replication checkpoint protein 1", "gene_name": "MRC1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P25635-1", "protein_name": "Periodic tryptophan protein 2", "gene_name": "PWP2", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P26754-1", "protein_name": "Replication factor A protein 2", "gene_name": "RFA2", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P26755-1", "protein_name": "Replication factor A protein 3", "gene_name": "RFA3", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P26793-1", "protein_name": "Flap endonuclease 1", "gene_name": "RAD27", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P32523-1", "protein_name": "Pre-mRNA-processing factor 19", "gene_name": "PRP19", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P32591-1", "protein_name": "SWI/SNF complex subunit SWI3", "gene_name": "SWI3", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P32598-1", "protein_name": "Serine/threonine-protein phosphatase PP1-2", "gene_name": "GLC7", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P32774-1", "protein_name": "Transcription initiation factor IIA subunit 2", "gene_name": "TOA2", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P38333-1", "protein_name": "Essential nuclear protein 1", "gene_name": "ENP1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P38859-1", "protein_name": "DNA replication ATP-dependent helicase/nuclease DNA2", "gene_name": "DNA2", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P40856-1", "protein_name": "SIT4-associating protein SAP185", "gene_name": "SAP185", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P40969-1", "protein_name": "Centromere DNA-binding protein complex CBF3 subunit B", "gene_name": "CEP3", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P46957-1", "protein_name": "DNA polymerase delta small subunit", "gene_name": "POL31", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P48743-1", "protein_name": "RFX-like DNA-binding protein RFX1", "gene_name": "RFX1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q03834-1", "protein_name": "DNA mismatch repair protein MSH6", "gene_name": "MSH6", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q06505-1", "protein_name": "Transcription factor SPN1", "gene_name": "SPN1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q12432-1", "protein_name": "Chromatin modification-related protein EAF3", "gene_name": "EAF3", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P02294-1", "protein_name": "Histone H2B.2", "gene_name": "HTB2", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P02309-1", "protein_name": "Histone H4", "gene_name": "HHF1; HHF2", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P04911-1", "protein_name": "Histone H2A.1", "gene_name": "HTA1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P07273-1", "protein_name": "Transcription elongation factor S-II", "gene_name": "DST1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P11978-1", "protein_name": "Regulatory protein SIR4", "gene_name": "SIR4", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P32325-1", "protein_name": "DDK kinase regulatory subunit DBF4", "gene_name": "DBF4", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P32597-1", "protein_name": "Nuclear protein STH1/NPS1", "gene_name": "STH1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P32628-1", "protein_name": "UV excision repair protein RAD23", "gene_name": "RAD23", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P39009-1", "protein_name": "DNA damage response protein kinase DUN1", "gene_name": "DUN1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q01560-1", "protein_name": "Serine/arginine (SR)-type shuttling mRNA binding protein NPL3", "gene_name": "NPL3", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q06697-1", "protein_name": "Cell division control protein 73", "gene_name": "CDC73", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q12030-1", "protein_name": "SAGA complex/transcription factor TFIID complex subunit TAF10", "gene_name": "TAF10", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q12098-1", "protein_name": "Structure-specific endonuclease subunit SLX4", "gene_name": "SLX4", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q12315-1", "protein_name": "mRNA export factor GLE1", "gene_name": "GLE1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q04603-1", "protein_name": "DNA polymerase epsilon subunit D", "gene_name": "DPB4", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P32863-1", "protein_name": "DNA repair and recombination protein RAD54", "gene_name": "RAD54", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P47134", "url": "https://www.uniprot.org/uniprotkb/P47134" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "phosphorylation": [ { "start_pos": 751, "end_pos": 751, "kinase_uniprot_canonical_ac": "P38110-1", "kinase_gene_name": "TEL1", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P47134", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P47134" }, { "database": "PubMed", "id": "18407956", "url": "https://pubmed.ncbi.nlm.nih.gov/18407956" }, { "database": "PubMed", "id": "20190278", "url": "https://pubmed.ncbi.nlm.nih.gov/20190278" } ], "site_lbl": "Ser751", "uniprot_canonical_ac": "P47134-1" }, { "start_pos": 751, "end_pos": 751, "kinase_uniprot_canonical_ac": "P38111-1", "kinase_gene_name": "MEC1", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P47134", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P47134" }, { "database": "PubMed", "id": "18407956", "url": "https://pubmed.ncbi.nlm.nih.gov/18407956" }, { "database": "PubMed", "id": "20190278", "url": "https://pubmed.ncbi.nlm.nih.gov/20190278" } ], "site_lbl": "Ser751", "uniprot_canonical_ac": "P47134-1" }, { "start_pos": 751, "end_pos": 751, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P47134", "url": "https://www.uniprot.org/uniprotkb/P47134" }, { "database": "PubMed", "id": "18407956", "url": "https://pubmed.ncbi.nlm.nih.gov/18407956" }, { "database": "SGD", "id": "S000003849", "url": "https://www.yeastgenome.org/locus/S000003849" }, { "database": "iPTMnet", "id": "P47134", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P47134" }, { "database": "PubMed", "id": "20190278", "url": "https://pubmed.ncbi.nlm.nih.gov/20190278" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" } ], "site_lbl": "Ser751", "uniprot_canonical_ac": "P47134-1" }, { "start_pos": 679, "end_pos": 679, "kinase_uniprot_canonical_ac": "P38110-1", "kinase_gene_name": "TEL1", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P52910", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P52910" }, { "database": "PubMed", "id": "18407956", "url": "https://pubmed.ncbi.nlm.nih.gov/18407956" }, { "database": "PubMed", "id": "20190278", "url": "https://pubmed.ncbi.nlm.nih.gov/20190278" } ], "site_lbl": "Ser679", "uniprot_canonical_ac": "P52910-1" }, { "start_pos": 679, "end_pos": 679, "kinase_uniprot_canonical_ac": "P38111-1", "kinase_gene_name": "MEC1", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P52910", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P52910" }, { "database": "PubMed", "id": "18407956", "url": "https://pubmed.ncbi.nlm.nih.gov/18407956" }, { "database": "PubMed", "id": "20190278", "url": "https://pubmed.ncbi.nlm.nih.gov/20190278" } ], "site_lbl": "Ser679", "uniprot_canonical_ac": "P52910-1" }, { "start_pos": 679, "end_pos": 679, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P52910", "url": "https://www.uniprot.org/uniprotkb/P52910" }, { "database": "PubMed", "id": "18407956", "url": "https://pubmed.ncbi.nlm.nih.gov/18407956" }, { "database": "SGD", "id": "S000004143", "url": "https://www.yeastgenome.org/locus/S000004143" }, { "database": "iPTMnet", "id": "P52910", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P52910" }, { "database": "PubMed", "id": "20190278", "url": "https://pubmed.ncbi.nlm.nih.gov/20190278" } ], "site_lbl": "Ser679", "uniprot_canonical_ac": "P52910-1" }, { "start_pos": 102, "end_pos": 102, "kinase_uniprot_canonical_ac": "P38110-1", "kinase_gene_name": "TEL1", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P53115", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P53115" }, { "database": "PubMed", "id": "20190278", "url": "https://pubmed.ncbi.nlm.nih.gov/20190278" } ], "site_lbl": "Ser102", "uniprot_canonical_ac": "P53115-1" }, { "start_pos": 102, "end_pos": 102, "kinase_uniprot_canonical_ac": "P38111-1", "kinase_gene_name": "MEC1", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P53115", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P53115" }, { "database": "PubMed", "id": "20190278", "url": "https://pubmed.ncbi.nlm.nih.gov/20190278" } ], "site_lbl": "Ser102", "uniprot_canonical_ac": "P53115-1" }, { "start_pos": 102, "end_pos": 102, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "SGD", "id": "S000003118", "url": "https://www.yeastgenome.org/locus/S000003118" }, { "database": "iPTMnet", "id": "P53115", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P53115" }, { "database": "PubMed", "id": "20190278", "url": "https://pubmed.ncbi.nlm.nih.gov/20190278" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" } ], "site_lbl": "Ser102", "uniprot_canonical_ac": "P53115-1" }, { "start_pos": 22, "end_pos": 22, "kinase_uniprot_canonical_ac": "P38110-1", "kinase_gene_name": "TEL1", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P53165", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P53165" }, { "database": "PubMed", "id": "18407956", "url": "https://pubmed.ncbi.nlm.nih.gov/18407956" }, { "database": "PubMed", "id": "20190278", "url": "https://pubmed.ncbi.nlm.nih.gov/20190278" } ], "site_lbl": "Ser22", "uniprot_canonical_ac": "P53165-1" }, { "start_pos": 22, "end_pos": 22, "kinase_uniprot_canonical_ac": "P38111-1", "kinase_gene_name": "MEC1", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P53165", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P53165" }, { "database": "PubMed", "id": "18407956", "url": "https://pubmed.ncbi.nlm.nih.gov/18407956" }, { "database": "PubMed", "id": "20190278", "url": "https://pubmed.ncbi.nlm.nih.gov/20190278" } ], "site_lbl": "Ser22", "uniprot_canonical_ac": "P53165-1" }, { "start_pos": 22, "end_pos": 22, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "SGD", "id": "S000003034", "url": "https://www.yeastgenome.org/locus/S000003034" }, { "database": "iPTMnet", "id": "P53165", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P53165" }, { "database": "PubMed", "id": "18407956", "url": "https://pubmed.ncbi.nlm.nih.gov/18407956" }, { "database": "PubMed", "id": "20190278", "url": "https://pubmed.ncbi.nlm.nih.gov/20190278" }, { "database": "PubMed", "id": "23749301", "url": "https://pubmed.ncbi.nlm.nih.gov/23749301" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" } ], "site_lbl": "Ser22", "uniprot_canonical_ac": "P53165-1" }, { "start_pos": 407, "end_pos": 407, "kinase_uniprot_canonical_ac": "P38110-1", "kinase_gene_name": "TEL1", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P53303", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P53303" }, { "database": "PubMed", "id": "18407956", "url": "https://pubmed.ncbi.nlm.nih.gov/18407956" }, { "database": "PubMed", "id": "20190278", "url": "https://pubmed.ncbi.nlm.nih.gov/20190278" } ], "site_lbl": "Thr407", "uniprot_canonical_ac": "P53303-1" }, { "start_pos": 407, "end_pos": 407, "kinase_uniprot_canonical_ac": "P38111-1", "kinase_gene_name": "MEC1", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P53303", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P53303" }, { "database": "PubMed", "id": "18407956", "url": "https://pubmed.ncbi.nlm.nih.gov/18407956" }, { "database": "PubMed", "id": "20190278", "url": "https://pubmed.ncbi.nlm.nih.gov/20190278" } ], "site_lbl": "Thr407", "uniprot_canonical_ac": "P53303-1" }, { "start_pos": 407, "end_pos": 407, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine", "evidence": [ { "database": "UniProtKB", "id": "P53303", "url": "https://www.uniprot.org/uniprotkb/P53303" }, { "database": "PubMed", "id": "18407956", "url": "https://pubmed.ncbi.nlm.nih.gov/18407956" }, { "database": "SGD", "id": "S000003443", "url": "https://www.yeastgenome.org/locus/S000003443" }, { "database": "iPTMnet", "id": "P53303", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P53303" }, { "database": "PubMed", "id": "20190278", "url": "https://pubmed.ncbi.nlm.nih.gov/20190278" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" } ], "site_lbl": "Thr407", "uniprot_canonical_ac": "P53303-1" }, { "start_pos": 25, "end_pos": 25, "kinase_uniprot_canonical_ac": "P38110-1", "kinase_gene_name": "TEL1", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q05027", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q05027" }, { "database": "PubMed", "id": "20190278", "url": "https://pubmed.ncbi.nlm.nih.gov/20190278" } ], "site_lbl": "Thr25", "uniprot_canonical_ac": "Q05027-1" }, { "start_pos": 25, "end_pos": 25, "kinase_uniprot_canonical_ac": "P38111-1", "kinase_gene_name": "MEC1", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q05027", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q05027" }, { "database": "PubMed", "id": "20190278", "url": "https://pubmed.ncbi.nlm.nih.gov/20190278" } ], "site_lbl": "Thr25", "uniprot_canonical_ac": "Q05027-1" }, { "start_pos": 25, "end_pos": 25, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "SGD", "id": "S000004849", "url": "https://www.yeastgenome.org/locus/S000004849" }, { "database": "iPTMnet", "id": "Q05027", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q05027" }, { "database": "PubMed", "id": "18407956", "url": "https://pubmed.ncbi.nlm.nih.gov/18407956" }, { "database": "PubMed", "id": "20190278", "url": "https://pubmed.ncbi.nlm.nih.gov/20190278" }, { "database": "PubMed", "id": "33481703", "url": "https://pubmed.ncbi.nlm.nih.gov/33481703" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" } ], "site_lbl": "Thr25", "uniprot_canonical_ac": "Q05027-1" }, { "start_pos": 933, "end_pos": 933, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "Q06680", "url": "https://www.uniprot.org/uniprotkb/Q06680" }, { "database": "PubMed", "id": "18407956", "url": "https://pubmed.ncbi.nlm.nih.gov/18407956" }, { "database": "iPTMnet", "id": "Q06680", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q06680" }, { "database": "PubMed", "id": "17563356", "url": "https://pubmed.ncbi.nlm.nih.gov/17563356" }, { "database": "PubMed", "id": "19481522", "url": "https://pubmed.ncbi.nlm.nih.gov/19481522" }, { "database": "PubMed", "id": "20190278", "url": "https://pubmed.ncbi.nlm.nih.gov/20190278" }, { "database": "SGD", "id": "S000002733", "url": "https://www.yeastgenome.org/locus/S000002733" }, { "database": "PubMed", "id": "23749301", "url": "https://pubmed.ncbi.nlm.nih.gov/23749301" }, { "database": "PubMed", "id": "33481703", "url": "https://pubmed.ncbi.nlm.nih.gov/33481703" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" } ], "site_lbl": "Ser933", "uniprot_canonical_ac": "Q06680-1" }, { "start_pos": 89, "end_pos": 89, "kinase_uniprot_canonical_ac": "P38110-1", "kinase_gene_name": "TEL1", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q12248", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q12248" }, { "database": "PubMed", "id": "20190278", "url": "https://pubmed.ncbi.nlm.nih.gov/20190278" } ], "site_lbl": "Ser89", "uniprot_canonical_ac": "Q12248-1" }, { "start_pos": 89, "end_pos": 89, "kinase_uniprot_canonical_ac": "P38111-1", "kinase_gene_name": "MEC1", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q12248", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q12248" }, { "database": "PubMed", "id": "20190278", "url": "https://pubmed.ncbi.nlm.nih.gov/20190278" } ], "site_lbl": "Ser89", "uniprot_canonical_ac": "Q12248-1" }, { "start_pos": 89, "end_pos": 89, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "SGD", "id": "S000002423", "url": "https://www.yeastgenome.org/locus/S000002423" }, { "database": "iPTMnet", "id": "Q12248", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q12248" }, { "database": "PubMed", "id": "18407956", "url": "https://pubmed.ncbi.nlm.nih.gov/18407956" }, { "database": "PubMed", "id": "20190278", "url": "https://pubmed.ncbi.nlm.nih.gov/20190278" }, { "database": "PubMed", "id": "33481703", "url": "https://pubmed.ncbi.nlm.nih.gov/33481703" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" } ], "site_lbl": "Ser89", "uniprot_canonical_ac": "Q12248-1" }, { "start_pos": 98, "end_pos": 98, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P31380", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P31380" }, { "database": "PubMed", "id": "18407956", "url": "https://pubmed.ncbi.nlm.nih.gov/18407956" }, { "database": "PubMed", "id": "20190278", "url": "https://pubmed.ncbi.nlm.nih.gov/20190278" }, { "database": "SGD", "id": "S000000017", "url": "https://www.yeastgenome.org/locus/S000000017" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" } ], "site_lbl": "Ser98", "uniprot_canonical_ac": "P31380-1" }, { "start_pos": 351, "end_pos": 351, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P32499", "url": "https://www.uniprot.org/uniprotkb/P32499" }, { "database": "PubMed", "id": "18407956", "url": "https://pubmed.ncbi.nlm.nih.gov/18407956" }, { "database": "iPTMnet", "id": "P32499", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P32499" }, { "database": "PubMed", "id": "17563356", "url": "https://pubmed.ncbi.nlm.nih.gov/17563356" }, { "database": "PubMed", "id": "20190278", "url": "https://pubmed.ncbi.nlm.nih.gov/20190278" }, { "database": "SGD", "id": "S000004327", "url": "https://www.yeastgenome.org/locus/S000004327" }, { "database": "PubMed", "id": "33481703", "url": "https://pubmed.ncbi.nlm.nih.gov/33481703" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" } ], "site_lbl": "Ser351", "uniprot_canonical_ac": "P32499-1" }, { "start_pos": 12, "end_pos": 12, "kinase_uniprot_canonical_ac": "P38110-1", "kinase_gene_name": "TEL1", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P32783", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P32783" }, { "database": "PubMed", "id": "20190278", "url": "https://pubmed.ncbi.nlm.nih.gov/20190278" } ], "site_lbl": "Ser12", "uniprot_canonical_ac": "P32783-1" }, { "start_pos": 12, "end_pos": 12, "kinase_uniprot_canonical_ac": "P38111-1", "kinase_gene_name": "MEC1", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P32783", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P32783" }, { "database": "PubMed", "id": "20190278", "url": "https://pubmed.ncbi.nlm.nih.gov/20190278" } ], "site_lbl": "Ser12", "uniprot_canonical_ac": "P32783-1" }, { "start_pos": 12, "end_pos": 12, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "SGD", "id": "S000000440", "url": "https://www.yeastgenome.org/locus/S000000440" }, { "database": "iPTMnet", "id": "P32783", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P32783" }, { "database": "PubMed", "id": "20190278", "url": "https://pubmed.ncbi.nlm.nih.gov/20190278" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" } ], "site_lbl": "Ser12", "uniprot_canonical_ac": "P32783-1" }, { "start_pos": 395, "end_pos": 395, "kinase_uniprot_canonical_ac": "P38110-1", "kinase_gene_name": "TEL1", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P33322", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P33322" }, { "database": "PubMed", "id": "19779198", "url": "https://pubmed.ncbi.nlm.nih.gov/19779198" }, { "database": "PubMed", "id": "19795423", "url": "https://pubmed.ncbi.nlm.nih.gov/19795423" }, { "database": "PubMed", "id": "19823750", "url": "https://pubmed.ncbi.nlm.nih.gov/19823750" }, { "database": "PubMed", "id": "20190278", "url": "https://pubmed.ncbi.nlm.nih.gov/20190278" }, { "database": "PubMed", "id": "20702584", "url": "https://pubmed.ncbi.nlm.nih.gov/20702584" }, { "database": "PubMed", "id": "21126336", "url": "https://pubmed.ncbi.nlm.nih.gov/21126336" }, { "database": "PubMed", "id": "21177495", "url": "https://pubmed.ncbi.nlm.nih.gov/21177495" } ], "site_lbl": "Ser395", "uniprot_canonical_ac": "P33322-1" }, { "start_pos": 395, "end_pos": 395, "kinase_uniprot_canonical_ac": "P38111-1", "kinase_gene_name": "MEC1", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P33322", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P33322" }, { "database": "PubMed", "id": "19779198", "url": "https://pubmed.ncbi.nlm.nih.gov/19779198" }, { "database": "PubMed", "id": "19795423", "url": "https://pubmed.ncbi.nlm.nih.gov/19795423" }, { "database": "PubMed", "id": "19823750", "url": "https://pubmed.ncbi.nlm.nih.gov/19823750" }, { "database": "PubMed", "id": "20190278", "url": "https://pubmed.ncbi.nlm.nih.gov/20190278" }, { "database": "PubMed", "id": "20702584", "url": "https://pubmed.ncbi.nlm.nih.gov/20702584" }, { "database": "PubMed", "id": "21126336", "url": "https://pubmed.ncbi.nlm.nih.gov/21126336" }, { "database": "PubMed", "id": "21177495", "url": "https://pubmed.ncbi.nlm.nih.gov/21177495" } ], "site_lbl": "Ser395", "uniprot_canonical_ac": "P33322-1" }, { "start_pos": 395, "end_pos": 395, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "SGD", "id": "S000004165", "url": "https://www.yeastgenome.org/locus/S000004165" }, { "database": "iPTMnet", "id": "P33322", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P33322" }, { "database": "PubMed", "id": "19779198", "url": "https://pubmed.ncbi.nlm.nih.gov/19779198" }, { "database": "PubMed", "id": "20190278", "url": "https://pubmed.ncbi.nlm.nih.gov/20190278" }, { "database": "PubMed", "id": "20702584", "url": "https://pubmed.ncbi.nlm.nih.gov/20702584" }, { "database": "PubMed", "id": "23749301", "url": "https://pubmed.ncbi.nlm.nih.gov/23749301" }, { "database": "PubMed", "id": "33481703", "url": "https://pubmed.ncbi.nlm.nih.gov/33481703" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" } ], "site_lbl": "Ser395", "uniprot_canonical_ac": "P33322-1" }, { "start_pos": 399, "end_pos": 399, "kinase_uniprot_canonical_ac": "P38110-1", "kinase_gene_name": "TEL1", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P33322", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P33322" }, { "database": "PubMed", "id": "17563356", "url": "https://pubmed.ncbi.nlm.nih.gov/17563356" }, { "database": "PubMed", "id": "18407956", "url": "https://pubmed.ncbi.nlm.nih.gov/18407956" }, { "database": "PubMed", "id": "19779198", "url": "https://pubmed.ncbi.nlm.nih.gov/19779198" }, { "database": "PubMed", "id": "19795423", "url": "https://pubmed.ncbi.nlm.nih.gov/19795423" }, { "database": "PubMed", "id": "19823750", "url": "https://pubmed.ncbi.nlm.nih.gov/19823750" }, { "database": "PubMed", "id": "20190278", "url": "https://pubmed.ncbi.nlm.nih.gov/20190278" }, { "database": "PubMed", "id": "20702584", "url": "https://pubmed.ncbi.nlm.nih.gov/20702584" }, { "database": "PubMed", "id": "21177495", "url": "https://pubmed.ncbi.nlm.nih.gov/21177495" } ], "site_lbl": "Ser399", "uniprot_canonical_ac": "P33322-1" }, { "start_pos": 399, "end_pos": 399, "kinase_uniprot_canonical_ac": "P38111-1", "kinase_gene_name": "MEC1", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P33322", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P33322" }, { "database": "PubMed", "id": "17563356", "url": "https://pubmed.ncbi.nlm.nih.gov/17563356" }, { "database": "PubMed", "id": "18407956", "url": "https://pubmed.ncbi.nlm.nih.gov/18407956" }, { "database": "PubMed", "id": "19779198", "url": "https://pubmed.ncbi.nlm.nih.gov/19779198" }, { "database": "PubMed", "id": "19795423", "url": "https://pubmed.ncbi.nlm.nih.gov/19795423" }, { "database": "PubMed", "id": "19823750", "url": "https://pubmed.ncbi.nlm.nih.gov/19823750" }, { "database": "PubMed", "id": "20190278", "url": "https://pubmed.ncbi.nlm.nih.gov/20190278" }, { "database": "PubMed", "id": "20702584", "url": "https://pubmed.ncbi.nlm.nih.gov/20702584" }, { "database": "PubMed", "id": "21177495", "url": "https://pubmed.ncbi.nlm.nih.gov/21177495" } ], "site_lbl": "Ser399", "uniprot_canonical_ac": "P33322-1" }, { "start_pos": 399, "end_pos": 399, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "SGD", "id": "S000004165", "url": "https://www.yeastgenome.org/locus/S000004165" }, { "database": "iPTMnet", "id": "P33322", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P33322" }, { "database": "PubMed", "id": "18407956", "url": "https://pubmed.ncbi.nlm.nih.gov/18407956" }, { "database": "PubMed", "id": "19779198", "url": "https://pubmed.ncbi.nlm.nih.gov/19779198" }, { "database": "PubMed", "id": "20190278", "url": "https://pubmed.ncbi.nlm.nih.gov/20190278" }, { "database": "PubMed", "id": "20702584", "url": "https://pubmed.ncbi.nlm.nih.gov/20702584" }, { "database": "PubMed", "id": "23749301", "url": "https://pubmed.ncbi.nlm.nih.gov/23749301" }, { "database": "PubMed", "id": "24909858", "url": "https://pubmed.ncbi.nlm.nih.gov/24909858" }, { "database": "PubMed", "id": "32597660", "url": "https://pubmed.ncbi.nlm.nih.gov/32597660" }, { "database": "PubMed", "id": "33481703", "url": "https://pubmed.ncbi.nlm.nih.gov/33481703" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" } ], "site_lbl": "Ser399", "uniprot_canonical_ac": "P33322-1" }, { "start_pos": 78, "end_pos": 78, "kinase_uniprot_canonical_ac": "P38110-1", "kinase_gene_name": "TEL1", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P35177", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P35177" }, { "database": "PubMed", "id": "17563356", "url": "https://pubmed.ncbi.nlm.nih.gov/17563356" }, { "database": "PubMed", "id": "18407956", "url": "https://pubmed.ncbi.nlm.nih.gov/18407956" }, { "database": "PubMed", "id": "19779198", "url": "https://pubmed.ncbi.nlm.nih.gov/19779198" }, { "database": "PubMed", "id": "20190278", "url": "https://pubmed.ncbi.nlm.nih.gov/20190278" } ], "site_lbl": "Thr78", "uniprot_canonical_ac": "P35177-1" }, { "start_pos": 78, "end_pos": 78, "kinase_uniprot_canonical_ac": "P38111-1", "kinase_gene_name": "MEC1", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P35177", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P35177" }, { "database": "PubMed", "id": "17563356", "url": "https://pubmed.ncbi.nlm.nih.gov/17563356" }, { "database": "PubMed", "id": "18407956", "url": "https://pubmed.ncbi.nlm.nih.gov/18407956" }, { "database": "PubMed", "id": "19779198", "url": "https://pubmed.ncbi.nlm.nih.gov/19779198" }, { "database": "PubMed", "id": "20190278", "url": "https://pubmed.ncbi.nlm.nih.gov/20190278" } ], "site_lbl": "Thr78", "uniprot_canonical_ac": "P35177-1" }, { "start_pos": 78, "end_pos": 78, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine; by ATM or ATR", "evidence": [ { "database": "UniProtKB", "id": "P35177", "url": "https://www.uniprot.org/uniprotkb/P35177" }, { "database": "SGD", "id": "S000000285", "url": "https://www.yeastgenome.org/locus/S000000285" }, { "database": "iPTMnet", "id": "P35177", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P35177" }, { "database": "PubMed", "id": "17563356", "url": "https://pubmed.ncbi.nlm.nih.gov/17563356" }, { "database": "PubMed", "id": "18407956", "url": "https://pubmed.ncbi.nlm.nih.gov/18407956" }, { "database": "PubMed", "id": "19779198", "url": "https://pubmed.ncbi.nlm.nih.gov/19779198" }, { "database": "PubMed", "id": "20190278", "url": "https://pubmed.ncbi.nlm.nih.gov/20190278" }, { "database": "PubMed", "id": "23749301", "url": "https://pubmed.ncbi.nlm.nih.gov/23749301" }, { "database": "PubMed", "id": "32597660", "url": "https://pubmed.ncbi.nlm.nih.gov/32597660" }, { "database": "PubMed", "id": "33481703", "url": "https://pubmed.ncbi.nlm.nih.gov/33481703" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" } ], "site_lbl": "Thr78", "uniprot_canonical_ac": "P35177-1" }, { "start_pos": 630, "end_pos": 630, "kinase_uniprot_canonical_ac": "P38110-1", "kinase_gene_name": "TEL1", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P35817", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P35817" }, { "database": "PubMed", "id": "20190278", "url": "https://pubmed.ncbi.nlm.nih.gov/20190278" } ], "site_lbl": "Ser630", "uniprot_canonical_ac": "P35817-1" }, { "start_pos": 630, "end_pos": 630, "kinase_uniprot_canonical_ac": "P38111-1", "kinase_gene_name": "MEC1", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P35817", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P35817" }, { "database": "PubMed", "id": "20190278", "url": "https://pubmed.ncbi.nlm.nih.gov/20190278" } ], "site_lbl": "Ser630", "uniprot_canonical_ac": "P35817-1" }, { "start_pos": 630, "end_pos": 630, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "SGD", "id": "S000004391", "url": "https://www.yeastgenome.org/locus/S000004391" }, { "database": "iPTMnet", "id": "P35817", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P35817" }, { "database": "PubMed", "id": "20190278", "url": "https://pubmed.ncbi.nlm.nih.gov/20190278" }, { "database": "PubMed", "id": "23749301", "url": "https://pubmed.ncbi.nlm.nih.gov/23749301" }, { "database": "PubMed", "id": "32597660", "url": "https://pubmed.ncbi.nlm.nih.gov/32597660" }, { "database": "PubMed", "id": "33481703", "url": "https://pubmed.ncbi.nlm.nih.gov/33481703" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" } ], "site_lbl": "Ser630", "uniprot_canonical_ac": "P35817-1" }, { "start_pos": 38, "end_pos": 38, "kinase_uniprot_canonical_ac": "P38110-1", "kinase_gene_name": "TEL1", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P38111", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P38111" }, { "database": "PubMed", "id": "17563356", "url": "https://pubmed.ncbi.nlm.nih.gov/17563356" }, { "database": "PubMed", "id": "18407956", "url": "https://pubmed.ncbi.nlm.nih.gov/18407956" }, { "database": "PubMed", "id": "20190278", "url": "https://pubmed.ncbi.nlm.nih.gov/20190278" } ], "site_lbl": "Ser38", "uniprot_canonical_ac": "P38111-1" }, { "start_pos": 38, "end_pos": 38, "kinase_uniprot_canonical_ac": "P38111-1", "kinase_gene_name": "MEC1", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P38111", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P38111" }, { "database": "PubMed", "id": "17563356", "url": "https://pubmed.ncbi.nlm.nih.gov/17563356" }, { "database": "PubMed", "id": "18407956", "url": "https://pubmed.ncbi.nlm.nih.gov/18407956" }, { "database": "PubMed", "id": "20190278", "url": "https://pubmed.ncbi.nlm.nih.gov/20190278" } ], "site_lbl": "Ser38", "uniprot_canonical_ac": "P38111-1" }, { "start_pos": 38, "end_pos": 38, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "SGD", "id": "S000000340", "url": "https://www.yeastgenome.org/locus/S000000340" }, { "database": "iPTMnet", "id": "P38111", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P38111" }, { "database": "PubMed", "id": "17563356", "url": "https://pubmed.ncbi.nlm.nih.gov/17563356" }, { "database": "PubMed", "id": "18407956", "url": "https://pubmed.ncbi.nlm.nih.gov/18407956" }, { "database": "PubMed", "id": "20190278", "url": "https://pubmed.ncbi.nlm.nih.gov/20190278" }, { "database": "PubMed", "id": "23749301", "url": "https://pubmed.ncbi.nlm.nih.gov/23749301" }, { "database": "PubMed", "id": "32597660", "url": "https://pubmed.ncbi.nlm.nih.gov/32597660" }, { "database": "PubMed", "id": "33481703", "url": "https://pubmed.ncbi.nlm.nih.gov/33481703" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" } ], "site_lbl": "Ser38", "uniprot_canonical_ac": "P38111-1" }, { "start_pos": 415, "end_pos": 415, "kinase_uniprot_canonical_ac": "P38110-1", "kinase_gene_name": "TEL1", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P38193", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P38193" }, { "database": "PubMed", "id": "18407956", "url": "https://pubmed.ncbi.nlm.nih.gov/18407956" }, { "database": "PubMed", "id": "20190278", "url": "https://pubmed.ncbi.nlm.nih.gov/20190278" } ], "site_lbl": "Ser415", "uniprot_canonical_ac": "P38193-1" }, { "start_pos": 415, "end_pos": 415, "kinase_uniprot_canonical_ac": "P38111-1", "kinase_gene_name": "MEC1", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P38193", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P38193" }, { "database": "PubMed", "id": "18407956", "url": "https://pubmed.ncbi.nlm.nih.gov/18407956" }, { "database": "PubMed", "id": "20190278", "url": "https://pubmed.ncbi.nlm.nih.gov/20190278" } ], "site_lbl": "Ser415", "uniprot_canonical_ac": "P38193-1" }, { "start_pos": 415, "end_pos": 415, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "SGD", "id": "S000000142", "url": "https://www.yeastgenome.org/locus/S000000142" }, { "database": "iPTMnet", "id": "P38193", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P38193" }, { "database": "PubMed", "id": "18407956", "url": "https://pubmed.ncbi.nlm.nih.gov/18407956" }, { "database": "PubMed", "id": "20190278", "url": "https://pubmed.ncbi.nlm.nih.gov/20190278" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" } ], "site_lbl": "Ser415", "uniprot_canonical_ac": "P38193-1" }, { "start_pos": 480, "end_pos": 480, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P39705", "url": "https://www.uniprot.org/uniprotkb/P39705" }, { "database": "PubMed", "id": "17287358", "url": "https://pubmed.ncbi.nlm.nih.gov/17287358" }, { "database": "iPTMnet", "id": "P39705", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P39705" }, { "database": "PubMed", "id": "17563356", "url": "https://pubmed.ncbi.nlm.nih.gov/17563356" }, { "database": "PubMed", "id": "18407956", "url": "https://pubmed.ncbi.nlm.nih.gov/18407956" }, { "database": "PubMed", "id": "19795423", "url": "https://pubmed.ncbi.nlm.nih.gov/19795423" }, { "database": "PubMed", "id": "19823750", "url": "https://pubmed.ncbi.nlm.nih.gov/19823750" }, { "database": "PubMed", "id": "20190278", "url": "https://pubmed.ncbi.nlm.nih.gov/20190278" }, { "database": "SGD", "id": "S000000063", "url": "https://www.yeastgenome.org/locus/S000000063" }, { "database": "PubMed", "id": "23749301", "url": "https://pubmed.ncbi.nlm.nih.gov/23749301" }, { "database": "PubMed", "id": "32597660", "url": "https://pubmed.ncbi.nlm.nih.gov/32597660" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" } ], "site_lbl": "Ser480", "uniprot_canonical_ac": "P39705-1" }, { "start_pos": 483, "end_pos": 483, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P39705", "url": "https://www.uniprot.org/uniprotkb/P39705" }, { "database": "PubMed", "id": "17287358", "url": "https://pubmed.ncbi.nlm.nih.gov/17287358" }, { "database": "iPTMnet", "id": "P39705", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P39705" }, { "database": "PubMed", "id": "18407956", "url": "https://pubmed.ncbi.nlm.nih.gov/18407956" }, { "database": "PubMed", "id": "20190278", "url": "https://pubmed.ncbi.nlm.nih.gov/20190278" }, { "database": "SGD", "id": "S000000063", "url": "https://www.yeastgenome.org/locus/S000000063" }, { "database": "PubMed", "id": "17563356", "url": "https://pubmed.ncbi.nlm.nih.gov/17563356" }, { "database": "PubMed", "id": "23749301", "url": "https://pubmed.ncbi.nlm.nih.gov/23749301" }, { "database": "PubMed", "id": "32597660", "url": "https://pubmed.ncbi.nlm.nih.gov/32597660" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" } ], "site_lbl": "Ser483", "uniprot_canonical_ac": "P39705-1" }, { "start_pos": 250, "end_pos": 250, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P40010", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P40010" }, { "database": "PubMed", "id": "20190278", "url": "https://pubmed.ncbi.nlm.nih.gov/20190278" }, { "database": "SGD", "id": "S000000808", "url": "https://www.yeastgenome.org/locus/S000000808" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" } ], "site_lbl": "Ser250", "uniprot_canonical_ac": "P40010-1" }, { "start_pos": 27, "end_pos": 27, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P40352", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P40352" }, { "database": "PubMed", "id": "18407956", "url": "https://pubmed.ncbi.nlm.nih.gov/18407956" }, { "database": "PubMed", "id": "19901073", "url": "https://pubmed.ncbi.nlm.nih.gov/19901073" }, { "database": "PubMed", "id": "20190278", "url": "https://pubmed.ncbi.nlm.nih.gov/20190278" }, { "database": "SGD", "id": "S000003796", "url": "https://www.yeastgenome.org/locus/S000003796" }, { "database": "PubMed", "id": "23749301", "url": "https://pubmed.ncbi.nlm.nih.gov/23749301" }, { "database": "PubMed", "id": "33481703", "url": "https://pubmed.ncbi.nlm.nih.gov/33481703" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" } ], "site_lbl": "Ser27", "uniprot_canonical_ac": "P40352-1" }, { "start_pos": 278, "end_pos": 278, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P40693", "url": "https://www.uniprot.org/uniprotkb/P40693" }, { "database": "PubMed", "id": "18407956", "url": "https://pubmed.ncbi.nlm.nih.gov/18407956" }, { "database": "PubMed", "id": "17287358", "url": "https://pubmed.ncbi.nlm.nih.gov/17287358" }, { "database": "iPTMnet", "id": "P40693", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P40693" }, { "database": "PubMed", "id": "19779198", "url": "https://pubmed.ncbi.nlm.nih.gov/19779198" }, { "database": "PubMed", "id": "20190278", "url": "https://pubmed.ncbi.nlm.nih.gov/20190278" }, { "database": "SGD", "id": "S000004947", "url": "https://www.yeastgenome.org/locus/S000004947" }, { "database": "PubMed", "id": "32597660", "url": "https://pubmed.ncbi.nlm.nih.gov/32597660" }, { "database": "PubMed", "id": "33481703", "url": "https://pubmed.ncbi.nlm.nih.gov/33481703" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" } ], "site_lbl": "Ser278", "uniprot_canonical_ac": "P40693-1" }, { "start_pos": 712, "end_pos": 712, "kinase_uniprot_canonical_ac": "P38110-1", "kinase_gene_name": "TEL1", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P46676", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P46676" }, { "database": "PubMed", "id": "17563356", "url": "https://pubmed.ncbi.nlm.nih.gov/17563356" }, { "database": "PubMed", "id": "18407956", "url": "https://pubmed.ncbi.nlm.nih.gov/18407956" }, { "database": "PubMed", "id": "19779198", "url": "https://pubmed.ncbi.nlm.nih.gov/19779198" }, { "database": "PubMed", "id": "20190278", "url": "https://pubmed.ncbi.nlm.nih.gov/20190278" } ], "site_lbl": "Ser712", "uniprot_canonical_ac": "P46676-1" }, { "start_pos": 712, "end_pos": 712, "kinase_uniprot_canonical_ac": "P38111-1", "kinase_gene_name": "MEC1", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P46676", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P46676" }, { "database": "PubMed", "id": "17563356", "url": "https://pubmed.ncbi.nlm.nih.gov/17563356" }, { "database": "PubMed", "id": "18407956", "url": "https://pubmed.ncbi.nlm.nih.gov/18407956" }, { "database": "PubMed", "id": "19779198", "url": "https://pubmed.ncbi.nlm.nih.gov/19779198" }, { "database": "PubMed", "id": "20190278", "url": "https://pubmed.ncbi.nlm.nih.gov/20190278" } ], "site_lbl": "Ser712", "uniprot_canonical_ac": "P46676-1" }, { "start_pos": 712, "end_pos": 712, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by ATM or ATR", "evidence": [ { "database": "UniProtKB", "id": "P46676", "url": "https://www.uniprot.org/uniprotkb/P46676" }, { "database": "SGD", "id": "S000002718", "url": "https://www.yeastgenome.org/locus/S000002718" }, { "database": "iPTMnet", "id": "P46676", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P46676" }, { "database": "PubMed", "id": "17563356", "url": "https://pubmed.ncbi.nlm.nih.gov/17563356" }, { "database": "PubMed", "id": "18407956", "url": "https://pubmed.ncbi.nlm.nih.gov/18407956" }, { "database": "PubMed", "id": "19779198", "url": "https://pubmed.ncbi.nlm.nih.gov/19779198" }, { "database": "PubMed", "id": "20190278", "url": "https://pubmed.ncbi.nlm.nih.gov/20190278" }, { "database": "PubMed", "id": "23749301", "url": "https://pubmed.ncbi.nlm.nih.gov/23749301" }, { "database": "PubMed", "id": "33481703", "url": "https://pubmed.ncbi.nlm.nih.gov/33481703" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" } ], "site_lbl": "Ser712", "uniprot_canonical_ac": "P46676-1" }, { "start_pos": 36, "end_pos": 36, "kinase_uniprot_canonical_ac": "P38110-1", "kinase_gene_name": "TEL1", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P43579", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P43579" }, { "database": "PubMed", "id": "18407956", "url": "https://pubmed.ncbi.nlm.nih.gov/18407956" }, { "database": "PubMed", "id": "20190278", "url": "https://pubmed.ncbi.nlm.nih.gov/20190278" } ], "site_lbl": "Ser36", "uniprot_canonical_ac": "P43579-1" }, { "start_pos": 36, "end_pos": 36, "kinase_uniprot_canonical_ac": "P38111-1", "kinase_gene_name": "MEC1", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P43579", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P43579" }, { "database": "PubMed", "id": "18407956", "url": "https://pubmed.ncbi.nlm.nih.gov/18407956" }, { "database": "PubMed", "id": "20190278", "url": "https://pubmed.ncbi.nlm.nih.gov/20190278" } ], "site_lbl": "Ser36", "uniprot_canonical_ac": "P43579-1" }, { "start_pos": 36, "end_pos": 36, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "SGD", "id": "S000001881", "url": "https://www.yeastgenome.org/locus/S000001881" }, { "database": "iPTMnet", "id": "P43579", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P43579" }, { "database": "PubMed", "id": "18407956", "url": "https://pubmed.ncbi.nlm.nih.gov/18407956" }, { "database": "PubMed", "id": "20190278", "url": "https://pubmed.ncbi.nlm.nih.gov/20190278" }, { "database": "PubMed", "id": "32597660", "url": "https://pubmed.ncbi.nlm.nih.gov/32597660" }, { "database": "PubMed", "id": "33481703", "url": "https://pubmed.ncbi.nlm.nih.gov/33481703" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" } ], "site_lbl": "Ser36", "uniprot_canonical_ac": "P43579-1" }, { "start_pos": 993, "end_pos": 993, "kinase_uniprot_canonical_ac": "P38110-1", "kinase_gene_name": "TEL1", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P53920", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P53920" }, { "database": "PubMed", "id": "20190278", "url": "https://pubmed.ncbi.nlm.nih.gov/20190278" } ], "site_lbl": "Ser993", "uniprot_canonical_ac": "P53920-1" }, { "start_pos": 993, "end_pos": 993, "kinase_uniprot_canonical_ac": "P38111-1", "kinase_gene_name": "MEC1", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P53920", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P53920" }, { "database": "PubMed", "id": "20190278", "url": "https://pubmed.ncbi.nlm.nih.gov/20190278" } ], "site_lbl": "Ser993", "uniprot_canonical_ac": "P53920-1" }, { "start_pos": 993, "end_pos": 993, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "SGD", "id": "S000005067", "url": "https://www.yeastgenome.org/locus/S000005067" }, { "database": "iPTMnet", "id": "P53920", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P53920" }, { "database": "PubMed", "id": "18407956", "url": "https://pubmed.ncbi.nlm.nih.gov/18407956" }, { "database": "PubMed", "id": "20190278", "url": "https://pubmed.ncbi.nlm.nih.gov/20190278" }, { "database": "PubMed", "id": "23749301", "url": "https://pubmed.ncbi.nlm.nih.gov/23749301" }, { "database": "PubMed", "id": "32597660", "url": "https://pubmed.ncbi.nlm.nih.gov/32597660" }, { "database": "PubMed", "id": "33481703", "url": "https://pubmed.ncbi.nlm.nih.gov/33481703" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" } ], "site_lbl": "Ser993", "uniprot_canonical_ac": "P53920-1" }, { "start_pos": 43, "end_pos": 43, "kinase_uniprot_canonical_ac": "P38110-1", "kinase_gene_name": "TEL1", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P69850", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P69850" }, { "database": "PubMed", "id": "20190278", "url": "https://pubmed.ncbi.nlm.nih.gov/20190278" } ], "site_lbl": "Ser43", "uniprot_canonical_ac": "P69850-1" }, { "start_pos": 43, "end_pos": 43, "kinase_uniprot_canonical_ac": "P38111-1", "kinase_gene_name": "MEC1", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P69850", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P69850" }, { "database": "PubMed", "id": "20190278", "url": "https://pubmed.ncbi.nlm.nih.gov/20190278" } ], "site_lbl": "Ser43", "uniprot_canonical_ac": "P69850-1" }, { "start_pos": 43, "end_pos": 43, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "SGD", "id": "S000007595", "url": "https://www.yeastgenome.org/locus/S000007595" }, { "database": "iPTMnet", "id": "P69850", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P69850" }, { "database": "PubMed", "id": "20190278", "url": "https://pubmed.ncbi.nlm.nih.gov/20190278" }, { "database": "PubMed", "id": "23749301", "url": "https://pubmed.ncbi.nlm.nih.gov/23749301" }, { "database": "PubMed", "id": "32597660", "url": "https://pubmed.ncbi.nlm.nih.gov/32597660" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" } ], "site_lbl": "Ser43", "uniprot_canonical_ac": "P69850-1" }, { "start_pos": 545, "end_pos": 545, "kinase_uniprot_canonical_ac": "P38110-1", "kinase_gene_name": "TEL1", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q02206", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q02206" }, { "database": "PubMed", "id": "18407956", "url": "https://pubmed.ncbi.nlm.nih.gov/18407956" }, { "database": "PubMed", "id": "20190278", "url": "https://pubmed.ncbi.nlm.nih.gov/20190278" } ], "site_lbl": "Ser545", "uniprot_canonical_ac": "Q02206-1" }, { "start_pos": 545, "end_pos": 545, "kinase_uniprot_canonical_ac": "P38111-1", "kinase_gene_name": "MEC1", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q02206", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q02206" }, { "database": "PubMed", "id": "18407956", "url": "https://pubmed.ncbi.nlm.nih.gov/18407956" }, { "database": "PubMed", "id": "20190278", "url": "https://pubmed.ncbi.nlm.nih.gov/20190278" } ], "site_lbl": "Ser545", "uniprot_canonical_ac": "Q02206-1" }, { "start_pos": 545, "end_pos": 545, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "Q02206", "url": "https://www.uniprot.org/uniprotkb/Q02206" }, { "database": "PubMed", "id": "18407956", "url": "https://pubmed.ncbi.nlm.nih.gov/18407956" }, { "database": "SGD", "id": "S000001716", "url": "https://www.yeastgenome.org/locus/S000001716" }, { "database": "iPTMnet", "id": "Q02206", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q02206" }, { "database": "PubMed", "id": "20190278", "url": "https://pubmed.ncbi.nlm.nih.gov/20190278" }, { "database": "PubMed", "id": "23749301", "url": "https://pubmed.ncbi.nlm.nih.gov/23749301" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" } ], "site_lbl": "Ser545", "uniprot_canonical_ac": "Q02206-1" }, { "start_pos": 68, "end_pos": 68, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "Q04779", "url": "https://www.uniprot.org/uniprotkb/Q04779" }, { "database": "PubMed", "id": "18407956", "url": "https://pubmed.ncbi.nlm.nih.gov/18407956" }, { "database": "iPTMnet", "id": "Q04779", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q04779" }, { "database": "PubMed", "id": "20190278", "url": "https://pubmed.ncbi.nlm.nih.gov/20190278" }, { "database": "SGD", "id": "S000004680", "url": "https://www.yeastgenome.org/locus/S000004680" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" } ], "site_lbl": "Ser68", "uniprot_canonical_ac": "Q04779-1" }, { "start_pos": 517, "end_pos": 517, "kinase_uniprot_canonical_ac": "P38110-1", "kinase_gene_name": "TEL1", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q06224", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q06224" }, { "database": "PubMed", "id": "17563356", "url": "https://pubmed.ncbi.nlm.nih.gov/17563356" }, { "database": "PubMed", "id": "18407956", "url": "https://pubmed.ncbi.nlm.nih.gov/18407956" }, { "database": "PubMed", "id": "20190278", "url": "https://pubmed.ncbi.nlm.nih.gov/20190278" } ], "site_lbl": "Ser517", "uniprot_canonical_ac": "Q06224-1" }, { "start_pos": 517, "end_pos": 517, "kinase_uniprot_canonical_ac": "P38111-1", "kinase_gene_name": "MEC1", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q06224", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q06224" }, { "database": "PubMed", "id": "17563356", "url": "https://pubmed.ncbi.nlm.nih.gov/17563356" }, { "database": "PubMed", "id": "18407956", "url": "https://pubmed.ncbi.nlm.nih.gov/18407956" }, { "database": "PubMed", "id": "20190278", "url": "https://pubmed.ncbi.nlm.nih.gov/20190278" } ], "site_lbl": "Ser517", "uniprot_canonical_ac": "Q06224-1" }, { "start_pos": 517, "end_pos": 517, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by ATM or ATR", "evidence": [ { "database": "UniProtKB", "id": "Q06224", "url": "https://www.uniprot.org/uniprotkb/Q06224" }, { "database": "SGD", "id": "S000004267", "url": "https://www.yeastgenome.org/locus/S000004267" }, { "database": "iPTMnet", "id": "Q06224", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q06224" }, { "database": "PubMed", "id": "17563356", "url": "https://pubmed.ncbi.nlm.nih.gov/17563356" }, { "database": "PubMed", "id": "18407956", "url": "https://pubmed.ncbi.nlm.nih.gov/18407956" }, { "database": "PubMed", "id": "20190278", "url": "https://pubmed.ncbi.nlm.nih.gov/20190278" }, { "database": "PubMed", "id": "23749301", "url": "https://pubmed.ncbi.nlm.nih.gov/23749301" }, { "database": "PubMed", "id": "33481703", "url": "https://pubmed.ncbi.nlm.nih.gov/33481703" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" } ], "site_lbl": "Ser517", "uniprot_canonical_ac": "Q06224-1" }, { "start_pos": 11, "end_pos": 11, "kinase_uniprot_canonical_ac": "P38110-1", "kinase_gene_name": "TEL1", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q06488", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q06488" }, { "database": "PubMed", "id": "20190278", "url": "https://pubmed.ncbi.nlm.nih.gov/20190278" } ], "site_lbl": "Thr11", "uniprot_canonical_ac": "Q06488-1" }, { "start_pos": 11, "end_pos": 11, "kinase_uniprot_canonical_ac": "P38111-1", "kinase_gene_name": "MEC1", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q06488", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q06488" }, { "database": "PubMed", "id": "20190278", "url": "https://pubmed.ncbi.nlm.nih.gov/20190278" } ], "site_lbl": "Thr11", "uniprot_canonical_ac": "Q06488-1" }, { "start_pos": 11, "end_pos": 11, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "SGD", "id": "S000004349", "url": "https://www.yeastgenome.org/locus/S000004349" }, { "database": "iPTMnet", "id": "Q06488", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q06488" }, { "database": "PubMed", "id": "20190278", "url": "https://pubmed.ncbi.nlm.nih.gov/20190278" } ], "site_lbl": "Thr11", "uniprot_canonical_ac": "Q06488-1" }, { "start_pos": 1082, "end_pos": 1082, "kinase_uniprot_canonical_ac": "P38110-1", "kinase_gene_name": "TEL1", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q08773", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q08773" }, { "database": "PubMed", "id": "17330950", "url": "https://pubmed.ncbi.nlm.nih.gov/17330950" }, { "database": "PubMed", "id": "17563356", "url": "https://pubmed.ncbi.nlm.nih.gov/17563356" }, { "database": "PubMed", "id": "18407956", "url": "https://pubmed.ncbi.nlm.nih.gov/18407956" }, { "database": "PubMed", "id": "19779198", "url": "https://pubmed.ncbi.nlm.nih.gov/19779198" }, { "database": "PubMed", "id": "20190278", "url": "https://pubmed.ncbi.nlm.nih.gov/20190278" } ], "site_lbl": "Ser1082", "uniprot_canonical_ac": "Q08773-1" }, { "start_pos": 1082, "end_pos": 1082, "kinase_uniprot_canonical_ac": "P38111-1", "kinase_gene_name": "MEC1", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q08773", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q08773" }, { "database": "PubMed", "id": "17330950", "url": "https://pubmed.ncbi.nlm.nih.gov/17330950" }, { "database": "PubMed", "id": "17563356", "url": "https://pubmed.ncbi.nlm.nih.gov/17563356" }, { "database": "PubMed", "id": "18407956", "url": "https://pubmed.ncbi.nlm.nih.gov/18407956" }, { "database": "PubMed", "id": "19779198", "url": "https://pubmed.ncbi.nlm.nih.gov/19779198" }, { "database": "PubMed", "id": "20190278", "url": "https://pubmed.ncbi.nlm.nih.gov/20190278" } ], "site_lbl": "Ser1082", "uniprot_canonical_ac": "Q08773-1" }, { "start_pos": 1082, "end_pos": 1082, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "Q08773", "url": "https://www.uniprot.org/uniprotkb/Q08773" }, { "database": "PubMed", "id": "19779198", "url": "https://pubmed.ncbi.nlm.nih.gov/19779198" }, { "database": "PubMed", "id": "18407956", "url": "https://pubmed.ncbi.nlm.nih.gov/18407956" }, { "database": "SGD", "id": "S000005831", "url": "https://www.yeastgenome.org/locus/S000005831" }, { "database": "iPTMnet", "id": "Q08773", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q08773" }, { "database": "PubMed", "id": "20190278", "url": "https://pubmed.ncbi.nlm.nih.gov/20190278" }, { "database": "PubMed", "id": "23749301", "url": "https://pubmed.ncbi.nlm.nih.gov/23749301" }, { "database": "PubMed", "id": "32597660", "url": "https://pubmed.ncbi.nlm.nih.gov/32597660" }, { "database": "PubMed", "id": "33481703", "url": "https://pubmed.ncbi.nlm.nih.gov/33481703" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" } ], "site_lbl": "Ser1082", "uniprot_canonical_ac": "Q08773-1" }, { "start_pos": 525, "end_pos": 525, "kinase_uniprot_canonical_ac": "P38110-1", "kinase_gene_name": "TEL1", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q08887", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q08887" }, { "database": "PubMed", "id": "20190278", "url": "https://pubmed.ncbi.nlm.nih.gov/20190278" } ], "site_lbl": "Ser525", "uniprot_canonical_ac": "Q08887-1" }, { "start_pos": 525, "end_pos": 525, "kinase_uniprot_canonical_ac": "P38111-1", "kinase_gene_name": "MEC1", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q08887", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q08887" }, { "database": "PubMed", "id": "20190278", "url": "https://pubmed.ncbi.nlm.nih.gov/20190278" } ], "site_lbl": "Ser525", "uniprot_canonical_ac": "Q08887-1" }, { "start_pos": 525, "end_pos": 525, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "SGD", "id": "S000005899", "url": "https://www.yeastgenome.org/locus/S000005899" }, { "database": "iPTMnet", "id": "Q08887", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q08887" }, { "database": "PubMed", "id": "20190278", "url": "https://pubmed.ncbi.nlm.nih.gov/20190278" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" } ], "site_lbl": "Ser525", "uniprot_canonical_ac": "Q08887-1" }, { "start_pos": 470, "end_pos": 470, "kinase_uniprot_canonical_ac": "P38110-1", "kinase_gene_name": "TEL1", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q12406", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q12406" }, { "database": "PubMed", "id": "20190278", "url": "https://pubmed.ncbi.nlm.nih.gov/20190278" } ], "site_lbl": "Ser470", "uniprot_canonical_ac": "Q12406-1" }, { "start_pos": 470, "end_pos": 470, "kinase_uniprot_canonical_ac": "P38111-1", "kinase_gene_name": "MEC1", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q12406", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q12406" }, { "database": "PubMed", "id": "20190278", "url": "https://pubmed.ncbi.nlm.nih.gov/20190278" } ], "site_lbl": "Ser470", "uniprot_canonical_ac": "Q12406-1" }, { "start_pos": 470, "end_pos": 470, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "SGD", "id": "S000006238", "url": "https://www.yeastgenome.org/locus/S000006238" }, { "database": "iPTMnet", "id": "Q12406", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q12406" }, { "database": "PubMed", "id": "20190278", "url": "https://pubmed.ncbi.nlm.nih.gov/20190278" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" } ], "site_lbl": "Ser470", "uniprot_canonical_ac": "Q12406-1" }, { "start_pos": 13, "end_pos": 13, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P35719", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P35719" }, { "database": "PubMed", "id": "17563356", "url": "https://pubmed.ncbi.nlm.nih.gov/17563356" }, { "database": "PubMed", "id": "18407956", "url": "https://pubmed.ncbi.nlm.nih.gov/18407956" }, { "database": "PubMed", "id": "20190278", "url": "https://pubmed.ncbi.nlm.nih.gov/20190278" }, { "database": "SGD", "id": "S000001625", "url": "https://www.yeastgenome.org/locus/S000001625" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" } ], "site_lbl": "Ser13", "uniprot_canonical_ac": "P35719-1" }, { "start_pos": 550, "end_pos": 550, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P38167", "url": "https://www.uniprot.org/uniprotkb/P38167" }, { "database": "PubMed", "id": "18407956", "url": "https://pubmed.ncbi.nlm.nih.gov/18407956" }, { "database": "iPTMnet", "id": "P38167", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P38167" }, { "database": "PubMed", "id": "20190278", "url": "https://pubmed.ncbi.nlm.nih.gov/20190278" }, { "database": "SGD", "id": "S000000197", "url": "https://www.yeastgenome.org/locus/S000000197" }, { "database": "PubMed", "id": "33481703", "url": "https://pubmed.ncbi.nlm.nih.gov/33481703" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" } ], "site_lbl": "Ser550", "uniprot_canonical_ac": "P38167-1" }, { "start_pos": 339, "end_pos": 339, "kinase_uniprot_canonical_ac": "P38110-1", "kinase_gene_name": "TEL1", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P38439", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P38439" }, { "database": "PubMed", "id": "17563356", "url": "https://pubmed.ncbi.nlm.nih.gov/17563356" }, { "database": "PubMed", "id": "20190278", "url": "https://pubmed.ncbi.nlm.nih.gov/20190278" } ], "site_lbl": "Ser339", "uniprot_canonical_ac": "P38439-1" }, { "start_pos": 339, "end_pos": 339, "kinase_uniprot_canonical_ac": "P38111-1", "kinase_gene_name": "MEC1", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P38439", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P38439" }, { "database": "PubMed", "id": "17563356", "url": "https://pubmed.ncbi.nlm.nih.gov/17563356" }, { "database": "PubMed", "id": "20190278", "url": "https://pubmed.ncbi.nlm.nih.gov/20190278" } ], "site_lbl": "Ser339", "uniprot_canonical_ac": "P38439-1" }, { "start_pos": 339, "end_pos": 339, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "SGD", "id": "S000005649", "url": "https://www.yeastgenome.org/locus/S000005649" }, { "database": "iPTMnet", "id": "P38439", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P38439" }, { "database": "PubMed", "id": "20190278", "url": "https://pubmed.ncbi.nlm.nih.gov/20190278" }, { "database": "PubMed", "id": "23749301", "url": "https://pubmed.ncbi.nlm.nih.gov/23749301" }, { "database": "PubMed", "id": "32597660", "url": "https://pubmed.ncbi.nlm.nih.gov/32597660" }, { "database": "PubMed", "id": "33481703", "url": "https://pubmed.ncbi.nlm.nih.gov/33481703" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" } ], "site_lbl": "Ser339", "uniprot_canonical_ac": "P38439-1" }, { "start_pos": 815, "end_pos": 815, "kinase_uniprot_canonical_ac": "P38110-1", "kinase_gene_name": "TEL1", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P38781", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P38781" }, { "database": "PubMed", "id": "20190278", "url": "https://pubmed.ncbi.nlm.nih.gov/20190278" } ], "site_lbl": "Ser815", "uniprot_canonical_ac": "P38781-1" }, { "start_pos": 815, "end_pos": 815, "kinase_uniprot_canonical_ac": "P38111-1", "kinase_gene_name": "MEC1", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P38781", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P38781" }, { "database": "PubMed", "id": "20190278", "url": "https://pubmed.ncbi.nlm.nih.gov/20190278" } ], "site_lbl": "Ser815", "uniprot_canonical_ac": "P38781-1" }, { "start_pos": 815, "end_pos": 815, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "SGD", "id": "S000001098", "url": "https://www.yeastgenome.org/locus/S000001098" }, { "database": "iPTMnet", "id": "P38781", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P38781" }, { "database": "PubMed", "id": "20190278", "url": "https://pubmed.ncbi.nlm.nih.gov/20190278" } ], "site_lbl": "Ser815", "uniprot_canonical_ac": "P38781-1" }, { "start_pos": 184, "end_pos": 184, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P38850", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P38850" }, { "database": "PubMed", "id": "18407956", "url": "https://pubmed.ncbi.nlm.nih.gov/18407956" }, { "database": "PubMed", "id": "19779198", "url": "https://pubmed.ncbi.nlm.nih.gov/19779198" }, { "database": "PubMed", "id": "20190278", "url": "https://pubmed.ncbi.nlm.nih.gov/20190278" }, { "database": "SGD", "id": "S000001197", "url": "https://www.yeastgenome.org/locus/S000001197" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" } ], "site_lbl": "Ser184", "uniprot_canonical_ac": "P38850-1" }, { "start_pos": 743, "end_pos": 743, "kinase_uniprot_canonical_ac": "P38110-1", "kinase_gene_name": "TEL1", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P38850", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P38850" }, { "database": "PubMed", "id": "14988729", "url": "https://pubmed.ncbi.nlm.nih.gov/14988729" }, { "database": "PubMed", "id": "17330950", "url": "https://pubmed.ncbi.nlm.nih.gov/17330950" }, { "database": "PubMed", "id": "20190278", "url": "https://pubmed.ncbi.nlm.nih.gov/20190278" } ], "site_lbl": "Ser743", "uniprot_canonical_ac": "P38850-1" }, { "start_pos": 743, "end_pos": 743, "kinase_uniprot_canonical_ac": "P38111-1", "kinase_gene_name": "MEC1", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P38850", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P38850" }, { "database": "PubMed", "id": "14988729", "url": "https://pubmed.ncbi.nlm.nih.gov/14988729" }, { "database": "PubMed", "id": "17330950", "url": "https://pubmed.ncbi.nlm.nih.gov/17330950" }, { "database": "PubMed", "id": "20190278", "url": "https://pubmed.ncbi.nlm.nih.gov/20190278" } ], "site_lbl": "Ser743", "uniprot_canonical_ac": "P38850-1" }, { "start_pos": 743, "end_pos": 743, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "SGD", "id": "S000001197", "url": "https://www.yeastgenome.org/locus/S000001197" }, { "database": "iPTMnet", "id": "P38850", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P38850" }, { "database": "PubMed", "id": "20190278", "url": "https://pubmed.ncbi.nlm.nih.gov/20190278" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" } ], "site_lbl": "Ser743", "uniprot_canonical_ac": "P38850-1" }, { "start_pos": 800, "end_pos": 800, "kinase_uniprot_canonical_ac": "P38110-1", "kinase_gene_name": "TEL1", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P38850", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P38850" }, { "database": "PubMed", "id": "18407956", "url": "https://pubmed.ncbi.nlm.nih.gov/18407956" }, { "database": "PubMed", "id": "19779198", "url": "https://pubmed.ncbi.nlm.nih.gov/19779198" }, { "database": "PubMed", "id": "20190278", "url": "https://pubmed.ncbi.nlm.nih.gov/20190278" } ], "site_lbl": "Ser800", "uniprot_canonical_ac": "P38850-1" }, { "start_pos": 800, "end_pos": 800, "kinase_uniprot_canonical_ac": "P38111-1", "kinase_gene_name": "MEC1", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P38850", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P38850" }, { "database": "PubMed", "id": "18407956", "url": "https://pubmed.ncbi.nlm.nih.gov/18407956" }, { "database": "PubMed", "id": "19779198", "url": "https://pubmed.ncbi.nlm.nih.gov/19779198" }, { "database": "PubMed", "id": "20190278", "url": "https://pubmed.ncbi.nlm.nih.gov/20190278" } ], "site_lbl": "Ser800", "uniprot_canonical_ac": "P38850-1" }, { "start_pos": 800, "end_pos": 800, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P38850", "url": "https://www.uniprot.org/uniprotkb/P38850" }, { "database": "PubMed", "id": "18407956", "url": "https://pubmed.ncbi.nlm.nih.gov/18407956" }, { "database": "SGD", "id": "S000001197", "url": "https://www.yeastgenome.org/locus/S000001197" }, { "database": "iPTMnet", "id": "P38850", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P38850" }, { "database": "PubMed", "id": "19779198", "url": "https://pubmed.ncbi.nlm.nih.gov/19779198" }, { "database": "PubMed", "id": "20190278", "url": "https://pubmed.ncbi.nlm.nih.gov/20190278" }, { "database": "PubMed", "id": "23749301", "url": "https://pubmed.ncbi.nlm.nih.gov/23749301" }, { "database": "PubMed", "id": "33481703", "url": "https://pubmed.ncbi.nlm.nih.gov/33481703" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" } ], "site_lbl": "Ser800", "uniprot_canonical_ac": "P38850-1" }, { "start_pos": 806, "end_pos": 806, "kinase_uniprot_canonical_ac": "P38110-1", "kinase_gene_name": "TEL1", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P38850", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P38850" }, { "database": "PubMed", "id": "14988729", "url": "https://pubmed.ncbi.nlm.nih.gov/14988729" }, { "database": "PubMed", "id": "17563356", "url": "https://pubmed.ncbi.nlm.nih.gov/17563356" }, { "database": "PubMed", "id": "18407956", "url": "https://pubmed.ncbi.nlm.nih.gov/18407956" }, { "database": "PubMed", "id": "19779198", "url": "https://pubmed.ncbi.nlm.nih.gov/19779198" }, { "database": "PubMed", "id": "20190278", "url": "https://pubmed.ncbi.nlm.nih.gov/20190278" } ], "site_lbl": "Ser806", "uniprot_canonical_ac": "P38850-1" }, { "start_pos": 806, "end_pos": 806, "kinase_uniprot_canonical_ac": "P38111-1", "kinase_gene_name": "MEC1", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P38850", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P38850" }, { "database": "PubMed", "id": "14988729", "url": "https://pubmed.ncbi.nlm.nih.gov/14988729" }, { "database": "PubMed", "id": "17563356", "url": "https://pubmed.ncbi.nlm.nih.gov/17563356" }, { "database": "PubMed", "id": "18407956", "url": "https://pubmed.ncbi.nlm.nih.gov/18407956" }, { "database": "PubMed", "id": "19779198", "url": "https://pubmed.ncbi.nlm.nih.gov/19779198" }, { "database": "PubMed", "id": "20190278", "url": "https://pubmed.ncbi.nlm.nih.gov/20190278" } ], "site_lbl": "Ser806", "uniprot_canonical_ac": "P38850-1" }, { "start_pos": 806, "end_pos": 806, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P38850", "url": "https://www.uniprot.org/uniprotkb/P38850" }, { "database": "PubMed", "id": "19779198", "url": "https://pubmed.ncbi.nlm.nih.gov/19779198" }, { "database": "PubMed", "id": "18407956", "url": "https://pubmed.ncbi.nlm.nih.gov/18407956" }, { "database": "SGD", "id": "S000001197", "url": "https://www.yeastgenome.org/locus/S000001197" }, { "database": "iPTMnet", "id": "P38850", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P38850" }, { "database": "PubMed", "id": "20190278", "url": "https://pubmed.ncbi.nlm.nih.gov/20190278" }, { "database": "PubMed", "id": "23749301", "url": "https://pubmed.ncbi.nlm.nih.gov/23749301" }, { "database": "PubMed", "id": "32597660", "url": "https://pubmed.ncbi.nlm.nih.gov/32597660" }, { "database": "PubMed", "id": "33481703", "url": "https://pubmed.ncbi.nlm.nih.gov/33481703" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" } ], "site_lbl": "Ser806", "uniprot_canonical_ac": "P38850-1" }, { "start_pos": 139, "end_pos": 139, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P39956", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P39956" }, { "database": "PubMed", "id": "20190278", "url": "https://pubmed.ncbi.nlm.nih.gov/20190278" }, { "database": "SGD", "id": "S000000971", "url": "https://www.yeastgenome.org/locus/S000000971" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" } ], "site_lbl": "Ser139", "uniprot_canonical_ac": "P39956-1" }, { "start_pos": 1142, "end_pos": 1142, "kinase_uniprot_canonical_ac": "P38110-1", "kinase_gene_name": "TEL1", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P40340", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P40340" }, { "database": "PubMed", "id": "15972895", "url": "https://pubmed.ncbi.nlm.nih.gov/15972895" }, { "database": "PubMed", "id": "17563356", "url": "https://pubmed.ncbi.nlm.nih.gov/17563356" }, { "database": "PubMed", "id": "18407956", "url": "https://pubmed.ncbi.nlm.nih.gov/18407956" }, { "database": "PubMed", "id": "19779198", "url": "https://pubmed.ncbi.nlm.nih.gov/19779198" }, { "database": "PubMed", "id": "19795423", "url": "https://pubmed.ncbi.nlm.nih.gov/19795423" }, { "database": "PubMed", "id": "19823750", "url": "https://pubmed.ncbi.nlm.nih.gov/19823750" }, { "database": "PubMed", "id": "20190278", "url": "https://pubmed.ncbi.nlm.nih.gov/20190278" }, { "database": "PubMed", "id": "20489023", "url": "https://pubmed.ncbi.nlm.nih.gov/20489023" }, { "database": "PubMed", "id": "20702584", "url": "https://pubmed.ncbi.nlm.nih.gov/20702584" }, { "database": "PubMed", "id": "21126336", "url": "https://pubmed.ncbi.nlm.nih.gov/21126336" }, { "database": "PubMed", "id": "21177495", "url": "https://pubmed.ncbi.nlm.nih.gov/21177495" } ], "site_lbl": "Ser1142", "uniprot_canonical_ac": "P40340-1" }, { "start_pos": 1142, "end_pos": 1142, "kinase_uniprot_canonical_ac": "P38111-1", "kinase_gene_name": "MEC1", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P40340", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P40340" }, { "database": "PubMed", "id": "15972895", "url": "https://pubmed.ncbi.nlm.nih.gov/15972895" }, { "database": "PubMed", "id": "17563356", "url": "https://pubmed.ncbi.nlm.nih.gov/17563356" }, { "database": "PubMed", "id": "18407956", "url": "https://pubmed.ncbi.nlm.nih.gov/18407956" }, { "database": "PubMed", "id": "19779198", "url": "https://pubmed.ncbi.nlm.nih.gov/19779198" }, { "database": "PubMed", "id": "19795423", "url": "https://pubmed.ncbi.nlm.nih.gov/19795423" }, { "database": "PubMed", "id": "19823750", "url": "https://pubmed.ncbi.nlm.nih.gov/19823750" }, { "database": "PubMed", "id": "20190278", "url": "https://pubmed.ncbi.nlm.nih.gov/20190278" }, { "database": "PubMed", "id": "20489023", "url": "https://pubmed.ncbi.nlm.nih.gov/20489023" }, { "database": "PubMed", "id": "20702584", "url": "https://pubmed.ncbi.nlm.nih.gov/20702584" }, { "database": "PubMed", "id": "21126336", "url": "https://pubmed.ncbi.nlm.nih.gov/21126336" }, { "database": "PubMed", "id": "21177495", "url": "https://pubmed.ncbi.nlm.nih.gov/21177495" } ], "site_lbl": "Ser1142", "uniprot_canonical_ac": "P40340-1" }, { "start_pos": 1142, "end_pos": 1142, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P40340", "url": "https://www.uniprot.org/uniprotkb/P40340" }, { "database": "PubMed", "id": "18407956", "url": "https://pubmed.ncbi.nlm.nih.gov/18407956" }, { "database": "PubMed", "id": "19779198", "url": "https://pubmed.ncbi.nlm.nih.gov/19779198" }, { "database": "SGD", "id": "S000003502", "url": "https://www.yeastgenome.org/locus/S000003502" }, { "database": "iPTMnet", "id": "P40340", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P40340" }, { "database": "PubMed", "id": "20190278", "url": "https://pubmed.ncbi.nlm.nih.gov/20190278" }, { "database": "PubMed", "id": "20489023", "url": "https://pubmed.ncbi.nlm.nih.gov/20489023" }, { "database": "PubMed", "id": "20702584", "url": "https://pubmed.ncbi.nlm.nih.gov/20702584" }, { "database": "PubMed", "id": "23749301", "url": "https://pubmed.ncbi.nlm.nih.gov/23749301" }, { "database": "PubMed", "id": "32597660", "url": "https://pubmed.ncbi.nlm.nih.gov/32597660" }, { "database": "PubMed", "id": "33481703", "url": "https://pubmed.ncbi.nlm.nih.gov/33481703" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" } ], "site_lbl": "Ser1142", "uniprot_canonical_ac": "P40340-1" }, { "start_pos": 182, "end_pos": 182, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P40477", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P40477" }, { "database": "PubMed", "id": "19779198", "url": "https://pubmed.ncbi.nlm.nih.gov/19779198" }, { "database": "PubMed", "id": "20190278", "url": "https://pubmed.ncbi.nlm.nih.gov/20190278" }, { "database": "SGD", "id": "S000001377", "url": "https://www.yeastgenome.org/locus/S000001377" } ], "site_lbl": "Ser182", "uniprot_canonical_ac": "P40477-1" }, { "start_pos": 343, "end_pos": 343, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P40541", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P40541" }, { "database": "PubMed", "id": "18407956", "url": "https://pubmed.ncbi.nlm.nih.gov/18407956" }, { "database": "PubMed", "id": "20190278", "url": "https://pubmed.ncbi.nlm.nih.gov/20190278" }, { "database": "SGD", "id": "S000001288", "url": "https://www.yeastgenome.org/locus/S000001288" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" } ], "site_lbl": "Ser343", "uniprot_canonical_ac": "P40541-1" }, { "start_pos": 305, "end_pos": 305, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q01448", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q01448" }, { "database": "PubMed", "id": "18407956", "url": "https://pubmed.ncbi.nlm.nih.gov/18407956" }, { "database": "PubMed", "id": "19779198", "url": "https://pubmed.ncbi.nlm.nih.gov/19779198" }, { "database": "PubMed", "id": "20190278", "url": "https://pubmed.ncbi.nlm.nih.gov/20190278" }, { "database": "SGD", "id": "S000000419", "url": "https://www.yeastgenome.org/locus/S000000419" }, { "database": "PubMed", "id": "23749301", "url": "https://pubmed.ncbi.nlm.nih.gov/23749301" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" }, { "database": "PubMed", "id": "33502312", "url": "https://pubmed.ncbi.nlm.nih.gov/33502312" } ], "site_lbl": "Ser305", "uniprot_canonical_ac": "Q01448-1" }, { "start_pos": 307, "end_pos": 307, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "SGD", "id": "S000000419", "url": "https://www.yeastgenome.org/locus/S000000419" }, { "database": "iPTMnet", "id": "Q01448", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q01448" }, { "database": "PubMed", "id": "20190278", "url": "https://pubmed.ncbi.nlm.nih.gov/20190278" }, { "database": "PubMed", "id": "23749301", "url": "https://pubmed.ncbi.nlm.nih.gov/23749301" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" }, { "database": "PubMed", "id": "33502312", "url": "https://pubmed.ncbi.nlm.nih.gov/33502312" } ], "site_lbl": "Ser307", "uniprot_canonical_ac": "Q01448-1" }, { "start_pos": 312, "end_pos": 312, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "SGD", "id": "S000000419", "url": "https://www.yeastgenome.org/locus/S000000419" }, { "database": "iPTMnet", "id": "Q01448", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q01448" }, { "database": "PubMed", "id": "20190278", "url": "https://pubmed.ncbi.nlm.nih.gov/20190278" }, { "database": "PubMed", "id": "23749301", "url": "https://pubmed.ncbi.nlm.nih.gov/23749301" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" } ], "site_lbl": "Ser312", "uniprot_canonical_ac": "Q01448-1" }, { "start_pos": 388, "end_pos": 388, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "SGD", "id": "S000000419", "url": "https://www.yeastgenome.org/locus/S000000419" }, { "database": "iPTMnet", "id": "Q01448", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q01448" }, { "database": "PubMed", "id": "20190278", "url": "https://pubmed.ncbi.nlm.nih.gov/20190278" }, { "database": "PubMed", "id": "23749301", "url": "https://pubmed.ncbi.nlm.nih.gov/23749301" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" } ], "site_lbl": "Ser388", "uniprot_canonical_ac": "Q01448-1" }, { "start_pos": 1670, "end_pos": 1670, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "Q02455", "url": "https://www.uniprot.org/uniprotkb/Q02455" }, { "database": "PubMed", "id": "18407956", "url": "https://pubmed.ncbi.nlm.nih.gov/18407956" }, { "database": "iPTMnet", "id": "Q02455", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q02455" }, { "database": "PubMed", "id": "20190278", "url": "https://pubmed.ncbi.nlm.nih.gov/20190278" }, { "database": "SGD", "id": "S000001803", "url": "https://www.yeastgenome.org/locus/S000001803" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" } ], "site_lbl": "Ser1670", "uniprot_canonical_ac": "Q02455-1" }, { "start_pos": 1723, "end_pos": 1723, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q02455", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q02455" }, { "database": "PubMed", "id": "18407956", "url": "https://pubmed.ncbi.nlm.nih.gov/18407956" }, { "database": "PubMed", "id": "20190278", "url": "https://pubmed.ncbi.nlm.nih.gov/20190278" }, { "database": "SGD", "id": "S000001803", "url": "https://www.yeastgenome.org/locus/S000001803" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" } ], "site_lbl": "Ser1723", "uniprot_canonical_ac": "Q02455-1" }, { "start_pos": 325, "end_pos": 325, "kinase_uniprot_canonical_ac": "P38110-1", "kinase_gene_name": "TEL1", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q03761", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q03761" }, { "database": "PubMed", "id": "18407956", "url": "https://pubmed.ncbi.nlm.nih.gov/18407956" }, { "database": "PubMed", "id": "20190278", "url": "https://pubmed.ncbi.nlm.nih.gov/20190278" } ], "site_lbl": "Ser325", "uniprot_canonical_ac": "Q03761-1" }, { "start_pos": 325, "end_pos": 325, "kinase_uniprot_canonical_ac": "P38111-1", "kinase_gene_name": "MEC1", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q03761", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q03761" }, { "database": "PubMed", "id": "18407956", "url": "https://pubmed.ncbi.nlm.nih.gov/18407956" }, { "database": "PubMed", "id": "20190278", "url": "https://pubmed.ncbi.nlm.nih.gov/20190278" } ], "site_lbl": "Ser325", "uniprot_canonical_ac": "Q03761-1" }, { "start_pos": 325, "end_pos": 325, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "SGD", "id": "S000002552", "url": "https://www.yeastgenome.org/locus/S000002552" }, { "database": "iPTMnet", "id": "Q03761", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q03761" }, { "database": "PubMed", "id": "18407956", "url": "https://pubmed.ncbi.nlm.nih.gov/18407956" }, { "database": "PubMed", "id": "20190278", "url": "https://pubmed.ncbi.nlm.nih.gov/20190278" }, { "database": "PubMed", "id": "23749301", "url": "https://pubmed.ncbi.nlm.nih.gov/23749301" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" } ], "site_lbl": "Ser325", "uniprot_canonical_ac": "Q03761-1" }, { "start_pos": 657, "end_pos": 657, "kinase_uniprot_canonical_ac": "P38110-1", "kinase_gene_name": "TEL1", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q05471", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q05471" }, { "database": "PubMed", "id": "20190278", "url": "https://pubmed.ncbi.nlm.nih.gov/20190278" } ], "site_lbl": "Thr657", "uniprot_canonical_ac": "Q05471-1" }, { "start_pos": 657, "end_pos": 657, "kinase_uniprot_canonical_ac": "P38111-1", "kinase_gene_name": "MEC1", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q05471", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q05471" }, { "database": "PubMed", "id": "20190278", "url": "https://pubmed.ncbi.nlm.nih.gov/20190278" } ], "site_lbl": "Thr657", "uniprot_canonical_ac": "Q05471-1" }, { "start_pos": 657, "end_pos": 657, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "SGD", "id": "S000002742", "url": "https://www.yeastgenome.org/locus/S000002742" }, { "database": "iPTMnet", "id": "Q05471", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q05471" }, { "database": "PubMed", "id": "20190278", "url": "https://pubmed.ncbi.nlm.nih.gov/20190278" } ], "site_lbl": "Thr657", "uniprot_canonical_ac": "Q05471-1" }, { "start_pos": 262, "end_pos": 262, "kinase_uniprot_canonical_ac": "P38110-1", "kinase_gene_name": "TEL1", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q12072", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q12072" }, { "database": "PubMed", "id": "18407956", "url": "https://pubmed.ncbi.nlm.nih.gov/18407956" }, { "database": "PubMed", "id": "19779198", "url": "https://pubmed.ncbi.nlm.nih.gov/19779198" }, { "database": "PubMed", "id": "20190278", "url": "https://pubmed.ncbi.nlm.nih.gov/20190278" } ], "site_lbl": "Ser262", "uniprot_canonical_ac": "Q12072-1" }, { "start_pos": 262, "end_pos": 262, "kinase_uniprot_canonical_ac": "P38111-1", "kinase_gene_name": "MEC1", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q12072", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q12072" }, { "database": "PubMed", "id": "18407956", "url": "https://pubmed.ncbi.nlm.nih.gov/18407956" }, { "database": "PubMed", "id": "19779198", "url": "https://pubmed.ncbi.nlm.nih.gov/19779198" }, { "database": "PubMed", "id": "20190278", "url": "https://pubmed.ncbi.nlm.nih.gov/20190278" } ], "site_lbl": "Ser262", "uniprot_canonical_ac": "Q12072-1" }, { "start_pos": 262, "end_pos": 262, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "SGD", "id": "S000004085", "url": "https://www.yeastgenome.org/locus/S000004085" }, { "database": "iPTMnet", "id": "Q12072", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q12072" }, { "database": "PubMed", "id": "18407956", "url": "https://pubmed.ncbi.nlm.nih.gov/18407956" }, { "database": "PubMed", "id": "19779198", "url": "https://pubmed.ncbi.nlm.nih.gov/19779198" }, { "database": "PubMed", "id": "20190278", "url": "https://pubmed.ncbi.nlm.nih.gov/20190278" }, { "database": "PubMed", "id": "23749301", "url": "https://pubmed.ncbi.nlm.nih.gov/23749301" }, { "database": "PubMed", "id": "32597660", "url": "https://pubmed.ncbi.nlm.nih.gov/32597660" }, { "database": "PubMed", "id": "33481703", "url": "https://pubmed.ncbi.nlm.nih.gov/33481703" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" } ], "site_lbl": "Ser262", "uniprot_canonical_ac": "Q12072-1" }, { "start_pos": 605, "end_pos": 605, "kinase_uniprot_canonical_ac": "P38110-1", "kinase_gene_name": "TEL1", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q12072", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q12072" }, { "database": "PubMed", "id": "20190278", "url": "https://pubmed.ncbi.nlm.nih.gov/20190278" } ], "site_lbl": "Ser605", "uniprot_canonical_ac": "Q12072-1" }, { "start_pos": 605, "end_pos": 605, "kinase_uniprot_canonical_ac": "P38111-1", "kinase_gene_name": "MEC1", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q12072", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q12072" }, { "database": "PubMed", "id": "20190278", "url": "https://pubmed.ncbi.nlm.nih.gov/20190278" } ], "site_lbl": "Ser605", "uniprot_canonical_ac": "Q12072-1" }, { "start_pos": 605, "end_pos": 605, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "SGD", "id": "S000004085", "url": "https://www.yeastgenome.org/locus/S000004085" }, { "database": "iPTMnet", "id": "Q12072", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q12072" }, { "database": "PubMed", "id": "20190278", "url": "https://pubmed.ncbi.nlm.nih.gov/20190278" }, { "database": "PubMed", "id": "32597660", "url": "https://pubmed.ncbi.nlm.nih.gov/32597660" }, { "database": "PubMed", "id": "33481703", "url": "https://pubmed.ncbi.nlm.nih.gov/33481703" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" } ], "site_lbl": "Ser605", "uniprot_canonical_ac": "Q12072-1" }, { "start_pos": 760, "end_pos": 760, "kinase_uniprot_canonical_ac": "P38110-1", "kinase_gene_name": "TEL1", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q12072", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q12072" }, { "database": "PubMed", "id": "20190278", "url": "https://pubmed.ncbi.nlm.nih.gov/20190278" } ], "site_lbl": "Ser760", "uniprot_canonical_ac": "Q12072-1" }, { "start_pos": 760, "end_pos": 760, "kinase_uniprot_canonical_ac": "P38111-1", "kinase_gene_name": "MEC1", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q12072", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q12072" }, { "database": "PubMed", "id": "20190278", "url": "https://pubmed.ncbi.nlm.nih.gov/20190278" } ], "site_lbl": "Ser760", "uniprot_canonical_ac": "Q12072-1" }, { "start_pos": 760, "end_pos": 760, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "SGD", "id": "S000004085", "url": "https://www.yeastgenome.org/locus/S000004085" }, { "database": "iPTMnet", "id": "Q12072", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q12072" }, { "database": "PubMed", "id": "20190278", "url": "https://pubmed.ncbi.nlm.nih.gov/20190278" } ], "site_lbl": "Ser760", "uniprot_canonical_ac": "Q12072-1" }, { "start_pos": 119, "end_pos": 119, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q12158", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q12158" }, { "database": "PubMed", "id": "20190278", "url": "https://pubmed.ncbi.nlm.nih.gov/20190278" }, { "database": "SGD", "id": "S000002161", "url": "https://www.yeastgenome.org/locus/S000002161" } ], "site_lbl": "Thr119", "uniprot_canonical_ac": "Q12158-1" }, { "start_pos": 307, "end_pos": 307, "kinase_uniprot_canonical_ac": "P38110-1", "kinase_gene_name": "TEL1", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q12158", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q12158" }, { "database": "PubMed", "id": "18407956", "url": "https://pubmed.ncbi.nlm.nih.gov/18407956" }, { "database": "PubMed", "id": "20190278", "url": "https://pubmed.ncbi.nlm.nih.gov/20190278" } ], "site_lbl": "Ser307", "uniprot_canonical_ac": "Q12158-1" }, { "start_pos": 307, "end_pos": 307, "kinase_uniprot_canonical_ac": "P38111-1", "kinase_gene_name": "MEC1", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q12158", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q12158" }, { "database": "PubMed", "id": "18407956", "url": "https://pubmed.ncbi.nlm.nih.gov/18407956" }, { "database": "PubMed", "id": "20190278", "url": "https://pubmed.ncbi.nlm.nih.gov/20190278" } ], "site_lbl": "Ser307", "uniprot_canonical_ac": "Q12158-1" }, { "start_pos": 307, "end_pos": 307, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "Q12158", "url": "https://www.uniprot.org/uniprotkb/Q12158" }, { "database": "PubMed", "id": "18407956", "url": "https://pubmed.ncbi.nlm.nih.gov/18407956" }, { "database": "SGD", "id": "S000002161", "url": "https://www.yeastgenome.org/locus/S000002161" }, { "database": "iPTMnet", "id": "Q12158", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q12158" }, { "database": "PubMed", "id": "20190278", "url": "https://pubmed.ncbi.nlm.nih.gov/20190278" }, { "database": "PubMed", "id": "33481703", "url": "https://pubmed.ncbi.nlm.nih.gov/33481703" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" } ], "site_lbl": "Ser307", "uniprot_canonical_ac": "Q12158-1" }, { "start_pos": 330, "end_pos": 330, "kinase_uniprot_canonical_ac": "P38110-1", "kinase_gene_name": "TEL1", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P38772", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P38772" }, { "database": "PubMed", "id": "17330950", "url": "https://pubmed.ncbi.nlm.nih.gov/17330950" }, { "database": "PubMed", "id": "20190278", "url": "https://pubmed.ncbi.nlm.nih.gov/20190278" } ], "site_lbl": "Ser330", "uniprot_canonical_ac": "P38772-1" }, { "start_pos": 330, "end_pos": 330, "kinase_uniprot_canonical_ac": "P38111-1", "kinase_gene_name": "MEC1", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P38772", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P38772" }, { "database": "PubMed", "id": "17330950", "url": "https://pubmed.ncbi.nlm.nih.gov/17330950" }, { "database": "PubMed", "id": "20190278", "url": "https://pubmed.ncbi.nlm.nih.gov/20190278" } ], "site_lbl": "Ser330", "uniprot_canonical_ac": "P38772-1" }, { "start_pos": 330, "end_pos": 330, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P38772", "url": "https://www.uniprot.org/uniprotkb/P38772" }, { "database": "PubMed", "id": "18407956", "url": "https://pubmed.ncbi.nlm.nih.gov/18407956" }, { "database": "SGD", "id": "S000001082", "url": "https://www.yeastgenome.org/locus/S000001082" }, { "database": "iPTMnet", "id": "P38772", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P38772" }, { "database": "PubMed", "id": "20190278", "url": "https://pubmed.ncbi.nlm.nih.gov/20190278" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" } ], "site_lbl": "Ser330", "uniprot_canonical_ac": "P38772-1" }, { "start_pos": 166, "end_pos": 166, "kinase_uniprot_canonical_ac": "P38110-1", "kinase_gene_name": "TEL1", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P40467", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P40467" }, { "database": "PubMed", "id": "17563356", "url": "https://pubmed.ncbi.nlm.nih.gov/17563356" }, { "database": "PubMed", "id": "18407956", "url": "https://pubmed.ncbi.nlm.nih.gov/18407956" }, { "database": "PubMed", "id": "20190278", "url": "https://pubmed.ncbi.nlm.nih.gov/20190278" } ], "site_lbl": "Ser166", "uniprot_canonical_ac": "P40467-1" }, { "start_pos": 166, "end_pos": 166, "kinase_uniprot_canonical_ac": "P38111-1", "kinase_gene_name": "MEC1", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P40467", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P40467" }, { "database": "PubMed", "id": "17563356", "url": "https://pubmed.ncbi.nlm.nih.gov/17563356" }, { "database": "PubMed", "id": "18407956", "url": "https://pubmed.ncbi.nlm.nih.gov/18407956" }, { "database": "PubMed", "id": "20190278", "url": "https://pubmed.ncbi.nlm.nih.gov/20190278" } ], "site_lbl": "Ser166", "uniprot_canonical_ac": "P40467-1" }, { "start_pos": 166, "end_pos": 166, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by ATM or ATR", "evidence": [ { "database": "UniProtKB", "id": "P40467", "url": "https://www.uniprot.org/uniprotkb/P40467" }, { "database": "SGD", "id": "S000001392", "url": "https://www.yeastgenome.org/locus/S000001392" }, { "database": "iPTMnet", "id": "P40467", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P40467" }, { "database": "PubMed", "id": "17563356", "url": "https://pubmed.ncbi.nlm.nih.gov/17563356" }, { "database": "PubMed", "id": "18407956", "url": "https://pubmed.ncbi.nlm.nih.gov/18407956" }, { "database": "PubMed", "id": "20190278", "url": "https://pubmed.ncbi.nlm.nih.gov/20190278" }, { "database": "PubMed", "id": "33481703", "url": "https://pubmed.ncbi.nlm.nih.gov/33481703" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" } ], "site_lbl": "Ser166", "uniprot_canonical_ac": "P40467-1" }, { "start_pos": 120, "end_pos": 120, "kinase_uniprot_canonical_ac": "P38110-1", "kinase_gene_name": "TEL1", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P46151", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P46151" }, { "database": "PubMed", "id": "18407956", "url": "https://pubmed.ncbi.nlm.nih.gov/18407956" }, { "database": "PubMed", "id": "20190278", "url": "https://pubmed.ncbi.nlm.nih.gov/20190278" } ], "site_lbl": "Ser120", "uniprot_canonical_ac": "P46151-1" }, { "start_pos": 120, "end_pos": 120, "kinase_uniprot_canonical_ac": "P38111-1", "kinase_gene_name": "MEC1", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P46151", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P46151" }, { "database": "PubMed", "id": "18407956", "url": "https://pubmed.ncbi.nlm.nih.gov/18407956" }, { "database": "PubMed", "id": "20190278", "url": "https://pubmed.ncbi.nlm.nih.gov/20190278" } ], "site_lbl": "Ser120", "uniprot_canonical_ac": "P46151-1" }, { "start_pos": 120, "end_pos": 120, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P46151", "url": "https://www.uniprot.org/uniprotkb/P46151" }, { "database": "PubMed", "id": "18407956", "url": "https://pubmed.ncbi.nlm.nih.gov/18407956" }, { "database": "SGD", "id": "S000005944", "url": "https://www.yeastgenome.org/locus/S000005944" }, { "database": "iPTMnet", "id": "P46151", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P46151" }, { "database": "PubMed", "id": "20190278", "url": "https://pubmed.ncbi.nlm.nih.gov/20190278" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" } ], "site_lbl": "Ser120", "uniprot_canonical_ac": "P46151-1" }, { "start_pos": 276, "end_pos": 276, "kinase_uniprot_canonical_ac": "P38110-1", "kinase_gene_name": "TEL1", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P53312", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P53312" }, { "database": "PubMed", "id": "18407956", "url": "https://pubmed.ncbi.nlm.nih.gov/18407956" }, { "database": "PubMed", "id": "20190278", "url": "https://pubmed.ncbi.nlm.nih.gov/20190278" } ], "site_lbl": "Ser276", "uniprot_canonical_ac": "P53312-1" }, { "start_pos": 276, "end_pos": 276, "kinase_uniprot_canonical_ac": "P38111-1", "kinase_gene_name": "MEC1", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P53312", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P53312" }, { "database": "PubMed", "id": "18407956", "url": "https://pubmed.ncbi.nlm.nih.gov/18407956" }, { "database": "PubMed", "id": "20190278", "url": "https://pubmed.ncbi.nlm.nih.gov/20190278" } ], "site_lbl": "Ser276", "uniprot_canonical_ac": "P53312-1" }, { "start_pos": 276, "end_pos": 276, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P53312", "url": "https://www.uniprot.org/uniprotkb/P53312" }, { "database": "PubMed", "id": "18407956", "url": "https://pubmed.ncbi.nlm.nih.gov/18407956" }, { "database": "SGD", "id": "S000003476", "url": "https://www.yeastgenome.org/locus/S000003476" }, { "database": "iPTMnet", "id": "P53312", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P53312" }, { "database": "PubMed", "id": "20190278", "url": "https://pubmed.ncbi.nlm.nih.gov/20190278" }, { "database": "PubMed", "id": "23749301", "url": "https://pubmed.ncbi.nlm.nih.gov/23749301" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" } ], "site_lbl": "Ser276", "uniprot_canonical_ac": "P53312-1" }, { "start_pos": 563, "end_pos": 563, "kinase_uniprot_canonical_ac": "P38110-1", "kinase_gene_name": "TEL1", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P54838", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P54838" }, { "database": "PubMed", "id": "18407956", "url": "https://pubmed.ncbi.nlm.nih.gov/18407956" }, { "database": "PubMed", "id": "20190278", "url": "https://pubmed.ncbi.nlm.nih.gov/20190278" } ], "site_lbl": "Ser563", "uniprot_canonical_ac": "P54838-1" }, { "start_pos": 563, "end_pos": 563, "kinase_uniprot_canonical_ac": "P38111-1", "kinase_gene_name": "MEC1", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P54838", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P54838" }, { "database": "PubMed", "id": "18407956", "url": "https://pubmed.ncbi.nlm.nih.gov/18407956" }, { "database": "PubMed", "id": "20190278", "url": "https://pubmed.ncbi.nlm.nih.gov/20190278" } ], "site_lbl": "Ser563", "uniprot_canonical_ac": "P54838-1" }, { "start_pos": 563, "end_pos": 563, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "SGD", "id": "S000004535", "url": "https://www.yeastgenome.org/locus/S000004535" }, { "database": "iPTMnet", "id": "P54838", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P54838" }, { "database": "PubMed", "id": "18407956", "url": "https://pubmed.ncbi.nlm.nih.gov/18407956" }, { "database": "PubMed", "id": "20190278", "url": "https://pubmed.ncbi.nlm.nih.gov/20190278" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" } ], "site_lbl": "Ser563", "uniprot_canonical_ac": "P54838-1" }, { "start_pos": 1166, "end_pos": 1166, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "Q03661", "url": "https://www.uniprot.org/uniprotkb/Q03661" }, { "database": "PubMed", "id": "18407956", "url": "https://pubmed.ncbi.nlm.nih.gov/18407956" }, { "database": "iPTMnet", "id": "Q03661", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q03661" }, { "database": "PubMed", "id": "20190278", "url": "https://pubmed.ncbi.nlm.nih.gov/20190278" }, { "database": "PubMed", "id": "21126336", "url": "https://pubmed.ncbi.nlm.nih.gov/21126336" }, { "database": "SGD", "id": "S000004832", "url": "https://www.yeastgenome.org/locus/S000004832" }, { "database": "PubMed", "id": "33481703", "url": "https://pubmed.ncbi.nlm.nih.gov/33481703" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" } ], "site_lbl": "Ser1166", "uniprot_canonical_ac": "Q03661-1" }, { "start_pos": 179, "end_pos": 179, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q04383", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q04383" }, { "database": "PubMed", "id": "18407956", "url": "https://pubmed.ncbi.nlm.nih.gov/18407956" }, { "database": "PubMed", "id": "20190278", "url": "https://pubmed.ncbi.nlm.nih.gov/20190278" }, { "database": "SGD", "id": "S000002909", "url": "https://www.yeastgenome.org/locus/S000002909" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" } ], "site_lbl": "Ser179", "uniprot_canonical_ac": "Q04383-1" }, { "start_pos": 281, "end_pos": 281, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "Q04383", "url": "https://www.uniprot.org/uniprotkb/Q04383" }, { "database": "PubMed", "id": "18407956", "url": "https://pubmed.ncbi.nlm.nih.gov/18407956" }, { "database": "iPTMnet", "id": "Q04383", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q04383" }, { "database": "PubMed", "id": "17287358", "url": "https://pubmed.ncbi.nlm.nih.gov/17287358" }, { "database": "PubMed", "id": "17563356", "url": "https://pubmed.ncbi.nlm.nih.gov/17563356" }, { "database": "PubMed", "id": "20190278", "url": "https://pubmed.ncbi.nlm.nih.gov/20190278" }, { "database": "SGD", "id": "S000002909", "url": "https://www.yeastgenome.org/locus/S000002909" }, { "database": "PubMed", "id": "32597660", "url": "https://pubmed.ncbi.nlm.nih.gov/32597660" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" } ], "site_lbl": "Ser281", "uniprot_canonical_ac": "Q04383-1" }, { "start_pos": 321, "end_pos": 321, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q04383", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q04383" }, { "database": "PubMed", "id": "18407956", "url": "https://pubmed.ncbi.nlm.nih.gov/18407956" }, { "database": "PubMed", "id": "20190278", "url": "https://pubmed.ncbi.nlm.nih.gov/20190278" }, { "database": "SGD", "id": "S000002909", "url": "https://www.yeastgenome.org/locus/S000002909" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" } ], "site_lbl": "Thr321", "uniprot_canonical_ac": "Q04383-1" }, { "start_pos": 11, "end_pos": 11, "kinase_uniprot_canonical_ac": "P38110-1", "kinase_gene_name": "TEL1", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q08561", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q08561" }, { "database": "PubMed", "id": "17693258", "url": "https://pubmed.ncbi.nlm.nih.gov/17693258" }, { "database": "PubMed", "id": "18407956", "url": "https://pubmed.ncbi.nlm.nih.gov/18407956" }, { "database": "PubMed", "id": "20190278", "url": "https://pubmed.ncbi.nlm.nih.gov/20190278" } ], "site_lbl": "Ser11", "uniprot_canonical_ac": "Q08561-1" }, { "start_pos": 11, "end_pos": 11, "kinase_uniprot_canonical_ac": "P38111-1", "kinase_gene_name": "MEC1", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q08561", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q08561" }, { "database": "PubMed", "id": "17693258", "url": "https://pubmed.ncbi.nlm.nih.gov/17693258" }, { "database": "PubMed", "id": "18407956", "url": "https://pubmed.ncbi.nlm.nih.gov/18407956" }, { "database": "PubMed", "id": "20190278", "url": "https://pubmed.ncbi.nlm.nih.gov/20190278" } ], "site_lbl": "Ser11", "uniprot_canonical_ac": "Q08561-1" }, { "start_pos": 11, "end_pos": 11, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "SGD", "id": "S000005715", "url": "https://www.yeastgenome.org/locus/S000005715" }, { "database": "iPTMnet", "id": "Q08561", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q08561" }, { "database": "PubMed", "id": "18407956", "url": "https://pubmed.ncbi.nlm.nih.gov/18407956" }, { "database": "PubMed", "id": "20190278", "url": "https://pubmed.ncbi.nlm.nih.gov/20190278" }, { "database": "PubMed", "id": "33481703", "url": "https://pubmed.ncbi.nlm.nih.gov/33481703" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" } ], "site_lbl": "Ser11", "uniprot_canonical_ac": "Q08561-1" }, { "start_pos": 2, "end_pos": 2, "kinase_uniprot_canonical_ac": "P38110-1", "kinase_gene_name": "TEL1", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q08561", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q08561" }, { "database": "PubMed", "id": "17693258", "url": "https://pubmed.ncbi.nlm.nih.gov/17693258" }, { "database": "PubMed", "id": "19795423", "url": "https://pubmed.ncbi.nlm.nih.gov/19795423" }, { "database": "PubMed", "id": "19823750", "url": "https://pubmed.ncbi.nlm.nih.gov/19823750" }, { "database": "PubMed", "id": "20190278", "url": "https://pubmed.ncbi.nlm.nih.gov/20190278" }, { "database": "PubMed", "id": "21126336", "url": "https://pubmed.ncbi.nlm.nih.gov/21126336" } ], "site_lbl": "Ser2", "uniprot_canonical_ac": "Q08561-1" }, { "start_pos": 2, "end_pos": 2, "kinase_uniprot_canonical_ac": "P38111-1", "kinase_gene_name": "MEC1", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q08561", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q08561" }, { "database": "PubMed", "id": "17693258", "url": "https://pubmed.ncbi.nlm.nih.gov/17693258" }, { "database": "PubMed", "id": "19795423", "url": "https://pubmed.ncbi.nlm.nih.gov/19795423" }, { "database": "PubMed", "id": "19823750", "url": "https://pubmed.ncbi.nlm.nih.gov/19823750" }, { "database": "PubMed", "id": "20190278", "url": "https://pubmed.ncbi.nlm.nih.gov/20190278" }, { "database": "PubMed", "id": "21126336", "url": "https://pubmed.ncbi.nlm.nih.gov/21126336" } ], "site_lbl": "Ser2", "uniprot_canonical_ac": "Q08561-1" }, { "start_pos": 2, "end_pos": 2, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "SGD", "id": "S000005715", "url": "https://www.yeastgenome.org/locus/S000005715" }, { "database": "iPTMnet", "id": "Q08561", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q08561" }, { "database": "PubMed", "id": "20190278", "url": "https://pubmed.ncbi.nlm.nih.gov/20190278" }, { "database": "PubMed", "id": "22218487", "url": "https://pubmed.ncbi.nlm.nih.gov/22218487" }, { "database": "PubMed", "id": "33481703", "url": "https://pubmed.ncbi.nlm.nih.gov/33481703" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" } ], "site_lbl": "Ser2", "uniprot_canonical_ac": "Q08561-1" }, { "start_pos": 5, "end_pos": 5, "kinase_uniprot_canonical_ac": "P38110-1", "kinase_gene_name": "TEL1", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q12455", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q12455" }, { "database": "PubMed", "id": "18407956", "url": "https://pubmed.ncbi.nlm.nih.gov/18407956" }, { "database": "PubMed", "id": "20190278", "url": "https://pubmed.ncbi.nlm.nih.gov/20190278" } ], "site_lbl": "Ser5", "uniprot_canonical_ac": "Q12455-1" }, { "start_pos": 5, "end_pos": 5, "kinase_uniprot_canonical_ac": "P38111-1", "kinase_gene_name": "MEC1", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q12455", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q12455" }, { "database": "PubMed", "id": "18407956", "url": "https://pubmed.ncbi.nlm.nih.gov/18407956" }, { "database": "PubMed", "id": "20190278", "url": "https://pubmed.ncbi.nlm.nih.gov/20190278" } ], "site_lbl": "Ser5", "uniprot_canonical_ac": "Q12455-1" }, { "start_pos": 5, "end_pos": 5, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "Q12455", "url": "https://www.uniprot.org/uniprotkb/Q12455" }, { "database": "PubMed", "id": "18407956", "url": "https://pubmed.ncbi.nlm.nih.gov/18407956" }, { "database": "SGD", "id": "S000004136", "url": "https://www.yeastgenome.org/locus/S000004136" }, { "database": "iPTMnet", "id": "Q12455", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q12455" }, { "database": "PubMed", "id": "20190278", "url": "https://pubmed.ncbi.nlm.nih.gov/20190278" }, { "database": "PubMed", "id": "32597660", "url": "https://pubmed.ncbi.nlm.nih.gov/32597660" }, { "database": "PubMed", "id": "33481703", "url": "https://pubmed.ncbi.nlm.nih.gov/33481703" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" } ], "site_lbl": "Ser5", "uniprot_canonical_ac": "Q12455-1" }, { "start_pos": 1231, "end_pos": 1231, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P13382", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P13382" }, { "database": "PubMed", "id": "18407956", "url": "https://pubmed.ncbi.nlm.nih.gov/18407956" }, { "database": "PubMed", "id": "20190278", "url": "https://pubmed.ncbi.nlm.nih.gov/20190278" }, { "database": "SGD", "id": "S000005046", "url": "https://www.yeastgenome.org/locus/S000005046" }, { "database": "PubMed", "id": "33481703", "url": "https://pubmed.ncbi.nlm.nih.gov/33481703" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" } ], "site_lbl": "Ser1231", "uniprot_canonical_ac": "P13382-1" }, { "start_pos": 435, "end_pos": 435, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P14737", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P14737" }, { "database": "PubMed", "id": "12049741", "url": "https://pubmed.ncbi.nlm.nih.gov/12049741" }, { "database": "PubMed", "id": "15060150", "url": "https://pubmed.ncbi.nlm.nih.gov/15060150" }, { "database": "PubMed", "id": "20190278", "url": "https://pubmed.ncbi.nlm.nih.gov/20190278" }, { "database": "SGD", "id": "S000002625", "url": "https://www.yeastgenome.org/locus/S000002625" }, { "database": "PubMed", "id": "18407956", "url": "https://pubmed.ncbi.nlm.nih.gov/18407956" } ], "site_lbl": "Ser435", "uniprot_canonical_ac": "P14737-1" }, { "start_pos": 208, "end_pos": 208, "kinase_uniprot_canonical_ac": "P38110-1", "kinase_gene_name": "TEL1", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P15992", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P15992" }, { "database": "PubMed", "id": "11875433", "url": "https://pubmed.ncbi.nlm.nih.gov/11875433" }, { "database": "PubMed", "id": "18407956", "url": "https://pubmed.ncbi.nlm.nih.gov/18407956" }, { "database": "PubMed", "id": "19684113", "url": "https://pubmed.ncbi.nlm.nih.gov/19684113" }, { "database": "PubMed", "id": "19779198", "url": "https://pubmed.ncbi.nlm.nih.gov/19779198" }, { "database": "PubMed", "id": "20190278", "url": "https://pubmed.ncbi.nlm.nih.gov/20190278" } ], "site_lbl": "Ser208", "uniprot_canonical_ac": "P15992-1" }, { "start_pos": 208, "end_pos": 208, "kinase_uniprot_canonical_ac": "P38111-1", "kinase_gene_name": "MEC1", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P15992", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P15992" }, { "database": "PubMed", "id": "11875433", "url": "https://pubmed.ncbi.nlm.nih.gov/11875433" }, { "database": "PubMed", "id": "18407956", "url": "https://pubmed.ncbi.nlm.nih.gov/18407956" }, { "database": "PubMed", "id": "19684113", "url": "https://pubmed.ncbi.nlm.nih.gov/19684113" }, { "database": "PubMed", "id": "19779198", "url": "https://pubmed.ncbi.nlm.nih.gov/19779198" }, { "database": "PubMed", "id": "20190278", "url": "https://pubmed.ncbi.nlm.nih.gov/20190278" } ], "site_lbl": "Ser208", "uniprot_canonical_ac": "P15992-1" }, { "start_pos": 208, "end_pos": 208, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P15992", "url": "https://www.uniprot.org/uniprotkb/P15992" }, { "database": "PubMed", "id": "19779198", "url": "https://pubmed.ncbi.nlm.nih.gov/19779198" }, { "database": "SGD", "id": "S000000276", "url": "https://www.yeastgenome.org/locus/S000000276" }, { "database": "iPTMnet", "id": "P15992", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P15992" }, { "database": "PubMed", "id": "11875433", "url": "https://pubmed.ncbi.nlm.nih.gov/11875433" }, { "database": "PubMed", "id": "18407956", "url": "https://pubmed.ncbi.nlm.nih.gov/18407956" }, { "database": "PubMed", "id": "20190278", "url": "https://pubmed.ncbi.nlm.nih.gov/20190278" }, { "database": "PubMed", "id": "23749301", "url": "https://pubmed.ncbi.nlm.nih.gov/23749301" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" } ], "site_lbl": "Ser208", "uniprot_canonical_ac": "P15992-1" }, { "start_pos": 211, "end_pos": 211, "kinase_uniprot_canonical_ac": "P38110-1", "kinase_gene_name": "TEL1", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P15992", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P15992" }, { "database": "PubMed", "id": "11875433", "url": "https://pubmed.ncbi.nlm.nih.gov/11875433" }, { "database": "PubMed", "id": "18407956", "url": "https://pubmed.ncbi.nlm.nih.gov/18407956" }, { "database": "PubMed", "id": "19684113", "url": "https://pubmed.ncbi.nlm.nih.gov/19684113" }, { "database": "PubMed", "id": "19779198", "url": "https://pubmed.ncbi.nlm.nih.gov/19779198" }, { "database": "PubMed", "id": "20190278", "url": "https://pubmed.ncbi.nlm.nih.gov/20190278" } ], "site_lbl": "Ser211", "uniprot_canonical_ac": "P15992-1" }, { "start_pos": 211, "end_pos": 211, "kinase_uniprot_canonical_ac": "P38111-1", "kinase_gene_name": "MEC1", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P15992", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P15992" }, { "database": "PubMed", "id": "11875433", "url": "https://pubmed.ncbi.nlm.nih.gov/11875433" }, { "database": "PubMed", "id": "18407956", "url": "https://pubmed.ncbi.nlm.nih.gov/18407956" }, { "database": "PubMed", "id": "19684113", "url": "https://pubmed.ncbi.nlm.nih.gov/19684113" }, { "database": "PubMed", "id": "19779198", "url": "https://pubmed.ncbi.nlm.nih.gov/19779198" }, { "database": "PubMed", "id": "20190278", "url": "https://pubmed.ncbi.nlm.nih.gov/20190278" } ], "site_lbl": "Ser211", "uniprot_canonical_ac": "P15992-1" }, { "start_pos": 211, "end_pos": 211, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P15992", "url": "https://www.uniprot.org/uniprotkb/P15992" }, { "database": "PubMed", "id": "19779198", "url": "https://pubmed.ncbi.nlm.nih.gov/19779198" }, { "database": "SGD", "id": "S000000276", "url": "https://www.yeastgenome.org/locus/S000000276" }, { "database": "iPTMnet", "id": "P15992", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P15992" }, { "database": "PubMed", "id": "11875433", "url": "https://pubmed.ncbi.nlm.nih.gov/11875433" }, { "database": "PubMed", "id": "18407956", "url": "https://pubmed.ncbi.nlm.nih.gov/18407956" }, { "database": "PubMed", "id": "20190278", "url": "https://pubmed.ncbi.nlm.nih.gov/20190278" }, { "database": "PubMed", "id": "23749301", "url": "https://pubmed.ncbi.nlm.nih.gov/23749301" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" } ], "site_lbl": "Ser211", "uniprot_canonical_ac": "P15992-1" }, { "start_pos": 3, "end_pos": 3, "kinase_uniprot_canonical_ac": "P38110-1", "kinase_gene_name": "TEL1", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P16861", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P16861" }, { "database": "PubMed", "id": "18407956", "url": "https://pubmed.ncbi.nlm.nih.gov/18407956" }, { "database": "PubMed", "id": "20190278", "url": "https://pubmed.ncbi.nlm.nih.gov/20190278" }, { "database": "PubMed", "id": "21126336", "url": "https://pubmed.ncbi.nlm.nih.gov/21126336" } ], "site_lbl": "Ser3", "uniprot_canonical_ac": "P16861-1" }, { "start_pos": 3, "end_pos": 3, "kinase_uniprot_canonical_ac": "P38111-1", "kinase_gene_name": "MEC1", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P16861", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P16861" }, { "database": "PubMed", "id": "18407956", "url": "https://pubmed.ncbi.nlm.nih.gov/18407956" }, { "database": "PubMed", "id": "20190278", "url": "https://pubmed.ncbi.nlm.nih.gov/20190278" }, { "database": "PubMed", "id": "21126336", "url": "https://pubmed.ncbi.nlm.nih.gov/21126336" } ], "site_lbl": "Ser3", "uniprot_canonical_ac": "P16861-1" }, { "start_pos": 3, "end_pos": 3, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P16861", "url": "https://www.uniprot.org/uniprotkb/P16861" }, { "database": "PubMed", "id": "18407956", "url": "https://pubmed.ncbi.nlm.nih.gov/18407956" }, { "database": "SGD", "id": "S000003472", "url": "https://www.yeastgenome.org/locus/S000003472" }, { "database": "iPTMnet", "id": "P16861", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P16861" }, { "database": "PubMed", "id": "20190278", "url": "https://pubmed.ncbi.nlm.nih.gov/20190278" }, { "database": "PubMed", "id": "23749301", "url": "https://pubmed.ncbi.nlm.nih.gov/23749301" }, { "database": "PubMed", "id": "33481703", "url": "https://pubmed.ncbi.nlm.nih.gov/33481703" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" } ], "site_lbl": "Ser3", "uniprot_canonical_ac": "P16861-1" }, { "start_pos": 45, "end_pos": 45, "kinase_uniprot_canonical_ac": "P38110-1", "kinase_gene_name": "TEL1", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P17106", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P17106" }, { "database": "PubMed", "id": "17563356", "url": "https://pubmed.ncbi.nlm.nih.gov/17563356" }, { "database": "PubMed", "id": "18407956", "url": "https://pubmed.ncbi.nlm.nih.gov/18407956" }, { "database": "PubMed", "id": "19684113", "url": "https://pubmed.ncbi.nlm.nih.gov/19684113" }, { "database": "PubMed", "id": "19779198", "url": "https://pubmed.ncbi.nlm.nih.gov/19779198" }, { "database": "PubMed", "id": "19795423", "url": "https://pubmed.ncbi.nlm.nih.gov/19795423" }, { "database": "PubMed", "id": "19823750", "url": "https://pubmed.ncbi.nlm.nih.gov/19823750" }, { "database": "PubMed", "id": "20190278", "url": "https://pubmed.ncbi.nlm.nih.gov/20190278" } ], "site_lbl": "Ser45", "uniprot_canonical_ac": "P17106-1" }, { "start_pos": 45, "end_pos": 45, "kinase_uniprot_canonical_ac": "P38111-1", "kinase_gene_name": "MEC1", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P17106", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P17106" }, { "database": "PubMed", "id": "17563356", "url": "https://pubmed.ncbi.nlm.nih.gov/17563356" }, { "database": "PubMed", "id": "18407956", "url": "https://pubmed.ncbi.nlm.nih.gov/18407956" }, { "database": "PubMed", "id": "19684113", "url": "https://pubmed.ncbi.nlm.nih.gov/19684113" }, { "database": "PubMed", "id": "19779198", "url": "https://pubmed.ncbi.nlm.nih.gov/19779198" }, { "database": "PubMed", "id": "19795423", "url": "https://pubmed.ncbi.nlm.nih.gov/19795423" }, { "database": "PubMed", "id": "19823750", "url": "https://pubmed.ncbi.nlm.nih.gov/19823750" }, { "database": "PubMed", "id": "20190278", "url": "https://pubmed.ncbi.nlm.nih.gov/20190278" } ], "site_lbl": "Ser45", "uniprot_canonical_ac": "P17106-1" }, { "start_pos": 45, "end_pos": 45, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by ATM or ATR", "evidence": [ { "database": "UniProtKB", "id": "P17106", "url": "https://www.uniprot.org/uniprotkb/P17106" }, { "database": "SGD", "id": "S000003821", "url": "https://www.yeastgenome.org/locus/S000003821" }, { "database": "iPTMnet", "id": "P17106", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P17106" }, { "database": "PubMed", "id": "17563356", "url": "https://pubmed.ncbi.nlm.nih.gov/17563356" }, { "database": "PubMed", "id": "18407956", "url": "https://pubmed.ncbi.nlm.nih.gov/18407956" }, { "database": "PubMed", "id": "19779198", "url": "https://pubmed.ncbi.nlm.nih.gov/19779198" }, { "database": "PubMed", "id": "20190278", "url": "https://pubmed.ncbi.nlm.nih.gov/20190278" }, { "database": "PubMed", "id": "23749301", "url": "https://pubmed.ncbi.nlm.nih.gov/23749301" }, { "database": "PubMed", "id": "30516470", "url": "https://pubmed.ncbi.nlm.nih.gov/30516470" }, { "database": "PubMed", "id": "33481703", "url": "https://pubmed.ncbi.nlm.nih.gov/33481703" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" } ], "site_lbl": "Ser45", "uniprot_canonical_ac": "P17106-1" }, { "start_pos": 48, "end_pos": 48, "kinase_uniprot_canonical_ac": "P38110-1", "kinase_gene_name": "TEL1", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P17106", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P17106" }, { "database": "PubMed", "id": "17563356", "url": "https://pubmed.ncbi.nlm.nih.gov/17563356" }, { "database": "PubMed", "id": "18407956", "url": "https://pubmed.ncbi.nlm.nih.gov/18407956" }, { "database": "PubMed", "id": "19684113", "url": "https://pubmed.ncbi.nlm.nih.gov/19684113" }, { "database": "PubMed", "id": "19779198", "url": "https://pubmed.ncbi.nlm.nih.gov/19779198" }, { "database": "PubMed", "id": "19795423", "url": "https://pubmed.ncbi.nlm.nih.gov/19795423" }, { "database": "PubMed", "id": "19823750", "url": "https://pubmed.ncbi.nlm.nih.gov/19823750" }, { "database": "PubMed", "id": "20190278", "url": "https://pubmed.ncbi.nlm.nih.gov/20190278" }, { "database": "PubMed", "id": "21177495", "url": "https://pubmed.ncbi.nlm.nih.gov/21177495" } ], "site_lbl": "Ser48", "uniprot_canonical_ac": "P17106-1" }, { "start_pos": 48, "end_pos": 48, "kinase_uniprot_canonical_ac": "P38111-1", "kinase_gene_name": "MEC1", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P17106", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P17106" }, { "database": "PubMed", "id": "17563356", "url": "https://pubmed.ncbi.nlm.nih.gov/17563356" }, { "database": "PubMed", "id": "18407956", "url": "https://pubmed.ncbi.nlm.nih.gov/18407956" }, { "database": "PubMed", "id": "19684113", "url": "https://pubmed.ncbi.nlm.nih.gov/19684113" }, { "database": "PubMed", "id": "19779198", "url": "https://pubmed.ncbi.nlm.nih.gov/19779198" }, { "database": "PubMed", "id": "19795423", "url": "https://pubmed.ncbi.nlm.nih.gov/19795423" }, { "database": "PubMed", "id": "19823750", "url": "https://pubmed.ncbi.nlm.nih.gov/19823750" }, { "database": "PubMed", "id": "20190278", "url": "https://pubmed.ncbi.nlm.nih.gov/20190278" }, { "database": "PubMed", "id": "21177495", "url": "https://pubmed.ncbi.nlm.nih.gov/21177495" } ], "site_lbl": "Ser48", "uniprot_canonical_ac": "P17106-1" }, { "start_pos": 48, "end_pos": 48, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P17106", "url": "https://www.uniprot.org/uniprotkb/P17106" }, { "database": "PubMed", "id": "18407956", "url": "https://pubmed.ncbi.nlm.nih.gov/18407956" }, { "database": "PubMed", "id": "19779198", "url": "https://pubmed.ncbi.nlm.nih.gov/19779198" }, { "database": "SGD", "id": "S000003821", "url": "https://www.yeastgenome.org/locus/S000003821" }, { "database": "iPTMnet", "id": "P17106", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P17106" }, { "database": "PubMed", "id": "17563356", "url": "https://pubmed.ncbi.nlm.nih.gov/17563356" }, { "database": "PubMed", "id": "20190278", "url": "https://pubmed.ncbi.nlm.nih.gov/20190278" }, { "database": "PubMed", "id": "23749301", "url": "https://pubmed.ncbi.nlm.nih.gov/23749301" }, { "database": "PubMed", "id": "24909858", "url": "https://pubmed.ncbi.nlm.nih.gov/24909858" }, { "database": "PubMed", "id": "30516470", "url": "https://pubmed.ncbi.nlm.nih.gov/30516470" }, { "database": "PubMed", "id": "33481703", "url": "https://pubmed.ncbi.nlm.nih.gov/33481703" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" } ], "site_lbl": "Ser48", "uniprot_canonical_ac": "P17106-1" }, { "start_pos": 956, "end_pos": 956, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P17442", "url": "https://www.uniprot.org/uniprotkb/P17442" }, { "database": "PubMed", "id": "18407956", "url": "https://pubmed.ncbi.nlm.nih.gov/18407956" }, { "database": "iPTMnet", "id": "P17442", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P17442" }, { "database": "PubMed", "id": "20190278", "url": "https://pubmed.ncbi.nlm.nih.gov/20190278" }, { "database": "SGD", "id": "S000003465", "url": "https://www.yeastgenome.org/locus/S000003465" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" } ], "site_lbl": "Ser956", "uniprot_canonical_ac": "P17442-1" }, { "start_pos": 675, "end_pos": 675, "kinase_uniprot_canonical_ac": "P38110-1", "kinase_gene_name": "TEL1", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P17629", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P17629" }, { "database": "PubMed", "id": "17563356", "url": "https://pubmed.ncbi.nlm.nih.gov/17563356" }, { "database": "PubMed", "id": "18407956", "url": "https://pubmed.ncbi.nlm.nih.gov/18407956" }, { "database": "PubMed", "id": "19795423", "url": "https://pubmed.ncbi.nlm.nih.gov/19795423" }, { "database": "PubMed", "id": "19823750", "url": "https://pubmed.ncbi.nlm.nih.gov/19823750" }, { "database": "PubMed", "id": "20190278", "url": "https://pubmed.ncbi.nlm.nih.gov/20190278" } ], "site_lbl": "Ser675", "uniprot_canonical_ac": "P17629-1" }, { "start_pos": 675, "end_pos": 675, "kinase_uniprot_canonical_ac": "P38111-1", "kinase_gene_name": "MEC1", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P17629", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P17629" }, { "database": "PubMed", "id": "17563356", "url": "https://pubmed.ncbi.nlm.nih.gov/17563356" }, { "database": "PubMed", "id": "18407956", "url": "https://pubmed.ncbi.nlm.nih.gov/18407956" }, { "database": "PubMed", "id": "19795423", "url": "https://pubmed.ncbi.nlm.nih.gov/19795423" }, { "database": "PubMed", "id": "19823750", "url": "https://pubmed.ncbi.nlm.nih.gov/19823750" }, { "database": "PubMed", "id": "20190278", "url": "https://pubmed.ncbi.nlm.nih.gov/20190278" } ], "site_lbl": "Ser675", "uniprot_canonical_ac": "P17629-1" }, { "start_pos": 675, "end_pos": 675, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "SGD", "id": "S000002545", "url": "https://www.yeastgenome.org/locus/S000002545" }, { "database": "iPTMnet", "id": "P17629", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P17629" }, { "database": "PubMed", "id": "17563356", "url": "https://pubmed.ncbi.nlm.nih.gov/17563356" }, { "database": "PubMed", "id": "18407956", "url": "https://pubmed.ncbi.nlm.nih.gov/18407956" }, { "database": "PubMed", "id": "20190278", "url": "https://pubmed.ncbi.nlm.nih.gov/20190278" }, { "database": "PubMed", "id": "23749301", "url": "https://pubmed.ncbi.nlm.nih.gov/23749301" }, { "database": "PubMed", "id": "33481703", "url": "https://pubmed.ncbi.nlm.nih.gov/33481703" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" } ], "site_lbl": "Ser675", "uniprot_canonical_ac": "P17629-1" }, { "start_pos": 656, "end_pos": 656, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P20676", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P20676" }, { "database": "PubMed", "id": "17563356", "url": "https://pubmed.ncbi.nlm.nih.gov/17563356" }, { "database": "PubMed", "id": "18407956", "url": "https://pubmed.ncbi.nlm.nih.gov/18407956" }, { "database": "PubMed", "id": "20190278", "url": "https://pubmed.ncbi.nlm.nih.gov/20190278" }, { "database": "SGD", "id": "S000005624", "url": "https://www.yeastgenome.org/locus/S000005624" }, { "database": "PubMed", "id": "32597660", "url": "https://pubmed.ncbi.nlm.nih.gov/32597660" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" } ], "site_lbl": "Ser656", "uniprot_canonical_ac": "P20676-1" }, { "start_pos": 806, "end_pos": 806, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P21672", "url": "https://www.uniprot.org/uniprotkb/P21672" }, { "database": "PubMed", "id": "18407956", "url": "https://pubmed.ncbi.nlm.nih.gov/18407956" }, { "database": "iPTMnet", "id": "P21672", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P21672" }, { "database": "PubMed", "id": "17563356", "url": "https://pubmed.ncbi.nlm.nih.gov/17563356" }, { "database": "PubMed", "id": "20190278", "url": "https://pubmed.ncbi.nlm.nih.gov/20190278" }, { "database": "SGD", "id": "S000001328", "url": "https://www.yeastgenome.org/locus/S000001328" }, { "database": "PubMed", "id": "23749301", "url": "https://pubmed.ncbi.nlm.nih.gov/23749301" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" } ], "site_lbl": "Ser806", "uniprot_canonical_ac": "P21672-1" }, { "start_pos": 485, "end_pos": 485, "kinase_uniprot_canonical_ac": "P38110-1", "kinase_gene_name": "TEL1", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P22216", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P22216" }, { "database": "PubMed", "id": "16085488", "url": "https://pubmed.ncbi.nlm.nih.gov/16085488" }, { "database": "PubMed", "id": "20190278", "url": "https://pubmed.ncbi.nlm.nih.gov/20190278" } ], "site_lbl": "Ser485", "uniprot_canonical_ac": "P22216-1" }, { "start_pos": 485, "end_pos": 485, "kinase_uniprot_canonical_ac": "P38111-1", "kinase_gene_name": "MEC1", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P22216", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P22216" }, { "database": "PubMed", "id": "16085488", "url": "https://pubmed.ncbi.nlm.nih.gov/16085488" }, { "database": "PubMed", "id": "20190278", "url": "https://pubmed.ncbi.nlm.nih.gov/20190278" } ], "site_lbl": "Ser485", "uniprot_canonical_ac": "P22216-1" }, { "start_pos": 485, "end_pos": 485, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "SGD", "id": "S000006074", "url": "https://www.yeastgenome.org/locus/S000006074" }, { "database": "iPTMnet", "id": "P22216", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P22216" }, { "database": "PubMed", "id": "20190278", "url": "https://pubmed.ncbi.nlm.nih.gov/20190278" }, { "database": "PubMed", "id": "24302356", "url": "https://pubmed.ncbi.nlm.nih.gov/24302356" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" } ], "site_lbl": "Ser485", "uniprot_canonical_ac": "P22216-1" }, { "start_pos": 489, "end_pos": 489, "kinase_uniprot_canonical_ac": "P38110-1", "kinase_gene_name": "TEL1", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P22216", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P22216" }, { "database": "PubMed", "id": "15972895", "url": "https://pubmed.ncbi.nlm.nih.gov/15972895" }, { "database": "PubMed", "id": "16085488", "url": "https://pubmed.ncbi.nlm.nih.gov/16085488" }, { "database": "PubMed", "id": "20190278", "url": "https://pubmed.ncbi.nlm.nih.gov/20190278" } ], "site_lbl": "Ser489", "uniprot_canonical_ac": "P22216-1" }, { "start_pos": 489, "end_pos": 489, "kinase_uniprot_canonical_ac": "P38111-1", "kinase_gene_name": "MEC1", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P22216", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P22216" }, { "database": "PubMed", "id": "15972895", "url": "https://pubmed.ncbi.nlm.nih.gov/15972895" }, { "database": "PubMed", "id": "16085488", "url": "https://pubmed.ncbi.nlm.nih.gov/16085488" }, { "database": "PubMed", "id": "20190278", "url": "https://pubmed.ncbi.nlm.nih.gov/20190278" } ], "site_lbl": "Ser489", "uniprot_canonical_ac": "P22216-1" }, { "start_pos": 489, "end_pos": 489, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "SGD", "id": "S000006074", "url": "https://www.yeastgenome.org/locus/S000006074" }, { "database": "iPTMnet", "id": "P22216", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P22216" }, { "database": "PubMed", "id": "20190278", "url": "https://pubmed.ncbi.nlm.nih.gov/20190278" }, { "database": "PubMed", "id": "24302356", "url": "https://pubmed.ncbi.nlm.nih.gov/24302356" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" } ], "site_lbl": "Ser489", "uniprot_canonical_ac": "P22216-1" }, { "start_pos": 178, "end_pos": 178, "kinase_uniprot_canonical_ac": "P38110-1", "kinase_gene_name": "TEL1", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P22336", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P22336" }, { "database": "PubMed", "id": "14642562", "url": "https://pubmed.ncbi.nlm.nih.gov/14642562" }, { "database": "PubMed", "id": "17563356", "url": "https://pubmed.ncbi.nlm.nih.gov/17563356" }, { "database": "PubMed", "id": "18407956", "url": "https://pubmed.ncbi.nlm.nih.gov/18407956" }, { "database": "PubMed", "id": "19684113", "url": "https://pubmed.ncbi.nlm.nih.gov/19684113" }, { "database": "PubMed", "id": "19779198", "url": "https://pubmed.ncbi.nlm.nih.gov/19779198" }, { "database": "PubMed", "id": "19795423", "url": "https://pubmed.ncbi.nlm.nih.gov/19795423" }, { "database": "PubMed", "id": "19823750", "url": "https://pubmed.ncbi.nlm.nih.gov/19823750" }, { "database": "PubMed", "id": "20190278", "url": "https://pubmed.ncbi.nlm.nih.gov/20190278" }, { "database": "PubMed", "id": "20702584", "url": "https://pubmed.ncbi.nlm.nih.gov/20702584" }, { "database": "PubMed", "id": "21177495", "url": "https://pubmed.ncbi.nlm.nih.gov/21177495" } ], "site_lbl": "Ser178", "uniprot_canonical_ac": "P22336-1" }, { "start_pos": 178, "end_pos": 178, "kinase_uniprot_canonical_ac": "P38111-1", "kinase_gene_name": "MEC1", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P22336", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P22336" }, { "database": "PubMed", "id": "14642562", "url": "https://pubmed.ncbi.nlm.nih.gov/14642562" }, { "database": "PubMed", "id": "17563356", "url": "https://pubmed.ncbi.nlm.nih.gov/17563356" }, { "database": "PubMed", "id": "18407956", "url": "https://pubmed.ncbi.nlm.nih.gov/18407956" }, { "database": "PubMed", "id": "19684113", "url": "https://pubmed.ncbi.nlm.nih.gov/19684113" }, { "database": "PubMed", "id": "19779198", "url": "https://pubmed.ncbi.nlm.nih.gov/19779198" }, { "database": "PubMed", "id": "19795423", "url": "https://pubmed.ncbi.nlm.nih.gov/19795423" }, { "database": "PubMed", "id": "19823750", "url": "https://pubmed.ncbi.nlm.nih.gov/19823750" }, { "database": "PubMed", "id": "20190278", "url": "https://pubmed.ncbi.nlm.nih.gov/20190278" }, { "database": "PubMed", "id": "20702584", "url": "https://pubmed.ncbi.nlm.nih.gov/20702584" }, { "database": "PubMed", "id": "21177495", "url": "https://pubmed.ncbi.nlm.nih.gov/21177495" } ], "site_lbl": "Ser178", "uniprot_canonical_ac": "P22336-1" }, { "start_pos": 178, "end_pos": 178, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by ATM or ATR", "evidence": [ { "database": "UniProtKB", "id": "P22336", "url": "https://www.uniprot.org/uniprotkb/P22336" }, { "database": "SGD", "id": "S000000065", "url": "https://www.yeastgenome.org/locus/S000000065" }, { "database": "iPTMnet", "id": "P22336", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P22336" }, { "database": "PubMed", "id": "17563356", "url": "https://pubmed.ncbi.nlm.nih.gov/17563356" }, { "database": "PubMed", "id": "18407956", "url": "https://pubmed.ncbi.nlm.nih.gov/18407956" }, { "database": "PubMed", "id": "19779198", "url": "https://pubmed.ncbi.nlm.nih.gov/19779198" }, { "database": "PubMed", "id": "20190278", "url": "https://pubmed.ncbi.nlm.nih.gov/20190278" }, { "database": "PubMed", "id": "20702584", "url": "https://pubmed.ncbi.nlm.nih.gov/20702584" }, { "database": "PubMed", "id": "23749301", "url": "https://pubmed.ncbi.nlm.nih.gov/23749301" }, { "database": "PubMed", "id": "30516470", "url": "https://pubmed.ncbi.nlm.nih.gov/30516470" }, { "database": "PubMed", "id": "32597660", "url": "https://pubmed.ncbi.nlm.nih.gov/32597660" }, { "database": "PubMed", "id": "33481703", "url": "https://pubmed.ncbi.nlm.nih.gov/33481703" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" } ], "site_lbl": "Ser178", "uniprot_canonical_ac": "P22336-1" }, { "start_pos": 1126, "end_pos": 1126, "kinase_uniprot_canonical_ac": "P38110-1", "kinase_gene_name": "TEL1", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P22579", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P22579" }, { "database": "PubMed", "id": "20190278", "url": "https://pubmed.ncbi.nlm.nih.gov/20190278" } ], "site_lbl": "Ser1126", "uniprot_canonical_ac": "P22579-1" }, { "start_pos": 1126, "end_pos": 1126, "kinase_uniprot_canonical_ac": "P38111-1", "kinase_gene_name": "MEC1", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P22579", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P22579" }, { "database": "PubMed", "id": "20190278", "url": "https://pubmed.ncbi.nlm.nih.gov/20190278" } ], "site_lbl": "Ser1126", "uniprot_canonical_ac": "P22579-1" }, { "start_pos": 1126, "end_pos": 1126, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "SGD", "id": "S000005364", "url": "https://www.yeastgenome.org/locus/S000005364" }, { "database": "iPTMnet", "id": "P22579", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P22579" }, { "database": "PubMed", "id": "20190278", "url": "https://pubmed.ncbi.nlm.nih.gov/20190278" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" } ], "site_lbl": "Ser1126", "uniprot_canonical_ac": "P22579-1" }, { "start_pos": 21, "end_pos": 21, "kinase_uniprot_canonical_ac": "P38110-1", "kinase_gene_name": "TEL1", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P22943", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P22943" }, { "database": "PubMed", "id": "17287358", "url": "https://pubmed.ncbi.nlm.nih.gov/17287358" }, { "database": "PubMed", "id": "17563356", "url": "https://pubmed.ncbi.nlm.nih.gov/17563356" }, { "database": "PubMed", "id": "18407956", "url": "https://pubmed.ncbi.nlm.nih.gov/18407956" }, { "database": "PubMed", "id": "19779198", "url": "https://pubmed.ncbi.nlm.nih.gov/19779198" }, { "database": "PubMed", "id": "19795423", "url": "https://pubmed.ncbi.nlm.nih.gov/19795423" }, { "database": "PubMed", "id": "19823750", "url": "https://pubmed.ncbi.nlm.nih.gov/19823750" }, { "database": "PubMed", "id": "20190278", "url": "https://pubmed.ncbi.nlm.nih.gov/20190278" }, { "database": "PubMed", "id": "21177495", "url": "https://pubmed.ncbi.nlm.nih.gov/21177495" } ], "site_lbl": "Ser21", "uniprot_canonical_ac": "P22943-1" }, { "start_pos": 21, "end_pos": 21, "kinase_uniprot_canonical_ac": "P38111-1", "kinase_gene_name": "MEC1", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P22943", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P22943" }, { "database": "PubMed", "id": "17287358", "url": "https://pubmed.ncbi.nlm.nih.gov/17287358" }, { "database": "PubMed", "id": "17563356", "url": "https://pubmed.ncbi.nlm.nih.gov/17563356" }, { "database": "PubMed", "id": "18407956", "url": "https://pubmed.ncbi.nlm.nih.gov/18407956" }, { "database": "PubMed", "id": "19779198", "url": "https://pubmed.ncbi.nlm.nih.gov/19779198" }, { "database": "PubMed", "id": "19795423", "url": "https://pubmed.ncbi.nlm.nih.gov/19795423" }, { "database": "PubMed", "id": "19823750", "url": "https://pubmed.ncbi.nlm.nih.gov/19823750" }, { "database": "PubMed", "id": "20190278", "url": "https://pubmed.ncbi.nlm.nih.gov/20190278" }, { "database": "PubMed", "id": "21177495", "url": "https://pubmed.ncbi.nlm.nih.gov/21177495" } ], "site_lbl": "Ser21", "uniprot_canonical_ac": "P22943-1" }, { "start_pos": 21, "end_pos": 21, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by ATM or ATR", "evidence": [ { "database": "UniProtKB", "id": "P22943", "url": "https://www.uniprot.org/uniprotkb/P22943" }, { "database": "SGD", "id": "S000001880", "url": "https://www.yeastgenome.org/locus/S000001880" }, { "database": "iPTMnet", "id": "P22943", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P22943" }, { "database": "PubMed", "id": "17563356", "url": "https://pubmed.ncbi.nlm.nih.gov/17563356" }, { "database": "PubMed", "id": "18407956", "url": "https://pubmed.ncbi.nlm.nih.gov/18407956" }, { "database": "PubMed", "id": "19779198", "url": "https://pubmed.ncbi.nlm.nih.gov/19779198" }, { "database": "PubMed", "id": "20190278", "url": "https://pubmed.ncbi.nlm.nih.gov/20190278" }, { "database": "PubMed", "id": "22218487", "url": "https://pubmed.ncbi.nlm.nih.gov/22218487" }, { "database": "PubMed", "id": "23749301", "url": "https://pubmed.ncbi.nlm.nih.gov/23749301" }, { "database": "PubMed", "id": "33481703", "url": "https://pubmed.ncbi.nlm.nih.gov/33481703" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" }, { "database": "PubMed", "id": "17287358", "url": "https://pubmed.ncbi.nlm.nih.gov/17287358" } ], "site_lbl": "Ser21", "uniprot_canonical_ac": "P22943-1" }, { "start_pos": 121, "end_pos": 121, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P25588", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P25588" }, { "database": "PubMed", "id": "18407956", "url": "https://pubmed.ncbi.nlm.nih.gov/18407956" }, { "database": "PubMed", "id": "20190278", "url": "https://pubmed.ncbi.nlm.nih.gov/20190278" }, { "database": "SGD", "id": "S000000566", "url": "https://www.yeastgenome.org/locus/S000000566" }, { "database": "PubMed", "id": "23749301", "url": "https://pubmed.ncbi.nlm.nih.gov/23749301" }, { "database": "PubMed", "id": "33481703", "url": "https://pubmed.ncbi.nlm.nih.gov/33481703" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" } ], "site_lbl": "Ser121", "uniprot_canonical_ac": "P25588-1" }, { "start_pos": 189, "end_pos": 189, "kinase_uniprot_canonical_ac": "P38110-1", "kinase_gene_name": "TEL1", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P25588", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P25588" }, { "database": "PubMed", "id": "12865299", "url": "https://pubmed.ncbi.nlm.nih.gov/12865299" }, { "database": "PubMed", "id": "19515819", "url": "https://pubmed.ncbi.nlm.nih.gov/19515819" }, { "database": "PubMed", "id": "20190278", "url": "https://pubmed.ncbi.nlm.nih.gov/20190278" } ], "site_lbl": "Ser189", "uniprot_canonical_ac": "P25588-1" }, { "start_pos": 189, "end_pos": 189, "kinase_uniprot_canonical_ac": "P38111-1", "kinase_gene_name": "MEC1", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P25588", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P25588" }, { "database": "PubMed", "id": "12865299", "url": "https://pubmed.ncbi.nlm.nih.gov/12865299" }, { "database": "PubMed", "id": "19515819", "url": "https://pubmed.ncbi.nlm.nih.gov/19515819" }, { "database": "PubMed", "id": "20190278", "url": "https://pubmed.ncbi.nlm.nih.gov/20190278" } ], "site_lbl": "Ser189", "uniprot_canonical_ac": "P25588-1" }, { "start_pos": 189, "end_pos": 189, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "SGD", "id": "S000000566", "url": "https://www.yeastgenome.org/locus/S000000566" }, { "database": "iPTMnet", "id": "P25588", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P25588" }, { "database": "PubMed", "id": "20190278", "url": "https://pubmed.ncbi.nlm.nih.gov/20190278" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" } ], "site_lbl": "Ser189", "uniprot_canonical_ac": "P25588-1" }, { "start_pos": 664, "end_pos": 664, "kinase_uniprot_canonical_ac": "P38110-1", "kinase_gene_name": "TEL1", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P25635", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P25635" }, { "database": "PubMed", "id": "18407956", "url": "https://pubmed.ncbi.nlm.nih.gov/18407956" }, { "database": "PubMed", "id": "19779198", "url": "https://pubmed.ncbi.nlm.nih.gov/19779198" }, { "database": "PubMed", "id": "20190278", "url": "https://pubmed.ncbi.nlm.nih.gov/20190278" } ], "site_lbl": "Ser664", "uniprot_canonical_ac": "P25635-1" }, { "start_pos": 664, "end_pos": 664, "kinase_uniprot_canonical_ac": "P38111-1", "kinase_gene_name": "MEC1", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P25635", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P25635" }, { "database": "PubMed", "id": "18407956", "url": "https://pubmed.ncbi.nlm.nih.gov/18407956" }, { "database": "PubMed", "id": "19779198", "url": "https://pubmed.ncbi.nlm.nih.gov/19779198" }, { "database": "PubMed", "id": "20190278", "url": "https://pubmed.ncbi.nlm.nih.gov/20190278" } ], "site_lbl": "Ser664", "uniprot_canonical_ac": "P25635-1" }, { "start_pos": 122, "end_pos": 122, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P26754", "url": "https://www.uniprot.org/uniprotkb/P26754" }, { "database": "PubMed", "id": "17287358", "url": "https://pubmed.ncbi.nlm.nih.gov/17287358" }, { "database": "PubMed", "id": "15665377", "url": "https://pubmed.ncbi.nlm.nih.gov/15665377" }, { "database": "PubMed", "id": "18407956", "url": "https://pubmed.ncbi.nlm.nih.gov/18407956" }, { "database": "iPTMnet", "id": "P26754", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P26754" }, { "database": "PubMed", "id": "16118184", "url": "https://pubmed.ncbi.nlm.nih.gov/16118184" }, { "database": "PubMed", "id": "17330950", "url": "https://pubmed.ncbi.nlm.nih.gov/17330950" }, { "database": "PubMed", "id": "19779198", "url": "https://pubmed.ncbi.nlm.nih.gov/19779198" }, { "database": "PubMed", "id": "19795423", "url": "https://pubmed.ncbi.nlm.nih.gov/19795423" }, { "database": "PubMed", "id": "19823750", "url": "https://pubmed.ncbi.nlm.nih.gov/19823750" }, { "database": "PubMed", "id": "20190278", "url": "https://pubmed.ncbi.nlm.nih.gov/20190278" }, { "database": "PubMed", "id": "20702584", "url": "https://pubmed.ncbi.nlm.nih.gov/20702584" }, { "database": "PubMed", "id": "21126336", "url": "https://pubmed.ncbi.nlm.nih.gov/21126336" }, { "database": "PubMed", "id": "25595672", "url": "https://pubmed.ncbi.nlm.nih.gov/25595672" }, { "database": "SGD", "id": "S000005256", "url": "https://www.yeastgenome.org/locus/S000005256" }, { "database": "PubMed", "id": "22218487", "url": "https://pubmed.ncbi.nlm.nih.gov/22218487" }, { "database": "PubMed", "id": "23749301", "url": "https://pubmed.ncbi.nlm.nih.gov/23749301" }, { "database": "PubMed", "id": "32597660", "url": "https://pubmed.ncbi.nlm.nih.gov/32597660" }, { "database": "PubMed", "id": "33481703", "url": "https://pubmed.ncbi.nlm.nih.gov/33481703" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" } ], "site_lbl": "Ser122", "uniprot_canonical_ac": "P26754-1" }, { "start_pos": 34, "end_pos": 34, "kinase_uniprot_canonical_ac": "P38110-1", "kinase_gene_name": "TEL1", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P26755", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P26755" }, { "database": "PubMed", "id": "20190278", "url": "https://pubmed.ncbi.nlm.nih.gov/20190278" } ], "site_lbl": "Ser34", "uniprot_canonical_ac": "P26755-1" }, { "start_pos": 34, "end_pos": 34, "kinase_uniprot_canonical_ac": "P38111-1", "kinase_gene_name": "MEC1", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P26755", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P26755" }, { "database": "PubMed", "id": "20190278", "url": "https://pubmed.ncbi.nlm.nih.gov/20190278" } ], "site_lbl": "Ser34", "uniprot_canonical_ac": "P26755-1" }, { "start_pos": 34, "end_pos": 34, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "SGD", "id": "S000003709", "url": "https://www.yeastgenome.org/locus/S000003709" }, { "database": "iPTMnet", "id": "P26755", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P26755" }, { "database": "PubMed", "id": "20190278", "url": "https://pubmed.ncbi.nlm.nih.gov/20190278" } ], "site_lbl": "Ser34", "uniprot_canonical_ac": "P26755-1" }, { "start_pos": 193, "end_pos": 193, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P26793", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P26793" }, { "database": "PubMed", "id": "20190278", "url": "https://pubmed.ncbi.nlm.nih.gov/20190278" }, { "database": "SGD", "id": "S000001596", "url": "https://www.yeastgenome.org/locus/S000001596" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" } ], "site_lbl": "Thr193", "uniprot_canonical_ac": "P26793-1" }, { "start_pos": 141, "end_pos": 141, "kinase_uniprot_canonical_ac": "P38110-1", "kinase_gene_name": "TEL1", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P32523", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P32523" }, { "database": "PubMed", "id": "17563356", "url": "https://pubmed.ncbi.nlm.nih.gov/17563356" }, { "database": "PubMed", "id": "18407956", "url": "https://pubmed.ncbi.nlm.nih.gov/18407956" }, { "database": "PubMed", "id": "19779198", "url": "https://pubmed.ncbi.nlm.nih.gov/19779198" }, { "database": "PubMed", "id": "20190278", "url": "https://pubmed.ncbi.nlm.nih.gov/20190278" }, { "database": "PubMed", "id": "21177495", "url": "https://pubmed.ncbi.nlm.nih.gov/21177495" } ], "site_lbl": "Ser141", "uniprot_canonical_ac": "P32523-1" }, { "start_pos": 141, "end_pos": 141, "kinase_uniprot_canonical_ac": "P38111-1", "kinase_gene_name": "MEC1", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P32523", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P32523" }, { "database": "PubMed", "id": "17563356", "url": "https://pubmed.ncbi.nlm.nih.gov/17563356" }, { "database": "PubMed", "id": "18407956", "url": "https://pubmed.ncbi.nlm.nih.gov/18407956" }, { "database": "PubMed", "id": "19779198", "url": "https://pubmed.ncbi.nlm.nih.gov/19779198" }, { "database": "PubMed", "id": "20190278", "url": "https://pubmed.ncbi.nlm.nih.gov/20190278" }, { "database": "PubMed", "id": "21177495", "url": "https://pubmed.ncbi.nlm.nih.gov/21177495" } ], "site_lbl": "Ser141", "uniprot_canonical_ac": "P32523-1" }, { "start_pos": 141, "end_pos": 141, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "SGD", "id": "S000003959", "url": "https://www.yeastgenome.org/locus/S000003959" }, { "database": "iPTMnet", "id": "P32523", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P32523" }, { "database": "PubMed", "id": "17563356", "url": "https://pubmed.ncbi.nlm.nih.gov/17563356" }, { "database": "PubMed", "id": "18407956", "url": "https://pubmed.ncbi.nlm.nih.gov/18407956" }, { "database": "PubMed", "id": "19779198", "url": "https://pubmed.ncbi.nlm.nih.gov/19779198" }, { "database": "PubMed", "id": "20190278", "url": "https://pubmed.ncbi.nlm.nih.gov/20190278" }, { "database": "PubMed", "id": "23749301", "url": "https://pubmed.ncbi.nlm.nih.gov/23749301" }, { "database": "PubMed", "id": "32597660", "url": "https://pubmed.ncbi.nlm.nih.gov/32597660" }, { "database": "PubMed", "id": "33481703", "url": "https://pubmed.ncbi.nlm.nih.gov/33481703" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" } ], "site_lbl": "Ser141", "uniprot_canonical_ac": "P32523-1" }, { "start_pos": 185, "end_pos": 185, "kinase_uniprot_canonical_ac": "P38110-1", "kinase_gene_name": "TEL1", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P32591", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P32591" }, { "database": "PubMed", "id": "18407956", "url": "https://pubmed.ncbi.nlm.nih.gov/18407956" }, { "database": "PubMed", "id": "19779198", "url": "https://pubmed.ncbi.nlm.nih.gov/19779198" }, { "database": "PubMed", "id": "19795423", "url": "https://pubmed.ncbi.nlm.nih.gov/19795423" }, { "database": "PubMed", "id": "19823750", "url": "https://pubmed.ncbi.nlm.nih.gov/19823750" }, { "database": "PubMed", "id": "20190278", "url": "https://pubmed.ncbi.nlm.nih.gov/20190278" } ], "site_lbl": "Ser185", "uniprot_canonical_ac": "P32591-1" }, { "start_pos": 185, "end_pos": 185, "kinase_uniprot_canonical_ac": "P38111-1", "kinase_gene_name": "MEC1", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P32591", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P32591" }, { "database": "PubMed", "id": "18407956", "url": "https://pubmed.ncbi.nlm.nih.gov/18407956" }, { "database": "PubMed", "id": "19779198", "url": "https://pubmed.ncbi.nlm.nih.gov/19779198" }, { "database": "PubMed", "id": "19795423", "url": "https://pubmed.ncbi.nlm.nih.gov/19795423" }, { "database": "PubMed", "id": "19823750", "url": "https://pubmed.ncbi.nlm.nih.gov/19823750" }, { "database": "PubMed", "id": "20190278", "url": "https://pubmed.ncbi.nlm.nih.gov/20190278" } ], "site_lbl": "Ser185", "uniprot_canonical_ac": "P32591-1" }, { "start_pos": 185, "end_pos": 185, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P32591", "url": "https://www.uniprot.org/uniprotkb/P32591" }, { "database": "PubMed", "id": "18407956", "url": "https://pubmed.ncbi.nlm.nih.gov/18407956" }, { "database": "SGD", "id": "S000003712", "url": "https://www.yeastgenome.org/locus/S000003712" }, { "database": "iPTMnet", "id": "P32591", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P32591" }, { "database": "PubMed", "id": "19779198", "url": "https://pubmed.ncbi.nlm.nih.gov/19779198" }, { "database": "PubMed", "id": "20190278", "url": "https://pubmed.ncbi.nlm.nih.gov/20190278" }, { "database": "PubMed", "id": "33481703", "url": "https://pubmed.ncbi.nlm.nih.gov/33481703" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" }, { "database": "PubMed", "id": "33502312", "url": "https://pubmed.ncbi.nlm.nih.gov/33502312" } ], "site_lbl": "Ser185", "uniprot_canonical_ac": "P32591-1" }, { "start_pos": 88, "end_pos": 88, "kinase_uniprot_canonical_ac": "P38110-1", "kinase_gene_name": "TEL1", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P32591", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P32591" }, { "database": "PubMed", "id": "17563356", "url": "https://pubmed.ncbi.nlm.nih.gov/17563356" }, { "database": "PubMed", "id": "18407956", "url": "https://pubmed.ncbi.nlm.nih.gov/18407956" }, { "database": "PubMed", "id": "20190278", "url": "https://pubmed.ncbi.nlm.nih.gov/20190278" }, { "database": "PubMed", "id": "21126336", "url": "https://pubmed.ncbi.nlm.nih.gov/21126336" }, { "database": "PubMed", "id": "21177495", "url": "https://pubmed.ncbi.nlm.nih.gov/21177495" } ], "site_lbl": "Ser88", "uniprot_canonical_ac": "P32591-1" }, { "start_pos": 88, "end_pos": 88, "kinase_uniprot_canonical_ac": "P38111-1", "kinase_gene_name": "MEC1", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P32591", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P32591" }, { "database": "PubMed", "id": "17563356", "url": "https://pubmed.ncbi.nlm.nih.gov/17563356" }, { "database": "PubMed", "id": "18407956", "url": "https://pubmed.ncbi.nlm.nih.gov/18407956" }, { "database": "PubMed", "id": "20190278", "url": "https://pubmed.ncbi.nlm.nih.gov/20190278" }, { "database": "PubMed", "id": "21126336", "url": "https://pubmed.ncbi.nlm.nih.gov/21126336" }, { "database": "PubMed", "id": "21177495", "url": "https://pubmed.ncbi.nlm.nih.gov/21177495" } ], "site_lbl": "Ser88", "uniprot_canonical_ac": "P32591-1" }, { "start_pos": 88, "end_pos": 88, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P32591", "url": "https://www.uniprot.org/uniprotkb/P32591" }, { "database": "PubMed", "id": "18407956", "url": "https://pubmed.ncbi.nlm.nih.gov/18407956" }, { "database": "SGD", "id": "S000003712", "url": "https://www.yeastgenome.org/locus/S000003712" }, { "database": "iPTMnet", "id": "P32591", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P32591" }, { "database": "PubMed", "id": "20190278", "url": "https://pubmed.ncbi.nlm.nih.gov/20190278" }, { "database": "PubMed", "id": "23749301", "url": "https://pubmed.ncbi.nlm.nih.gov/23749301" }, { "database": "PubMed", "id": "33481703", "url": "https://pubmed.ncbi.nlm.nih.gov/33481703" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" } ], "site_lbl": "Ser88", "uniprot_canonical_ac": "P32591-1" }, { "start_pos": 3, "end_pos": 3, "kinase_uniprot_canonical_ac": "P38110-1", "kinase_gene_name": "TEL1", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P32598", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P32598" }, { "database": "PubMed", "id": "20190278", "url": "https://pubmed.ncbi.nlm.nih.gov/20190278" }, { "database": "PubMed", "id": "20489023", "url": "https://pubmed.ncbi.nlm.nih.gov/20489023" } ], "site_lbl": "Ser3", "uniprot_canonical_ac": "P32598-1" }, { "start_pos": 3, "end_pos": 3, "kinase_uniprot_canonical_ac": "P38111-1", "kinase_gene_name": "MEC1", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P32598", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P32598" }, { "database": "PubMed", "id": "20190278", "url": "https://pubmed.ncbi.nlm.nih.gov/20190278" }, { "database": "PubMed", "id": "20489023", "url": "https://pubmed.ncbi.nlm.nih.gov/20489023" } ], "site_lbl": "Ser3", "uniprot_canonical_ac": "P32598-1" }, { "start_pos": 3, "end_pos": 3, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "SGD", "id": "S000000935", "url": "https://www.yeastgenome.org/locus/S000000935" }, { "database": "iPTMnet", "id": "P32598", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P32598" }, { "database": "PubMed", "id": "20190278", "url": "https://pubmed.ncbi.nlm.nih.gov/20190278" }, { "database": "PubMed", "id": "20489023", "url": "https://pubmed.ncbi.nlm.nih.gov/20489023" } ], "site_lbl": "Ser3", "uniprot_canonical_ac": "P32598-1" }, { "start_pos": 102, "end_pos": 102, "kinase_uniprot_canonical_ac": "P38110-1", "kinase_gene_name": "TEL1", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P32774", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P32774" }, { "database": "PubMed", "id": "17563356", "url": "https://pubmed.ncbi.nlm.nih.gov/17563356" }, { "database": "PubMed", "id": "18407956", "url": "https://pubmed.ncbi.nlm.nih.gov/18407956" }, { "database": "PubMed", "id": "20190278", "url": "https://pubmed.ncbi.nlm.nih.gov/20190278" } ], "site_lbl": "Ser102", "uniprot_canonical_ac": "P32774-1" }, { "start_pos": 102, "end_pos": 102, "kinase_uniprot_canonical_ac": "P38111-1", "kinase_gene_name": "MEC1", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P32774", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P32774" }, { "database": "PubMed", "id": "17563356", "url": "https://pubmed.ncbi.nlm.nih.gov/17563356" }, { "database": "PubMed", "id": "18407956", "url": "https://pubmed.ncbi.nlm.nih.gov/18407956" }, { "database": "PubMed", "id": "20190278", "url": "https://pubmed.ncbi.nlm.nih.gov/20190278" } ], "site_lbl": "Ser102", "uniprot_canonical_ac": "P32774-1" }, { "start_pos": 102, "end_pos": 102, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P32774", "url": "https://www.uniprot.org/uniprotkb/P32774" }, { "database": "PubMed", "id": "18407956", "url": "https://pubmed.ncbi.nlm.nih.gov/18407956" }, { "database": "SGD", "id": "S000001541", "url": "https://www.yeastgenome.org/locus/S000001541" }, { "database": "iPTMnet", "id": "P32774", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P32774" }, { "database": "PubMed", "id": "20190278", "url": "https://pubmed.ncbi.nlm.nih.gov/20190278" }, { "database": "PubMed", "id": "22218487", "url": "https://pubmed.ncbi.nlm.nih.gov/22218487" }, { "database": "PubMed", "id": "23749301", "url": "https://pubmed.ncbi.nlm.nih.gov/23749301" }, { "database": "PubMed", "id": "32597660", "url": "https://pubmed.ncbi.nlm.nih.gov/32597660" }, { "database": "PubMed", "id": "33481703", "url": "https://pubmed.ncbi.nlm.nih.gov/33481703" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" } ], "site_lbl": "Ser102", "uniprot_canonical_ac": "P32774-1" }, { "start_pos": 104, "end_pos": 104, "kinase_uniprot_canonical_ac": "P38110-1", "kinase_gene_name": "TEL1", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P32774", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P32774" }, { "database": "PubMed", "id": "20190278", "url": "https://pubmed.ncbi.nlm.nih.gov/20190278" } ], "site_lbl": "Ser104", "uniprot_canonical_ac": "P32774-1" }, { "start_pos": 104, "end_pos": 104, "kinase_uniprot_canonical_ac": "P38111-1", "kinase_gene_name": "MEC1", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P32774", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P32774" }, { "database": "PubMed", "id": "20190278", "url": "https://pubmed.ncbi.nlm.nih.gov/20190278" } ], "site_lbl": "Ser104", "uniprot_canonical_ac": "P32774-1" }, { "start_pos": 104, "end_pos": 104, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "SGD", "id": "S000001541", "url": "https://www.yeastgenome.org/locus/S000001541" }, { "database": "iPTMnet", "id": "P32774", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P32774" }, { "database": "PubMed", "id": "18407956", "url": "https://pubmed.ncbi.nlm.nih.gov/18407956" }, { "database": "PubMed", "id": "20190278", "url": "https://pubmed.ncbi.nlm.nih.gov/20190278" }, { "database": "PubMed", "id": "33481703", "url": "https://pubmed.ncbi.nlm.nih.gov/33481703" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" } ], "site_lbl": "Ser104", "uniprot_canonical_ac": "P32774-1" }, { "start_pos": 95, "end_pos": 95, "kinase_uniprot_canonical_ac": "P38110-1", "kinase_gene_name": "TEL1", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P32774", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P32774" }, { "database": "PubMed", "id": "18407956", "url": "https://pubmed.ncbi.nlm.nih.gov/18407956" }, { "database": "PubMed", "id": "19779198", "url": "https://pubmed.ncbi.nlm.nih.gov/19779198" }, { "database": "PubMed", "id": "20190278", "url": "https://pubmed.ncbi.nlm.nih.gov/20190278" } ], "site_lbl": "Ser95", "uniprot_canonical_ac": "P32774-1" }, { "start_pos": 95, "end_pos": 95, "kinase_uniprot_canonical_ac": "P38111-1", "kinase_gene_name": "MEC1", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P32774", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P32774" }, { "database": "PubMed", "id": "18407956", "url": "https://pubmed.ncbi.nlm.nih.gov/18407956" }, { "database": "PubMed", "id": "19779198", "url": "https://pubmed.ncbi.nlm.nih.gov/19779198" }, { "database": "PubMed", "id": "20190278", "url": "https://pubmed.ncbi.nlm.nih.gov/20190278" } ], "site_lbl": "Ser95", "uniprot_canonical_ac": "P32774-1" }, { "start_pos": 95, "end_pos": 95, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P32774", "url": "https://www.uniprot.org/uniprotkb/P32774" }, { "database": "PubMed", "id": "18407956", "url": "https://pubmed.ncbi.nlm.nih.gov/18407956" }, { "database": "PubMed", "id": "19779198", "url": "https://pubmed.ncbi.nlm.nih.gov/19779198" }, { "database": "SGD", "id": "S000001541", "url": "https://www.yeastgenome.org/locus/S000001541" }, { "database": "iPTMnet", "id": "P32774", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P32774" }, { "database": "PubMed", "id": "20190278", "url": "https://pubmed.ncbi.nlm.nih.gov/20190278" }, { "database": "PubMed", "id": "22218487", "url": "https://pubmed.ncbi.nlm.nih.gov/22218487" }, { "database": "PubMed", "id": "23749301", "url": "https://pubmed.ncbi.nlm.nih.gov/23749301" }, { "database": "PubMed", "id": "33481703", "url": "https://pubmed.ncbi.nlm.nih.gov/33481703" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" } ], "site_lbl": "Ser95", "uniprot_canonical_ac": "P32774-1" }, { "start_pos": 404, "end_pos": 404, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P38333", "url": "https://www.uniprot.org/uniprotkb/P38333" }, { "database": "PubMed", "id": "18407956", "url": "https://pubmed.ncbi.nlm.nih.gov/18407956" }, { "database": "iPTMnet", "id": "P38333", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P38333" }, { "database": "PubMed", "id": "20190278", "url": "https://pubmed.ncbi.nlm.nih.gov/20190278" }, { "database": "SGD", "id": "S000000451", "url": "https://www.yeastgenome.org/locus/S000000451" }, { "database": "PubMed", "id": "23749301", "url": "https://pubmed.ncbi.nlm.nih.gov/23749301" }, { "database": "PubMed", "id": "32138239", "url": "https://pubmed.ncbi.nlm.nih.gov/32138239" }, { "database": "PubMed", "id": "32597660", "url": "https://pubmed.ncbi.nlm.nih.gov/32597660" }, { "database": "PubMed", "id": "33481703", "url": "https://pubmed.ncbi.nlm.nih.gov/33481703" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" } ], "site_lbl": "Ser404", "uniprot_canonical_ac": "P38333-1" }, { "start_pos": 287, "end_pos": 287, "kinase_uniprot_canonical_ac": "P38110-1", "kinase_gene_name": "TEL1", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P38859", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P38859" }, { "database": "PubMed", "id": "20190278", "url": "https://pubmed.ncbi.nlm.nih.gov/20190278" } ], "site_lbl": "Ser287", "uniprot_canonical_ac": "P38859-1" }, { "start_pos": 287, "end_pos": 287, "kinase_uniprot_canonical_ac": "P38111-1", "kinase_gene_name": "MEC1", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P38859", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P38859" }, { "database": "PubMed", "id": "20190278", "url": "https://pubmed.ncbi.nlm.nih.gov/20190278" } ], "site_lbl": "Ser287", "uniprot_canonical_ac": "P38859-1" }, { "start_pos": 287, "end_pos": 287, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "SGD", "id": "S000001207", "url": "https://www.yeastgenome.org/locus/S000001207" }, { "database": "iPTMnet", "id": "P38859", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P38859" }, { "database": "PubMed", "id": "20190278", "url": "https://pubmed.ncbi.nlm.nih.gov/20190278" }, { "database": "PubMed", "id": "23749301", "url": "https://pubmed.ncbi.nlm.nih.gov/23749301" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" } ], "site_lbl": "Ser287", "uniprot_canonical_ac": "P38859-1" }, { "start_pos": 14, "end_pos": 14, "kinase_uniprot_canonical_ac": "P38110-1", "kinase_gene_name": "TEL1", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P40856", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P40856" }, { "database": "PubMed", "id": "20190278", "url": "https://pubmed.ncbi.nlm.nih.gov/20190278" } ], "site_lbl": "Ser14", "uniprot_canonical_ac": "P40856-1" }, { "start_pos": 14, "end_pos": 14, "kinase_uniprot_canonical_ac": "P38111-1", "kinase_gene_name": "MEC1", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P40856", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P40856" }, { "database": "PubMed", "id": "20190278", "url": "https://pubmed.ncbi.nlm.nih.gov/20190278" } ], "site_lbl": "Ser14", "uniprot_canonical_ac": "P40856-1" }, { "start_pos": 14, "end_pos": 14, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "SGD", "id": "S000003634", "url": "https://www.yeastgenome.org/locus/S000003634" }, { "database": "iPTMnet", "id": "P40856", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P40856" }, { "database": "PubMed", "id": "20190278", "url": "https://pubmed.ncbi.nlm.nih.gov/20190278" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" } ], "site_lbl": "Ser14", "uniprot_canonical_ac": "P40856-1" }, { "start_pos": 575, "end_pos": 575, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P40969", "url": "https://www.uniprot.org/uniprotkb/P40969" }, { "database": "PubMed", "id": "18407956", "url": "https://pubmed.ncbi.nlm.nih.gov/18407956" }, { "database": "iPTMnet", "id": "P40969", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P40969" }, { "database": "PubMed", "id": "14581449", "url": "https://pubmed.ncbi.nlm.nih.gov/14581449" }, { "database": "PubMed", "id": "17563356", "url": "https://pubmed.ncbi.nlm.nih.gov/17563356" }, { "database": "PubMed", "id": "20190278", "url": "https://pubmed.ncbi.nlm.nih.gov/20190278" }, { "database": "SGD", "id": "S000004778", "url": "https://www.yeastgenome.org/locus/S000004778" }, { "database": "PubMed", "id": "23749301", "url": "https://pubmed.ncbi.nlm.nih.gov/23749301" }, { "database": "PubMed", "id": "26829389", "url": "https://pubmed.ncbi.nlm.nih.gov/26829389" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" } ], "site_lbl": "Ser575", "uniprot_canonical_ac": "P40969-1" }, { "start_pos": 20, "end_pos": 20, "kinase_uniprot_canonical_ac": "P38110-1", "kinase_gene_name": "TEL1", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P46957", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P46957" }, { "database": "PubMed", "id": "18407956", "url": "https://pubmed.ncbi.nlm.nih.gov/18407956" }, { "database": "PubMed", "id": "20190278", "url": "https://pubmed.ncbi.nlm.nih.gov/20190278" } ], "site_lbl": "Ser20", "uniprot_canonical_ac": "P46957-1" }, { "start_pos": 20, "end_pos": 20, "kinase_uniprot_canonical_ac": "P38111-1", "kinase_gene_name": "MEC1", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P46957", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P46957" }, { "database": "PubMed", "id": "18407956", "url": "https://pubmed.ncbi.nlm.nih.gov/18407956" }, { "database": "PubMed", "id": "20190278", "url": "https://pubmed.ncbi.nlm.nih.gov/20190278" } ], "site_lbl": "Ser20", "uniprot_canonical_ac": "P46957-1" }, { "start_pos": 20, "end_pos": 20, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P46957", "url": "https://www.uniprot.org/uniprotkb/P46957" }, { "database": "PubMed", "id": "18407956", "url": "https://pubmed.ncbi.nlm.nih.gov/18407956" }, { "database": "SGD", "id": "S000003766", "url": "https://www.yeastgenome.org/locus/S000003766" }, { "database": "iPTMnet", "id": "P46957", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P46957" }, { "database": "PubMed", "id": "20190278", "url": "https://pubmed.ncbi.nlm.nih.gov/20190278" }, { "database": "PubMed", "id": "23749301", "url": "https://pubmed.ncbi.nlm.nih.gov/23749301" }, { "database": "PubMed", "id": "32597660", "url": "https://pubmed.ncbi.nlm.nih.gov/32597660" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" } ], "site_lbl": "Ser20", "uniprot_canonical_ac": "P46957-1" }, { "start_pos": 173, "end_pos": 173, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P48743", "url": "https://www.uniprot.org/uniprotkb/P48743" }, { "database": "PubMed", "id": "19779198", "url": "https://pubmed.ncbi.nlm.nih.gov/19779198" }, { "database": "iPTMnet", "id": "P48743", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P48743" }, { "database": "PubMed", "id": "18407956", "url": "https://pubmed.ncbi.nlm.nih.gov/18407956" }, { "database": "PubMed", "id": "20190278", "url": "https://pubmed.ncbi.nlm.nih.gov/20190278" }, { "database": "SGD", "id": "S000004166", "url": "https://www.yeastgenome.org/locus/S000004166" }, { "database": "PubMed", "id": "23749301", "url": "https://pubmed.ncbi.nlm.nih.gov/23749301" }, { "database": "PubMed", "id": "32597660", "url": "https://pubmed.ncbi.nlm.nih.gov/32597660" }, { "database": "PubMed", "id": "33481703", "url": "https://pubmed.ncbi.nlm.nih.gov/33481703" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" } ], "site_lbl": "Ser173", "uniprot_canonical_ac": "P48743-1" }, { "start_pos": 199, "end_pos": 199, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P48743", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P48743" }, { "database": "PubMed", "id": "18407956", "url": "https://pubmed.ncbi.nlm.nih.gov/18407956" }, { "database": "PubMed", "id": "20190278", "url": "https://pubmed.ncbi.nlm.nih.gov/20190278" }, { "database": "SGD", "id": "S000004166", "url": "https://www.yeastgenome.org/locus/S000004166" }, { "database": "PubMed", "id": "23749301", "url": "https://pubmed.ncbi.nlm.nih.gov/23749301" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" } ], "site_lbl": "Thr199", "uniprot_canonical_ac": "P48743-1" }, { "start_pos": 102, "end_pos": 102, "kinase_uniprot_canonical_ac": "P38110-1", "kinase_gene_name": "TEL1", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q03834", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q03834" }, { "database": "PubMed", "id": "17563356", "url": "https://pubmed.ncbi.nlm.nih.gov/17563356" }, { "database": "PubMed", "id": "18407956", "url": "https://pubmed.ncbi.nlm.nih.gov/18407956" }, { "database": "PubMed", "id": "20190278", "url": "https://pubmed.ncbi.nlm.nih.gov/20190278" } ], "site_lbl": "Ser102", "uniprot_canonical_ac": "Q03834-1" }, { "start_pos": 102, "end_pos": 102, "kinase_uniprot_canonical_ac": "P38111-1", "kinase_gene_name": "MEC1", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q03834", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q03834" }, { "database": "PubMed", "id": "17563356", "url": "https://pubmed.ncbi.nlm.nih.gov/17563356" }, { "database": "PubMed", "id": "18407956", "url": "https://pubmed.ncbi.nlm.nih.gov/18407956" }, { "database": "PubMed", "id": "20190278", "url": "https://pubmed.ncbi.nlm.nih.gov/20190278" } ], "site_lbl": "Ser102", "uniprot_canonical_ac": "Q03834-1" }, { "start_pos": 102, "end_pos": 102, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "Q03834", "url": "https://www.uniprot.org/uniprotkb/Q03834" }, { "database": "PubMed", "id": "18407956", "url": "https://pubmed.ncbi.nlm.nih.gov/18407956" }, { "database": "SGD", "id": "S000002504", "url": "https://www.yeastgenome.org/locus/S000002504" }, { "database": "iPTMnet", "id": "Q03834", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q03834" }, { "database": "PubMed", "id": "17563356", "url": "https://pubmed.ncbi.nlm.nih.gov/17563356" }, { "database": "PubMed", "id": "20190278", "url": "https://pubmed.ncbi.nlm.nih.gov/20190278" }, { "database": "PubMed", "id": "23749301", "url": "https://pubmed.ncbi.nlm.nih.gov/23749301" }, { "database": "PubMed", "id": "33481703", "url": "https://pubmed.ncbi.nlm.nih.gov/33481703" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" } ], "site_lbl": "Ser102", "uniprot_canonical_ac": "Q03834-1" }, { "start_pos": 130, "end_pos": 130, "kinase_uniprot_canonical_ac": "P38110-1", "kinase_gene_name": "TEL1", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q03834", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q03834" }, { "database": "PubMed", "id": "17287358", "url": "https://pubmed.ncbi.nlm.nih.gov/17287358" }, { "database": "PubMed", "id": "17563356", "url": "https://pubmed.ncbi.nlm.nih.gov/17563356" }, { "database": "PubMed", "id": "18407956", "url": "https://pubmed.ncbi.nlm.nih.gov/18407956" }, { "database": "PubMed", "id": "20190278", "url": "https://pubmed.ncbi.nlm.nih.gov/20190278" } ], "site_lbl": "Ser130", "uniprot_canonical_ac": "Q03834-1" }, { "start_pos": 130, "end_pos": 130, "kinase_uniprot_canonical_ac": "P38111-1", "kinase_gene_name": "MEC1", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q03834", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q03834" }, { "database": "PubMed", "id": "17287358", "url": "https://pubmed.ncbi.nlm.nih.gov/17287358" }, { "database": "PubMed", "id": "17563356", "url": "https://pubmed.ncbi.nlm.nih.gov/17563356" }, { "database": "PubMed", "id": "18407956", "url": "https://pubmed.ncbi.nlm.nih.gov/18407956" }, { "database": "PubMed", "id": "20190278", "url": "https://pubmed.ncbi.nlm.nih.gov/20190278" } ], "site_lbl": "Ser130", "uniprot_canonical_ac": "Q03834-1" }, { "start_pos": 130, "end_pos": 130, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "SGD", "id": "S000002504", "url": "https://www.yeastgenome.org/locus/S000002504" }, { "database": "iPTMnet", "id": "Q03834", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q03834" }, { "database": "PubMed", "id": "17563356", "url": "https://pubmed.ncbi.nlm.nih.gov/17563356" }, { "database": "PubMed", "id": "18407956", "url": "https://pubmed.ncbi.nlm.nih.gov/18407956" }, { "database": "PubMed", "id": "20190278", "url": "https://pubmed.ncbi.nlm.nih.gov/20190278" }, { "database": "PubMed", "id": "23749301", "url": "https://pubmed.ncbi.nlm.nih.gov/23749301" }, { "database": "PubMed", "id": "32597660", "url": "https://pubmed.ncbi.nlm.nih.gov/32597660" }, { "database": "PubMed", "id": "33481703", "url": "https://pubmed.ncbi.nlm.nih.gov/33481703" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" } ], "site_lbl": "Ser130", "uniprot_canonical_ac": "Q03834-1" }, { "start_pos": 451, "end_pos": 451, "kinase_uniprot_canonical_ac": "P38110-1", "kinase_gene_name": "TEL1", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q03834", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q03834" }, { "database": "PubMed", "id": "18407956", "url": "https://pubmed.ncbi.nlm.nih.gov/18407956" }, { "database": "PubMed", "id": "20190278", "url": "https://pubmed.ncbi.nlm.nih.gov/20190278" } ], "site_lbl": "Thr451", "uniprot_canonical_ac": "Q03834-1" }, { "start_pos": 451, "end_pos": 451, "kinase_uniprot_canonical_ac": "P38111-1", "kinase_gene_name": "MEC1", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q03834", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q03834" }, { "database": "PubMed", "id": "18407956", "url": "https://pubmed.ncbi.nlm.nih.gov/18407956" }, { "database": "PubMed", "id": "20190278", "url": "https://pubmed.ncbi.nlm.nih.gov/20190278" } ], "site_lbl": "Thr451", "uniprot_canonical_ac": "Q03834-1" }, { "start_pos": 451, "end_pos": 451, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine", "evidence": [ { "database": "UniProtKB", "id": "Q03834", "url": "https://www.uniprot.org/uniprotkb/Q03834" }, { "database": "PubMed", "id": "18407956", "url": "https://pubmed.ncbi.nlm.nih.gov/18407956" }, { "database": "SGD", "id": "S000002504", "url": "https://www.yeastgenome.org/locus/S000002504" }, { "database": "iPTMnet", "id": "Q03834", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q03834" }, { "database": "PubMed", "id": "20190278", "url": "https://pubmed.ncbi.nlm.nih.gov/20190278" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" } ], "site_lbl": "Thr451", "uniprot_canonical_ac": "Q03834-1" }, { "start_pos": 23, "end_pos": 23, "kinase_uniprot_canonical_ac": "P38110-1", "kinase_gene_name": "TEL1", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q06505", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q06505" }, { "database": "PubMed", "id": "17330950", "url": "https://pubmed.ncbi.nlm.nih.gov/17330950" }, { "database": "PubMed", "id": "17563356", "url": "https://pubmed.ncbi.nlm.nih.gov/17563356" }, { "database": "PubMed", "id": "18407956", "url": "https://pubmed.ncbi.nlm.nih.gov/18407956" }, { "database": "PubMed", "id": "19684113", "url": "https://pubmed.ncbi.nlm.nih.gov/19684113" }, { "database": "PubMed", "id": "19779198", "url": "https://pubmed.ncbi.nlm.nih.gov/19779198" }, { "database": "PubMed", "id": "19795423", "url": "https://pubmed.ncbi.nlm.nih.gov/19795423" }, { "database": "PubMed", "id": "19823750", "url": "https://pubmed.ncbi.nlm.nih.gov/19823750" }, { "database": "PubMed", "id": "20190278", "url": "https://pubmed.ncbi.nlm.nih.gov/20190278" }, { "database": "PubMed", "id": "20702584", "url": "https://pubmed.ncbi.nlm.nih.gov/20702584" }, { "database": "PubMed", "id": "21177495", "url": "https://pubmed.ncbi.nlm.nih.gov/21177495" } ], "site_lbl": "Ser23", "uniprot_canonical_ac": "Q06505-1" }, { "start_pos": 23, "end_pos": 23, "kinase_uniprot_canonical_ac": "P38111-1", "kinase_gene_name": "MEC1", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q06505", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q06505" }, { "database": "PubMed", "id": "17330950", "url": "https://pubmed.ncbi.nlm.nih.gov/17330950" }, { "database": "PubMed", "id": "17563356", "url": "https://pubmed.ncbi.nlm.nih.gov/17563356" }, { "database": "PubMed", "id": "18407956", "url": "https://pubmed.ncbi.nlm.nih.gov/18407956" }, { "database": "PubMed", "id": "19684113", "url": "https://pubmed.ncbi.nlm.nih.gov/19684113" }, { "database": "PubMed", "id": "19779198", "url": "https://pubmed.ncbi.nlm.nih.gov/19779198" }, { "database": "PubMed", "id": "19795423", "url": "https://pubmed.ncbi.nlm.nih.gov/19795423" }, { "database": "PubMed", "id": "19823750", "url": "https://pubmed.ncbi.nlm.nih.gov/19823750" }, { "database": "PubMed", "id": "20190278", "url": "https://pubmed.ncbi.nlm.nih.gov/20190278" }, { "database": "PubMed", "id": "20702584", "url": "https://pubmed.ncbi.nlm.nih.gov/20702584" }, { "database": "PubMed", "id": "21177495", "url": "https://pubmed.ncbi.nlm.nih.gov/21177495" } ], "site_lbl": "Ser23", "uniprot_canonical_ac": "Q06505-1" }, { "start_pos": 23, "end_pos": 23, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by ATM or ATR", "evidence": [ { "database": "UniProtKB", "id": "Q06505", "url": "https://www.uniprot.org/uniprotkb/Q06505" }, { "database": "SGD", "id": "S000006337", "url": "https://www.yeastgenome.org/locus/S000006337" }, { "database": "iPTMnet", "id": "Q06505", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q06505" }, { "database": "PubMed", "id": "17563356", "url": "https://pubmed.ncbi.nlm.nih.gov/17563356" }, { "database": "PubMed", "id": "18407956", "url": "https://pubmed.ncbi.nlm.nih.gov/18407956" }, { "database": "PubMed", "id": "19684113", "url": "https://pubmed.ncbi.nlm.nih.gov/19684113" }, { "database": "PubMed", "id": "19779198", "url": "https://pubmed.ncbi.nlm.nih.gov/19779198" }, { "database": "PubMed", "id": "20190278", "url": "https://pubmed.ncbi.nlm.nih.gov/20190278" }, { "database": "PubMed", "id": "20702584", "url": "https://pubmed.ncbi.nlm.nih.gov/20702584" }, { "database": "PubMed", "id": "22218487", "url": "https://pubmed.ncbi.nlm.nih.gov/22218487" }, { "database": "PubMed", "id": "23749301", "url": "https://pubmed.ncbi.nlm.nih.gov/23749301" }, { "database": "PubMed", "id": "33481703", "url": "https://pubmed.ncbi.nlm.nih.gov/33481703" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" }, { "database": "PubMed", "id": "17330950", "url": "https://pubmed.ncbi.nlm.nih.gov/17330950" } ], "site_lbl": "Ser23", "uniprot_canonical_ac": "Q06505-1" }, { "start_pos": 50, "end_pos": 50, "kinase_uniprot_canonical_ac": "P38110-1", "kinase_gene_name": "TEL1", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q12432", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q12432" }, { "database": "PubMed", "id": "17563356", "url": "https://pubmed.ncbi.nlm.nih.gov/17563356" }, { "database": "PubMed", "id": "18407956", "url": "https://pubmed.ncbi.nlm.nih.gov/18407956" }, { "database": "PubMed", "id": "20190278", "url": "https://pubmed.ncbi.nlm.nih.gov/20190278" } ], "site_lbl": "Ser50", "uniprot_canonical_ac": "Q12432-1" }, { "start_pos": 50, "end_pos": 50, "kinase_uniprot_canonical_ac": "P38111-1", "kinase_gene_name": "MEC1", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q12432", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q12432" }, { "database": "PubMed", "id": "17563356", "url": "https://pubmed.ncbi.nlm.nih.gov/17563356" }, { "database": "PubMed", "id": "18407956", "url": "https://pubmed.ncbi.nlm.nih.gov/18407956" }, { "database": "PubMed", "id": "20190278", "url": "https://pubmed.ncbi.nlm.nih.gov/20190278" } ], "site_lbl": "Ser50", "uniprot_canonical_ac": "Q12432-1" }, { "start_pos": 50, "end_pos": 50, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "SGD", "id": "S000006227", "url": "https://www.yeastgenome.org/locus/S000006227" }, { "database": "iPTMnet", "id": "Q12432", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q12432" }, { "database": "PubMed", "id": "18407956", "url": "https://pubmed.ncbi.nlm.nih.gov/18407956" }, { "database": "PubMed", "id": "20190278", "url": "https://pubmed.ncbi.nlm.nih.gov/20190278" }, { "database": "PubMed", "id": "23749301", "url": "https://pubmed.ncbi.nlm.nih.gov/23749301" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" } ], "site_lbl": "Ser50", "uniprot_canonical_ac": "Q12432-1" }, { "start_pos": 129, "end_pos": 129, "kinase_uniprot_canonical_ac": "P38110-1", "kinase_gene_name": "TEL1", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P02294", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P02294" }, { "database": "PubMed", "id": "20190278", "url": "https://pubmed.ncbi.nlm.nih.gov/20190278" } ], "site_lbl": "Thr129", "uniprot_canonical_ac": "P02294-1" }, { "start_pos": 129, "end_pos": 129, "kinase_uniprot_canonical_ac": "P38111-1", "kinase_gene_name": "MEC1", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P02294", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P02294" }, { "database": "PubMed", "id": "20190278", "url": "https://pubmed.ncbi.nlm.nih.gov/20190278" } ], "site_lbl": "Thr129", "uniprot_canonical_ac": "P02294-1" }, { "start_pos": 129, "end_pos": 129, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "SGD", "id": "S000000098", "url": "https://www.yeastgenome.org/locus/S000000098" }, { "database": "iPTMnet", "id": "P02294", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P02294" }, { "database": "PubMed", "id": "20190278", "url": "https://pubmed.ncbi.nlm.nih.gov/20190278" }, { "database": "PubMed", "id": "23749301", "url": "https://pubmed.ncbi.nlm.nih.gov/23749301" }, { "database": "PubMed", "id": "33502312", "url": "https://pubmed.ncbi.nlm.nih.gov/33502312" } ], "site_lbl": "Thr129", "uniprot_canonical_ac": "P02294-1" }, { "start_pos": 61, "end_pos": 61, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P02309", "url": "https://www.uniprot.org/uniprotkb/P02309" }, { "database": "PubMed", "id": "18407956", "url": "https://pubmed.ncbi.nlm.nih.gov/18407956" }, { "database": "PubMed", "id": "19779198", "url": "https://pubmed.ncbi.nlm.nih.gov/19779198" }, { "database": "iPTMnet", "id": "P02309", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P02309" }, { "database": "PubMed", "id": "20190278", "url": "https://pubmed.ncbi.nlm.nih.gov/20190278" }, { "database": "SGD", "id": "S000000213", "url": "https://www.yeastgenome.org/locus/S000000213" }, { "database": "SGD", "id": "S000004975", "url": "https://www.yeastgenome.org/locus/S000004975" }, { "database": "PubMed", "id": "33481703", "url": "https://pubmed.ncbi.nlm.nih.gov/33481703" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" } ], "site_lbl": "Ser61", "uniprot_canonical_ac": "P02309-1" }, { "start_pos": 65, "end_pos": 65, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P02309", "url": "https://www.uniprot.org/uniprotkb/P02309" }, { "database": "PubMed", "id": "17287358", "url": "https://pubmed.ncbi.nlm.nih.gov/17287358" }, { "database": "PubMed", "id": "19779198", "url": "https://pubmed.ncbi.nlm.nih.gov/19779198" }, { "database": "iPTMnet", "id": "P02309", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P02309" }, { "database": "PubMed", "id": "20190278", "url": "https://pubmed.ncbi.nlm.nih.gov/20190278" }, { "database": "SGD", "id": "S000000213", "url": "https://www.yeastgenome.org/locus/S000000213" }, { "database": "SGD", "id": "S000004975", "url": "https://www.yeastgenome.org/locus/S000004975" }, { "database": "PubMed", "id": "33481703", "url": "https://pubmed.ncbi.nlm.nih.gov/33481703" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" } ], "site_lbl": "Ser65", "uniprot_canonical_ac": "P02309-1" }, { "start_pos": 129, "end_pos": 129, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P04911", "url": "https://www.uniprot.org/uniprotkb/P04911" }, { "database": "PubMed", "id": "11140636", "url": "https://pubmed.ncbi.nlm.nih.gov/11140636" }, { "database": "iPTMnet", "id": "P04911", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P04911" }, { "database": "PubMed", "id": "11875433", "url": "https://pubmed.ncbi.nlm.nih.gov/11875433" }, { "database": "PubMed", "id": "15607975", "url": "https://pubmed.ncbi.nlm.nih.gov/15607975" }, { "database": "PubMed", "id": "19795423", "url": "https://pubmed.ncbi.nlm.nih.gov/19795423" }, { "database": "PubMed", "id": "20190278", "url": "https://pubmed.ncbi.nlm.nih.gov/20190278" }, { "database": "SGD", "id": "S000002633", "url": "https://www.yeastgenome.org/locus/S000002633" }, { "database": "PubMed", "id": "21212735", "url": "https://pubmed.ncbi.nlm.nih.gov/21212735" }, { "database": "PubMed", "id": "22218487", "url": "https://pubmed.ncbi.nlm.nih.gov/22218487" }, { "database": "PubMed", "id": "23749301", "url": "https://pubmed.ncbi.nlm.nih.gov/23749301" }, { "database": "PubMed", "id": "32597660", "url": "https://pubmed.ncbi.nlm.nih.gov/32597660" }, { "database": "PubMed", "id": "32933557", "url": "https://pubmed.ncbi.nlm.nih.gov/32933557" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" }, { "database": "PubMed", "id": "33502312", "url": "https://pubmed.ncbi.nlm.nih.gov/33502312" } ], "site_lbl": "Ser129", "uniprot_canonical_ac": "P04911-1" }, { "start_pos": 116, "end_pos": 116, "kinase_uniprot_canonical_ac": "P38110-1", "kinase_gene_name": "TEL1", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P07273", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P07273" }, { "database": "PubMed", "id": "18407956", "url": "https://pubmed.ncbi.nlm.nih.gov/18407956" }, { "database": "PubMed", "id": "19779198", "url": "https://pubmed.ncbi.nlm.nih.gov/19779198" }, { "database": "PubMed", "id": "20190278", "url": "https://pubmed.ncbi.nlm.nih.gov/20190278" } ], "site_lbl": "Ser116", "uniprot_canonical_ac": "P07273-1" }, { "start_pos": 116, "end_pos": 116, "kinase_uniprot_canonical_ac": "P38111-1", "kinase_gene_name": "MEC1", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P07273", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P07273" }, { "database": "PubMed", "id": "18407956", "url": "https://pubmed.ncbi.nlm.nih.gov/18407956" }, { "database": "PubMed", "id": "19779198", "url": "https://pubmed.ncbi.nlm.nih.gov/19779198" }, { "database": "PubMed", "id": "20190278", "url": "https://pubmed.ncbi.nlm.nih.gov/20190278" } ], "site_lbl": "Ser116", "uniprot_canonical_ac": "P07273-1" }, { "start_pos": 116, "end_pos": 116, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P07273", "url": "https://www.uniprot.org/uniprotkb/P07273" }, { "database": "PubMed", "id": "19779198", "url": "https://pubmed.ncbi.nlm.nih.gov/19779198" }, { "database": "SGD", "id": "S000003011", "url": "https://www.yeastgenome.org/locus/S000003011" }, { "database": "iPTMnet", "id": "P07273", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P07273" }, { "database": "PubMed", "id": "18407956", "url": "https://pubmed.ncbi.nlm.nih.gov/18407956" }, { "database": "PubMed", "id": "20190278", "url": "https://pubmed.ncbi.nlm.nih.gov/20190278" }, { "database": "PubMed", "id": "23749301", "url": "https://pubmed.ncbi.nlm.nih.gov/23749301" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" } ], "site_lbl": "Ser116", "uniprot_canonical_ac": "P07273-1" }, { "start_pos": 692, "end_pos": 692, "kinase_uniprot_canonical_ac": "P38110-1", "kinase_gene_name": "TEL1", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P11978", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P11978" }, { "database": "PubMed", "id": "18407956", "url": "https://pubmed.ncbi.nlm.nih.gov/18407956" }, { "database": "PubMed", "id": "20190278", "url": "https://pubmed.ncbi.nlm.nih.gov/20190278" } ], "site_lbl": "Ser692", "uniprot_canonical_ac": "P11978-1" }, { "start_pos": 692, "end_pos": 692, "kinase_uniprot_canonical_ac": "P38111-1", "kinase_gene_name": "MEC1", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P11978", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P11978" }, { "database": "PubMed", "id": "18407956", "url": "https://pubmed.ncbi.nlm.nih.gov/18407956" }, { "database": "PubMed", "id": "20190278", "url": "https://pubmed.ncbi.nlm.nih.gov/20190278" } ], "site_lbl": "Ser692", "uniprot_canonical_ac": "P11978-1" }, { "start_pos": 692, "end_pos": 692, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P11978", "url": "https://www.uniprot.org/uniprotkb/P11978" }, { "database": "PubMed", "id": "18407956", "url": "https://pubmed.ncbi.nlm.nih.gov/18407956" }, { "database": "SGD", "id": "S000002635", "url": "https://www.yeastgenome.org/locus/S000002635" }, { "database": "iPTMnet", "id": "P11978", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P11978" }, { "database": "PubMed", "id": "20190278", "url": "https://pubmed.ncbi.nlm.nih.gov/20190278" }, { "database": "PubMed", "id": "23749301", "url": "https://pubmed.ncbi.nlm.nih.gov/23749301" }, { "database": "PubMed", "id": "32597660", "url": "https://pubmed.ncbi.nlm.nih.gov/32597660" }, { "database": "PubMed", "id": "33481703", "url": "https://pubmed.ncbi.nlm.nih.gov/33481703" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" } ], "site_lbl": "Ser692", "uniprot_canonical_ac": "P11978-1" }, { "start_pos": 473, "end_pos": 473, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P32325", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P32325" }, { "database": "PubMed", "id": "20190278", "url": "https://pubmed.ncbi.nlm.nih.gov/20190278" }, { "database": "PubMed", "id": "20865002", "url": "https://pubmed.ncbi.nlm.nih.gov/20865002" }, { "database": "SGD", "id": "S000002459", "url": "https://www.yeastgenome.org/locus/S000002459" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" } ], "site_lbl": "Thr473", "uniprot_canonical_ac": "P32325-1" }, { "start_pos": 1166, "end_pos": 1166, "kinase_uniprot_canonical_ac": "P38110-1", "kinase_gene_name": "TEL1", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P32597", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P32597" }, { "database": "PubMed", "id": "18407956", "url": "https://pubmed.ncbi.nlm.nih.gov/18407956" }, { "database": "PubMed", "id": "20190278", "url": "https://pubmed.ncbi.nlm.nih.gov/20190278" }, { "database": "PubMed", "id": "21126336", "url": "https://pubmed.ncbi.nlm.nih.gov/21126336" } ], "site_lbl": "Thr1166", "uniprot_canonical_ac": "P32597-1" }, { "start_pos": 1166, "end_pos": 1166, "kinase_uniprot_canonical_ac": "P38111-1", "kinase_gene_name": "MEC1", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P32597", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P32597" }, { "database": "PubMed", "id": "18407956", "url": "https://pubmed.ncbi.nlm.nih.gov/18407956" }, { "database": "PubMed", "id": "20190278", "url": "https://pubmed.ncbi.nlm.nih.gov/20190278" }, { "database": "PubMed", "id": "21126336", "url": "https://pubmed.ncbi.nlm.nih.gov/21126336" } ], "site_lbl": "Thr1166", "uniprot_canonical_ac": "P32597-1" }, { "start_pos": 1166, "end_pos": 1166, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "SGD", "id": "S000001388", "url": "https://www.yeastgenome.org/locus/S000001388" }, { "database": "iPTMnet", "id": "P32597", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P32597" }, { "database": "PubMed", "id": "18407956", "url": "https://pubmed.ncbi.nlm.nih.gov/18407956" }, { "database": "PubMed", "id": "20190278", "url": "https://pubmed.ncbi.nlm.nih.gov/20190278" } ], "site_lbl": "Thr1166", "uniprot_canonical_ac": "P32597-1" }, { "start_pos": 1172, "end_pos": 1172, "kinase_uniprot_canonical_ac": "P38110-1", "kinase_gene_name": "TEL1", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P32597", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P32597" }, { "database": "PubMed", "id": "20190278", "url": "https://pubmed.ncbi.nlm.nih.gov/20190278" } ], "site_lbl": "Ser1172", "uniprot_canonical_ac": "P32597-1" }, { "start_pos": 1172, "end_pos": 1172, "kinase_uniprot_canonical_ac": "P38111-1", "kinase_gene_name": "MEC1", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P32597", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P32597" }, { "database": "PubMed", "id": "20190278", "url": "https://pubmed.ncbi.nlm.nih.gov/20190278" } ], "site_lbl": "Ser1172", "uniprot_canonical_ac": "P32597-1" }, { "start_pos": 1172, "end_pos": 1172, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "SGD", "id": "S000001388", "url": "https://www.yeastgenome.org/locus/S000001388" }, { "database": "iPTMnet", "id": "P32597", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P32597" }, { "database": "PubMed", "id": "20190278", "url": "https://pubmed.ncbi.nlm.nih.gov/20190278" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" } ], "site_lbl": "Ser1172", "uniprot_canonical_ac": "P32597-1" }, { "start_pos": 121, "end_pos": 121, "kinase_uniprot_canonical_ac": "P38110-1", "kinase_gene_name": "TEL1", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P32628", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P32628" }, { "database": "PubMed", "id": "18407956", "url": "https://pubmed.ncbi.nlm.nih.gov/18407956" }, { "database": "PubMed", "id": "20190278", "url": "https://pubmed.ncbi.nlm.nih.gov/20190278" }, { "database": "PubMed", "id": "21177495", "url": "https://pubmed.ncbi.nlm.nih.gov/21177495" } ], "site_lbl": "Ser121", "uniprot_canonical_ac": "P32628-1" }, { "start_pos": 121, "end_pos": 121, "kinase_uniprot_canonical_ac": "P38111-1", "kinase_gene_name": "MEC1", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P32628", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P32628" }, { "database": "PubMed", "id": "18407956", "url": "https://pubmed.ncbi.nlm.nih.gov/18407956" }, { "database": "PubMed", "id": "20190278", "url": "https://pubmed.ncbi.nlm.nih.gov/20190278" }, { "database": "PubMed", "id": "21177495", "url": "https://pubmed.ncbi.nlm.nih.gov/21177495" } ], "site_lbl": "Ser121", "uniprot_canonical_ac": "P32628-1" }, { "start_pos": 121, "end_pos": 121, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P32628", "url": "https://www.uniprot.org/uniprotkb/P32628" }, { "database": "PubMed", "id": "18407956", "url": "https://pubmed.ncbi.nlm.nih.gov/18407956" }, { "database": "SGD", "id": "S000000763", "url": "https://www.yeastgenome.org/locus/S000000763" }, { "database": "iPTMnet", "id": "P32628", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P32628" }, { "database": "PubMed", "id": "20190278", "url": "https://pubmed.ncbi.nlm.nih.gov/20190278" }, { "database": "PubMed", "id": "23749301", "url": "https://pubmed.ncbi.nlm.nih.gov/23749301" }, { "database": "PubMed", "id": "33481703", "url": "https://pubmed.ncbi.nlm.nih.gov/33481703" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" } ], "site_lbl": "Ser121", "uniprot_canonical_ac": "P32628-1" }, { "start_pos": 132, "end_pos": 132, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P39009", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P39009" }, { "database": "PubMed", "id": "17114794", "url": "https://pubmed.ncbi.nlm.nih.gov/17114794" }, { "database": "PubMed", "id": "18407956", "url": "https://pubmed.ncbi.nlm.nih.gov/18407956" }, { "database": "PubMed", "id": "20190278", "url": "https://pubmed.ncbi.nlm.nih.gov/20190278" }, { "database": "SGD", "id": "S000002259", "url": "https://www.yeastgenome.org/locus/S000002259" }, { "database": "PubMed", "id": "33481703", "url": "https://pubmed.ncbi.nlm.nih.gov/33481703" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" } ], "site_lbl": "Ser132", "uniprot_canonical_ac": "P39009-1" }, { "start_pos": 139, "end_pos": 139, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P39009", "url": "https://www.uniprot.org/uniprotkb/P39009" }, { "database": "PubMed", "id": "18407956", "url": "https://pubmed.ncbi.nlm.nih.gov/18407956" }, { "database": "iPTMnet", "id": "P39009", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P39009" }, { "database": "PubMed", "id": "17114794", "url": "https://pubmed.ncbi.nlm.nih.gov/17114794" }, { "database": "PubMed", "id": "17563356", "url": "https://pubmed.ncbi.nlm.nih.gov/17563356" }, { "database": "PubMed", "id": "20190278", "url": "https://pubmed.ncbi.nlm.nih.gov/20190278" }, { "database": "PubMed", "id": "21126336", "url": "https://pubmed.ncbi.nlm.nih.gov/21126336" }, { "database": "PubMed", "id": "33600490", "url": "https://pubmed.ncbi.nlm.nih.gov/33600490" }, { "database": "SGD", "id": "S000002259", "url": "https://www.yeastgenome.org/locus/S000002259" }, { "database": "PubMed", "id": "23749301", "url": "https://pubmed.ncbi.nlm.nih.gov/23749301" }, { "database": "PubMed", "id": "32597660", "url": "https://pubmed.ncbi.nlm.nih.gov/32597660" }, { "database": "PubMed", "id": "33481703", "url": "https://pubmed.ncbi.nlm.nih.gov/33481703" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" } ], "site_lbl": "Ser139", "uniprot_canonical_ac": "P39009-1" }, { "start_pos": 224, "end_pos": 224, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "Q01560", "url": "https://www.uniprot.org/uniprotkb/Q01560" }, { "database": "PubMed", "id": "18407956", "url": "https://pubmed.ncbi.nlm.nih.gov/18407956" }, { "database": "PubMed", "id": "17330950", "url": "https://pubmed.ncbi.nlm.nih.gov/17330950" }, { "database": "PubMed", "id": "33856219", "url": "https://pubmed.ncbi.nlm.nih.gov/33856219" }, { "database": "PubMed", "id": "19779198", "url": "https://pubmed.ncbi.nlm.nih.gov/19779198" }, { "database": "iPTMnet", "id": "Q01560", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q01560" }, { "database": "PubMed", "id": "15665377", "url": "https://pubmed.ncbi.nlm.nih.gov/15665377" }, { "database": "PubMed", "id": "17563356", "url": "https://pubmed.ncbi.nlm.nih.gov/17563356" }, { "database": "PubMed", "id": "20190278", "url": "https://pubmed.ncbi.nlm.nih.gov/20190278" }, { "database": "PubMed", "id": "20702584", "url": "https://pubmed.ncbi.nlm.nih.gov/20702584" }, { "database": "PubMed", "id": "21126336", "url": "https://pubmed.ncbi.nlm.nih.gov/21126336" }, { "database": "PubMed", "id": "21177495", "url": "https://pubmed.ncbi.nlm.nih.gov/21177495" }, { "database": "PubMed", "id": "18818768", "url": "https://pubmed.ncbi.nlm.nih.gov/18818768" }, { "database": "SGD", "id": "S000002840", "url": "https://www.yeastgenome.org/locus/S000002840" }, { "database": "PubMed", "id": "22218487", "url": "https://pubmed.ncbi.nlm.nih.gov/22218487" }, { "database": "PubMed", "id": "23749301", "url": "https://pubmed.ncbi.nlm.nih.gov/23749301" }, { "database": "PubMed", "id": "32597660", "url": "https://pubmed.ncbi.nlm.nih.gov/32597660" }, { "database": "PubMed", "id": "33481703", "url": "https://pubmed.ncbi.nlm.nih.gov/33481703" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" } ], "site_lbl": "Ser224", "uniprot_canonical_ac": "Q01560-1" }, { "start_pos": 115, "end_pos": 115, "kinase_uniprot_canonical_ac": "P38110-1", "kinase_gene_name": "TEL1", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q06697", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q06697" }, { "database": "PubMed", "id": "20190278", "url": "https://pubmed.ncbi.nlm.nih.gov/20190278" } ], "site_lbl": "Ser115", "uniprot_canonical_ac": "Q06697-1" }, { "start_pos": 115, "end_pos": 115, "kinase_uniprot_canonical_ac": "P38111-1", "kinase_gene_name": "MEC1", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q06697", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q06697" }, { "database": "PubMed", "id": "20190278", "url": "https://pubmed.ncbi.nlm.nih.gov/20190278" } ], "site_lbl": "Ser115", "uniprot_canonical_ac": "Q06697-1" }, { "start_pos": 115, "end_pos": 115, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "SGD", "id": "S000004410", "url": "https://www.yeastgenome.org/locus/S000004410" }, { "database": "iPTMnet", "id": "Q06697", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q06697" }, { "database": "PubMed", "id": "20190278", "url": "https://pubmed.ncbi.nlm.nih.gov/20190278" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" } ], "site_lbl": "Ser115", "uniprot_canonical_ac": "Q06697-1" }, { "start_pos": 146, "end_pos": 146, "kinase_uniprot_canonical_ac": "P38110-1", "kinase_gene_name": "TEL1", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q12030", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q12030" }, { "database": "PubMed", "id": "18407956", "url": "https://pubmed.ncbi.nlm.nih.gov/18407956" }, { "database": "PubMed", "id": "20190278", "url": "https://pubmed.ncbi.nlm.nih.gov/20190278" } ], "site_lbl": "Ser146", "uniprot_canonical_ac": "Q12030-1" }, { "start_pos": 146, "end_pos": 146, "kinase_uniprot_canonical_ac": "P38111-1", "kinase_gene_name": "MEC1", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q12030", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q12030" }, { "database": "PubMed", "id": "18407956", "url": "https://pubmed.ncbi.nlm.nih.gov/18407956" }, { "database": "PubMed", "id": "20190278", "url": "https://pubmed.ncbi.nlm.nih.gov/20190278" } ], "site_lbl": "Ser146", "uniprot_canonical_ac": "Q12030-1" }, { "start_pos": 146, "end_pos": 146, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "Q12030", "url": "https://www.uniprot.org/uniprotkb/Q12030" }, { "database": "PubMed", "id": "18407956", "url": "https://pubmed.ncbi.nlm.nih.gov/18407956" }, { "database": "SGD", "id": "S000002574", "url": "https://www.yeastgenome.org/locus/S000002574" }, { "database": "iPTMnet", "id": "Q12030", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q12030" }, { "database": "PubMed", "id": "20190278", "url": "https://pubmed.ncbi.nlm.nih.gov/20190278" }, { "database": "PubMed", "id": "23749301", "url": "https://pubmed.ncbi.nlm.nih.gov/23749301" }, { "database": "PubMed", "id": "32597660", "url": "https://pubmed.ncbi.nlm.nih.gov/32597660" }, { "database": "PubMed", "id": "33481703", "url": "https://pubmed.ncbi.nlm.nih.gov/33481703" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" } ], "site_lbl": "Ser146", "uniprot_canonical_ac": "Q12030-1" }, { "start_pos": 725, "end_pos": 725, "kinase_uniprot_canonical_ac": "P38110-1", "kinase_gene_name": "TEL1", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q12098", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q12098" }, { "database": "PubMed", "id": "20190278", "url": "https://pubmed.ncbi.nlm.nih.gov/20190278" }, { "database": "PubMed", "id": "20670896", "url": "https://pubmed.ncbi.nlm.nih.gov/20670896" } ], "site_lbl": "Ser725", "uniprot_canonical_ac": "Q12098-1" }, { "start_pos": 725, "end_pos": 725, "kinase_uniprot_canonical_ac": "P38111-1", "kinase_gene_name": "MEC1", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q12098", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q12098" }, { "database": "PubMed", "id": "20190278", "url": "https://pubmed.ncbi.nlm.nih.gov/20190278" }, { "database": "PubMed", "id": "20670896", "url": "https://pubmed.ncbi.nlm.nih.gov/20670896" } ], "site_lbl": "Ser725", "uniprot_canonical_ac": "Q12098-1" }, { "start_pos": 725, "end_pos": 725, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "SGD", "id": "S000004125", "url": "https://www.yeastgenome.org/locus/S000004125" }, { "database": "iPTMnet", "id": "Q12098", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q12098" }, { "database": "PubMed", "id": "20190278", "url": "https://pubmed.ncbi.nlm.nih.gov/20190278" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" } ], "site_lbl": "Ser725", "uniprot_canonical_ac": "Q12098-1" }, { "start_pos": 108, "end_pos": 108, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q12315", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q12315" }, { "database": "PubMed", "id": "17563356", "url": "https://pubmed.ncbi.nlm.nih.gov/17563356" }, { "database": "PubMed", "id": "18407956", "url": "https://pubmed.ncbi.nlm.nih.gov/18407956" }, { "database": "PubMed", "id": "20190278", "url": "https://pubmed.ncbi.nlm.nih.gov/20190278" }, { "database": "SGD", "id": "S000002366", "url": "https://www.yeastgenome.org/locus/S000002366" }, { "database": "PubMed", "id": "23749301", "url": "https://pubmed.ncbi.nlm.nih.gov/23749301" }, { "database": "PubMed", "id": "33481703", "url": "https://pubmed.ncbi.nlm.nih.gov/33481703" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" } ], "site_lbl": "Ser108", "uniprot_canonical_ac": "Q12315-1" }, { "start_pos": 183, "end_pos": 183, "kinase_uniprot_canonical_ac": "P38110-1", "kinase_gene_name": "TEL1", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q04603", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q04603" }, { "database": "PubMed", "id": "17563356", "url": "https://pubmed.ncbi.nlm.nih.gov/17563356" }, { "database": "PubMed", "id": "20190278", "url": "https://pubmed.ncbi.nlm.nih.gov/20190278" }, { "database": "PubMed", "id": "21177495", "url": "https://pubmed.ncbi.nlm.nih.gov/21177495" } ], "site_lbl": "Ser183", "uniprot_canonical_ac": "Q04603-1" }, { "start_pos": 183, "end_pos": 183, "kinase_uniprot_canonical_ac": "P38111-1", "kinase_gene_name": "MEC1", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q04603", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q04603" }, { "database": "PubMed", "id": "17563356", "url": "https://pubmed.ncbi.nlm.nih.gov/17563356" }, { "database": "PubMed", "id": "20190278", "url": "https://pubmed.ncbi.nlm.nih.gov/20190278" }, { "database": "PubMed", "id": "21177495", "url": "https://pubmed.ncbi.nlm.nih.gov/21177495" } ], "site_lbl": "Ser183", "uniprot_canonical_ac": "Q04603-1" }, { "start_pos": 183, "end_pos": 183, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by ATM or ATR", "evidence": [ { "database": "UniProtKB", "id": "Q04603", "url": "https://www.uniprot.org/uniprotkb/Q04603" }, { "database": "SGD", "id": "S000002528", "url": "https://www.yeastgenome.org/locus/S000002528" }, { "database": "iPTMnet", "id": "Q04603", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q04603" }, { "database": "PubMed", "id": "17563356", "url": "https://pubmed.ncbi.nlm.nih.gov/17563356" }, { "database": "PubMed", "id": "18407956", "url": "https://pubmed.ncbi.nlm.nih.gov/18407956" }, { "database": "PubMed", "id": "20190278", "url": "https://pubmed.ncbi.nlm.nih.gov/20190278" }, { "database": "PubMed", "id": "23749301", "url": "https://pubmed.ncbi.nlm.nih.gov/23749301" }, { "database": "PubMed", "id": "32597660", "url": "https://pubmed.ncbi.nlm.nih.gov/32597660" }, { "database": "PubMed", "id": "33481703", "url": "https://pubmed.ncbi.nlm.nih.gov/33481703" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" } ], "site_lbl": "Ser183", "uniprot_canonical_ac": "Q04603-1" }, { "start_pos": 132, "end_pos": 132, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P32863", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P32863" }, { "database": "PubMed", "id": "17563356", "url": "https://pubmed.ncbi.nlm.nih.gov/17563356" }, { "database": "PubMed", "id": "18407956", "url": "https://pubmed.ncbi.nlm.nih.gov/18407956" }, { "database": "PubMed", "id": "19917248", "url": "https://pubmed.ncbi.nlm.nih.gov/19917248" }, { "database": "PubMed", "id": "20190278", "url": "https://pubmed.ncbi.nlm.nih.gov/20190278" }, { "database": "SGD", "id": "S000003131", "url": "https://www.yeastgenome.org/locus/S000003131" }, { "database": "PubMed", "id": "33481703", "url": "https://pubmed.ncbi.nlm.nih.gov/33481703" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" } ], "site_lbl": "Thr132", "uniprot_canonical_ac": "P32863-1" } ], "record_id": "pubmed.20190278", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 102 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 295 }, { "field": "total_sites", "count": 123 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "A large-scale method to measure absolute protein phosphorylation stoichiometries.", "journal": "Nature methods", "date": "2011-07-03", "authors": "Wu Ronghu, Haas Wilhelm, Dephoure Noah, Huttlin Edward L, Zhai Bo, Sowa Mathew E, Gygi Steven P", "reference": { "type": "PubMed", "id": "21725298", "url": "https://pubmed.ncbi.nlm.nih.gov/21725298" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P47134-1", "protein_name": "Chromosomal passenger complex protein BIR1", "gene_name": "BIR1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P53687-1", "protein_name": "NAD-dependent histone deacetylase HST3", "gene_name": "HST3", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q06340-1", "protein_name": "Protein ESC2", "gene_name": "ESC2", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P32566-1", "protein_name": "Cell wall assembly regulator SMI1", "gene_name": "SMI1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P34244-1", "protein_name": "Probable serine/threonine-protein kinase HSL1", "gene_name": "HSL1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P37370-1", "protein_name": "Verprolin", "gene_name": "VRP1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P53874-1", "protein_name": "Ubiquitin carboxyl-terminal hydrolase 10", "gene_name": "UBP10", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P38792-1", "protein_name": "Exosome complex component RRP4", "gene_name": "RRP4", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P38911-1", "protein_name": "Peptidyl-prolyl cis-trans isomerase", "gene_name": "FPR3", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q05791-1", "protein_name": "Translation initiation factor eIF2 assembly protein", "gene_name": "CDC123", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q12389-1", "protein_name": "ATP-dependent RNA helicase DBP10", "gene_name": "DBP10", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q04347-1", "protein_name": "Bud site selection protein 22", "gene_name": "BUD22", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P27637-1", "protein_name": "Bud site selection protein 14", "gene_name": "BUD14", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P38928-1", "protein_name": "Axial budding pattern protein 2", "gene_name": "AXL2", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q06344-1", "protein_name": "Pre-rRNA-processing protein ESF1", "gene_name": "ESF1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P04786-1", "protein_name": "DNA topoisomerase 1", "gene_name": "TOP1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P43573-1", "protein_name": "Bud site selection protein 27", "gene_name": "BUD27", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P53686-1", "protein_name": "NAD-dependent protein deacetylase HST2", "gene_name": "HST2", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q00684-1", "protein_name": "Tyrosine-protein phosphatase CDC14", "gene_name": "CDC14", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P23748-1", "protein_name": "M-phase inducer phosphatase", "gene_name": "MIH1", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P47134", "url": "https://www.uniprot.org/uniprotkb/P47134" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "phosphorylation": [ { "start_pos": 488, "end_pos": 488, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "SGD", "id": "S000003849", "url": "https://www.yeastgenome.org/locus/S000003849" }, { "database": "iPTMnet", "id": "P47134", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P47134" }, { "database": "PubMed", "id": "21725298", "url": "https://pubmed.ncbi.nlm.nih.gov/21725298" } ], "site_lbl": "Thr488", "uniprot_canonical_ac": "P47134-1" }, { "start_pos": 416, "end_pos": 416, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "SGD", "id": "S000005551", "url": "https://www.yeastgenome.org/locus/S000005551" }, { "database": "iPTMnet", "id": "P53687", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P53687" }, { "database": "PubMed", "id": "21725298", "url": "https://pubmed.ncbi.nlm.nih.gov/21725298" }, { "database": "PubMed", "id": "23749301", "url": "https://pubmed.ncbi.nlm.nih.gov/23749301" }, { "database": "PubMed", "id": "33481703", "url": "https://pubmed.ncbi.nlm.nih.gov/33481703" } ], "site_lbl": "Ser416", "uniprot_canonical_ac": "P53687-1" }, { "start_pos": 76, "end_pos": 76, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q06340", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q06340" }, { "database": "PubMed", "id": "19795423", "url": "https://pubmed.ncbi.nlm.nih.gov/19795423" }, { "database": "PubMed", "id": "19823750", "url": "https://pubmed.ncbi.nlm.nih.gov/19823750" }, { "database": "SGD", "id": "S000002771", "url": "https://www.yeastgenome.org/locus/S000002771" }, { "database": "PubMed", "id": "21725298", "url": "https://pubmed.ncbi.nlm.nih.gov/21725298" }, { "database": "PubMed", "id": "33481703", "url": "https://pubmed.ncbi.nlm.nih.gov/33481703" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" } ], "site_lbl": "Ser76", "uniprot_canonical_ac": "Q06340-1" }, { "start_pos": 376, "end_pos": 376, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine", "evidence": [ { "database": "UniProtKB", "id": "P32566", "url": "https://www.uniprot.org/uniprotkb/P32566" }, { "database": "PubMed", "id": "19779198", "url": "https://pubmed.ncbi.nlm.nih.gov/19779198" }, { "database": "iPTMnet", "id": "P32566", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P32566" }, { "database": "SGD", "id": "S000003461", "url": "https://www.yeastgenome.org/locus/S000003461" }, { "database": "PubMed", "id": "21725298", "url": "https://pubmed.ncbi.nlm.nih.gov/21725298" }, { "database": "PubMed", "id": "33481703", "url": "https://pubmed.ncbi.nlm.nih.gov/33481703" } ], "site_lbl": "Thr376", "uniprot_canonical_ac": "P32566-1" }, { "start_pos": 407, "end_pos": 407, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P34244", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P34244" }, { "database": "PubMed", "id": "20489023", "url": "https://pubmed.ncbi.nlm.nih.gov/20489023" }, { "database": "SGD", "id": "S000001584", "url": "https://www.yeastgenome.org/locus/S000001584" }, { "database": "PubMed", "id": "21725298", "url": "https://pubmed.ncbi.nlm.nih.gov/21725298" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" } ], "site_lbl": "Ser407", "uniprot_canonical_ac": "P34244-1" }, { "start_pos": 720, "end_pos": 720, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P37370", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P37370" }, { "database": "PubMed", "id": "11875433", "url": "https://pubmed.ncbi.nlm.nih.gov/11875433" }, { "database": "PubMed", "id": "18407956", "url": "https://pubmed.ncbi.nlm.nih.gov/18407956" }, { "database": "PubMed", "id": "19779198", "url": "https://pubmed.ncbi.nlm.nih.gov/19779198" }, { "database": "PubMed", "id": "21177495", "url": "https://pubmed.ncbi.nlm.nih.gov/21177495" }, { "database": "SGD", "id": "S000004329", "url": "https://www.yeastgenome.org/locus/S000004329" }, { "database": "PubMed", "id": "21725298", "url": "https://pubmed.ncbi.nlm.nih.gov/21725298" }, { "database": "PubMed", "id": "23749301", "url": "https://pubmed.ncbi.nlm.nih.gov/23749301" }, { "database": "PubMed", "id": "32597660", "url": "https://pubmed.ncbi.nlm.nih.gov/32597660" }, { "database": "PubMed", "id": "33481703", "url": "https://pubmed.ncbi.nlm.nih.gov/33481703" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" } ], "site_lbl": "Ser720", "uniprot_canonical_ac": "P37370-1" }, { "start_pos": 259, "end_pos": 259, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P53874", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P53874" }, { "database": "PubMed", "id": "20702584", "url": "https://pubmed.ncbi.nlm.nih.gov/20702584" }, { "database": "SGD", "id": "S000005130", "url": "https://www.yeastgenome.org/locus/S000005130" }, { "database": "PubMed", "id": "21725298", "url": "https://pubmed.ncbi.nlm.nih.gov/21725298" } ], "site_lbl": "Ser259", "uniprot_canonical_ac": "P53874-1" }, { "start_pos": 28, "end_pos": 28, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P38792", "url": "https://www.uniprot.org/uniprotkb/P38792" }, { "database": "PubMed", "id": "19779198", "url": "https://pubmed.ncbi.nlm.nih.gov/19779198" }, { "database": "PubMed", "id": "18407956", "url": "https://pubmed.ncbi.nlm.nih.gov/18407956" }, { "database": "iPTMnet", "id": "P38792", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P38792" }, { "database": "PubMed", "id": "19795423", "url": "https://pubmed.ncbi.nlm.nih.gov/19795423" }, { "database": "PubMed", "id": "19823750", "url": "https://pubmed.ncbi.nlm.nih.gov/19823750" }, { "database": "SGD", "id": "S000001111", "url": "https://www.yeastgenome.org/locus/S000001111" }, { "database": "PubMed", "id": "21725298", "url": "https://pubmed.ncbi.nlm.nih.gov/21725298" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" } ], "site_lbl": "Ser28", "uniprot_canonical_ac": "P38792-1" }, { "start_pos": 80, "end_pos": 80, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P38911", "url": "https://www.uniprot.org/uniprotkb/P38911" }, { "database": "PubMed", "id": "18407956", "url": "https://pubmed.ncbi.nlm.nih.gov/18407956" }, { "database": "PubMed", "id": "17330950", "url": "https://pubmed.ncbi.nlm.nih.gov/17330950" }, { "database": "PubMed", "id": "19779198", "url": "https://pubmed.ncbi.nlm.nih.gov/19779198" }, { "database": "iPTMnet", "id": "P38911", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P38911" }, { "database": "PubMed", "id": "19684113", "url": "https://pubmed.ncbi.nlm.nih.gov/19684113" }, { "database": "PubMed", "id": "19795423", "url": "https://pubmed.ncbi.nlm.nih.gov/19795423" }, { "database": "PubMed", "id": "19823750", "url": "https://pubmed.ncbi.nlm.nih.gov/19823750" }, { "database": "PubMed", "id": "20489023", "url": "https://pubmed.ncbi.nlm.nih.gov/20489023" }, { "database": "PubMed", "id": "21177495", "url": "https://pubmed.ncbi.nlm.nih.gov/21177495" }, { "database": "SGD", "id": "S000004539", "url": "https://www.yeastgenome.org/locus/S000004539" }, { "database": "PubMed", "id": "21725298", "url": "https://pubmed.ncbi.nlm.nih.gov/21725298" }, { "database": "PubMed", "id": "30516470", "url": "https://pubmed.ncbi.nlm.nih.gov/30516470" }, { "database": "PubMed", "id": "33481703", "url": "https://pubmed.ncbi.nlm.nih.gov/33481703" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" } ], "site_lbl": "Ser80", "uniprot_canonical_ac": "P38911-1" }, { "start_pos": 353, "end_pos": 353, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q05791", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q05791" }, { "database": "PubMed", "id": "19684113", "url": "https://pubmed.ncbi.nlm.nih.gov/19684113" }, { "database": "PubMed", "id": "19779198", "url": "https://pubmed.ncbi.nlm.nih.gov/19779198" }, { "database": "SGD", "id": "S000004205", "url": "https://www.yeastgenome.org/locus/S000004205" }, { "database": "PubMed", "id": "21725298", "url": "https://pubmed.ncbi.nlm.nih.gov/21725298" }, { "database": "PubMed", "id": "23749301", "url": "https://pubmed.ncbi.nlm.nih.gov/23749301" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" } ], "site_lbl": "Ser353", "uniprot_canonical_ac": "Q05791-1" }, { "start_pos": 392, "end_pos": 392, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q12389", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q12389" }, { "database": "PubMed", "id": "20702584", "url": "https://pubmed.ncbi.nlm.nih.gov/20702584" }, { "database": "SGD", "id": "S000002189", "url": "https://www.yeastgenome.org/locus/S000002189" }, { "database": "PubMed", "id": "21725298", "url": "https://pubmed.ncbi.nlm.nih.gov/21725298" } ], "site_lbl": "Ser392", "uniprot_canonical_ac": "Q12389-1" }, { "start_pos": 255, "end_pos": 255, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q04347", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q04347" }, { "database": "PubMed", "id": "18407956", "url": "https://pubmed.ncbi.nlm.nih.gov/18407956" }, { "database": "SGD", "id": "S000004616", "url": "https://www.yeastgenome.org/locus/S000004616" }, { "database": "PubMed", "id": "21725298", "url": "https://pubmed.ncbi.nlm.nih.gov/21725298" }, { "database": "PubMed", "id": "32597660", "url": "https://pubmed.ncbi.nlm.nih.gov/32597660" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" } ], "site_lbl": "Tyr255", "uniprot_canonical_ac": "Q04347-1" }, { "start_pos": 221, "end_pos": 221, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P27637", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P27637" }, { "database": "PubMed", "id": "19795423", "url": "https://pubmed.ncbi.nlm.nih.gov/19795423" }, { "database": "PubMed", "id": "19823750", "url": "https://pubmed.ncbi.nlm.nih.gov/19823750" }, { "database": "SGD", "id": "S000000069", "url": "https://www.yeastgenome.org/locus/S000000069" }, { "database": "PubMed", "id": "21725298", "url": "https://pubmed.ncbi.nlm.nih.gov/21725298" }, { "database": "PubMed", "id": "24909858", "url": "https://pubmed.ncbi.nlm.nih.gov/24909858" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" } ], "site_lbl": "Tyr221", "uniprot_canonical_ac": "P27637-1" }, { "start_pos": 604, "end_pos": 604, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "SGD", "id": "S000001402", "url": "https://www.yeastgenome.org/locus/S000001402" }, { "database": "iPTMnet", "id": "P38928", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P38928" }, { "database": "PubMed", "id": "21725298", "url": "https://pubmed.ncbi.nlm.nih.gov/21725298" } ], "site_lbl": "Ser604", "uniprot_canonical_ac": "P38928-1" }, { "start_pos": 225, "end_pos": 225, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "Q06344", "url": "https://www.uniprot.org/uniprotkb/Q06344" }, { "database": "PubMed", "id": "17287358", "url": "https://pubmed.ncbi.nlm.nih.gov/17287358" }, { "database": "PubMed", "id": "18407956", "url": "https://pubmed.ncbi.nlm.nih.gov/18407956" }, { "database": "PubMed", "id": "19779198", "url": "https://pubmed.ncbi.nlm.nih.gov/19779198" }, { "database": "PubMed", "id": "17330950", "url": "https://pubmed.ncbi.nlm.nih.gov/17330950" }, { "database": "iPTMnet", "id": "Q06344", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q06344" }, { "database": "PubMed", "id": "19684113", "url": "https://pubmed.ncbi.nlm.nih.gov/19684113" }, { "database": "PubMed", "id": "19795423", "url": "https://pubmed.ncbi.nlm.nih.gov/19795423" }, { "database": "PubMed", "id": "19823750", "url": "https://pubmed.ncbi.nlm.nih.gov/19823750" }, { "database": "PubMed", "id": "20702584", "url": "https://pubmed.ncbi.nlm.nih.gov/20702584" }, { "database": "PubMed", "id": "21177495", "url": "https://pubmed.ncbi.nlm.nih.gov/21177495" }, { "database": "SGD", "id": "S000002773", "url": "https://www.yeastgenome.org/locus/S000002773" }, { "database": "PubMed", "id": "21725298", "url": "https://pubmed.ncbi.nlm.nih.gov/21725298" }, { "database": "PubMed", "id": "22218487", "url": "https://pubmed.ncbi.nlm.nih.gov/22218487" }, { "database": "PubMed", "id": "23749301", "url": "https://pubmed.ncbi.nlm.nih.gov/23749301" }, { "database": "PubMed", "id": "30516470", "url": "https://pubmed.ncbi.nlm.nih.gov/30516470" }, { "database": "PubMed", "id": "33481703", "url": "https://pubmed.ncbi.nlm.nih.gov/33481703" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" } ], "site_lbl": "Ser225", "uniprot_canonical_ac": "Q06344-1" }, { "start_pos": 47, "end_pos": 47, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P04786", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P04786" }, { "database": "PubMed", "id": "17330950", "url": "https://pubmed.ncbi.nlm.nih.gov/17330950" }, { "database": "PubMed", "id": "19779198", "url": "https://pubmed.ncbi.nlm.nih.gov/19779198" }, { "database": "PubMed", "id": "19795423", "url": "https://pubmed.ncbi.nlm.nih.gov/19795423" }, { "database": "PubMed", "id": "19823750", "url": "https://pubmed.ncbi.nlm.nih.gov/19823750" }, { "database": "PubMed", "id": "20702584", "url": "https://pubmed.ncbi.nlm.nih.gov/20702584" }, { "database": "SGD", "id": "S000005366", "url": "https://www.yeastgenome.org/locus/S000005366" }, { "database": "PubMed", "id": "21725298", "url": "https://pubmed.ncbi.nlm.nih.gov/21725298" }, { "database": "PubMed", "id": "33481703", "url": "https://pubmed.ncbi.nlm.nih.gov/33481703" } ], "site_lbl": "Tyr47", "uniprot_canonical_ac": "P04786-1" }, { "start_pos": 584, "end_pos": 584, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P43573", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P43573" }, { "database": "PubMed", "id": "19779198", "url": "https://pubmed.ncbi.nlm.nih.gov/19779198" }, { "database": "SGD", "id": "S000001871", "url": "https://www.yeastgenome.org/locus/S000001871" }, { "database": "PubMed", "id": "21725298", "url": "https://pubmed.ncbi.nlm.nih.gov/21725298" }, { "database": "PubMed", "id": "22218487", "url": "https://pubmed.ncbi.nlm.nih.gov/22218487" } ], "site_lbl": "Tyr584", "uniprot_canonical_ac": "P43573-1" }, { "start_pos": 340, "end_pos": 340, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P53686", "url": "https://www.uniprot.org/uniprotkb/P53686" }, { "database": "PubMed", "id": "18407956", "url": "https://pubmed.ncbi.nlm.nih.gov/18407956" }, { "database": "iPTMnet", "id": "P53686", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P53686" }, { "database": "PubMed", "id": "19795423", "url": "https://pubmed.ncbi.nlm.nih.gov/19795423" }, { "database": "PubMed", "id": "19823750", "url": "https://pubmed.ncbi.nlm.nih.gov/19823750" }, { "database": "SGD", "id": "S000005936", "url": "https://www.yeastgenome.org/locus/S000005936" }, { "database": "PubMed", "id": "21725298", "url": "https://pubmed.ncbi.nlm.nih.gov/21725298" }, { "database": "PubMed", "id": "23749301", "url": "https://pubmed.ncbi.nlm.nih.gov/23749301" }, { "database": "PubMed", "id": "32597660", "url": "https://pubmed.ncbi.nlm.nih.gov/32597660" }, { "database": "PubMed", "id": "33481703", "url": "https://pubmed.ncbi.nlm.nih.gov/33481703" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" } ], "site_lbl": "Ser340", "uniprot_canonical_ac": "P53686-1" }, { "start_pos": 478, "end_pos": 478, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q00684", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q00684" }, { "database": "PubMed", "id": "19779198", "url": "https://pubmed.ncbi.nlm.nih.gov/19779198" }, { "database": "SGD", "id": "S000001924", "url": "https://www.yeastgenome.org/locus/S000001924" }, { "database": "PubMed", "id": "21725298", "url": "https://pubmed.ncbi.nlm.nih.gov/21725298" }, { "database": "PubMed", "id": "22031224", "url": "https://pubmed.ncbi.nlm.nih.gov/22031224" } ], "site_lbl": "Thr478", "uniprot_canonical_ac": "Q00684-1" }, { "start_pos": 82, "end_pos": 82, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "SGD", "id": "S000004639", "url": "https://www.yeastgenome.org/locus/S000004639" }, { "database": "iPTMnet", "id": "P23748", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P23748" }, { "database": "PubMed", "id": "21725298", "url": "https://pubmed.ncbi.nlm.nih.gov/21725298" }, { "database": "PubMed", "id": "23749301", "url": "https://pubmed.ncbi.nlm.nih.gov/23749301" }, { "database": "PubMed", "id": "33481703", "url": "https://pubmed.ncbi.nlm.nih.gov/33481703" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" } ], "site_lbl": "Ser82", "uniprot_canonical_ac": "P23748-1" } ], "record_id": "pubmed.21725298", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 20 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 20 }, { "field": "total_sites", "count": 20 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Endosome-associated complex, ESCRT-II, recruits transport machinery for protein sorting at the multivesicular body.", "journal": "Developmental cell", "date": "2002-08", "authors": "Babst Markus, Katzmann David J, Snyder William B, Wendland Beverly, Emr Scott D", "reference": { "type": "PubMed", "id": "12194858", "url": "https://pubmed.ncbi.nlm.nih.gov/12194858" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P47142-1", "protein_name": "Vacuolar protein-sorting-associated protein 25", "gene_name": "VPS25", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q12483-1", "protein_name": "Vacuolar-sorting protein SNF8", "gene_name": "SNF8", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q06696-1", "protein_name": "Vacuolar protein-sorting-associated protein 36", "gene_name": "VPS36", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P47142", "url": "https://www.uniprot.org/uniprotkb/P47142" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.12194858", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Structure of the ESCRT-II endosomal trafficking complex.", "journal": "Nature", "date": "2004", "authors": "Hierro Aitor, Sun Ji, Rusnak Alexander S, Kim Jaewon, Prag Gali, Emr Scott D, Hurley James H", "reference": { "type": "PubMed", "id": "15329733", "url": "https://pubmed.ncbi.nlm.nih.gov/15329733" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P47142-1", "protein_name": "Vacuolar protein-sorting-associated protein 25", "gene_name": "VPS25", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q12483-1", "protein_name": "Vacuolar-sorting protein SNF8", "gene_name": "SNF8", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q06696-1", "protein_name": "Vacuolar protein-sorting-associated protein 36", "gene_name": "VPS36", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P47142", "url": "https://www.uniprot.org/uniprotkb/P47142" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.15329733", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "ESCRT-II, an endosome-associated complex required for protein sorting: crystal structure and interactions with ESCRT-III and membranes.", "journal": "Dev. Cell", "date": "2004", "authors": "Teo Hsiangling, Perisic Olga, Gonz\u00e1lez Beatriz, Williams Roger L", "reference": { "type": "PubMed", "id": "15469844", "url": "https://pubmed.ncbi.nlm.nih.gov/15469844" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P47142-1", "protein_name": "Vacuolar protein-sorting-associated protein 25", "gene_name": "VPS25", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q04272-1", "protein_name": "Vacuolar protein sorting-associated protein 20", "gene_name": "VPS20", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q12483-1", "protein_name": "Vacuolar-sorting protein SNF8", "gene_name": "SNF8", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q06696-1", "protein_name": "Vacuolar protein-sorting-associated protein 36", "gene_name": "VPS36", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P47142", "url": "https://www.uniprot.org/uniprotkb/P47142" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.15469844", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 4 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Crystal structure of subunit VPS25 of the endosomal trafficking complex ESCRT-II.", "journal": "BMC Struct. Biol.", "date": "2004", "authors": "Wernimont Amy K, Weissenhorn Winfried", "reference": { "type": "PubMed", "id": "15579210", "url": "https://pubmed.ncbi.nlm.nih.gov/15579210" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P47142-1", "protein_name": "Vacuolar protein-sorting-associated protein 25", "gene_name": "VPS25", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P47142", "url": "https://www.uniprot.org/uniprotkb/P47142" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.15579210", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Role of adenosine kinase in Saccharomyces cerevisiae: identification of the ADO1 gene and study of the mutant phenotypes.", "journal": "Yeast", "date": "2001", "authors": "Lecoq K, Belloc I, Desgranges C, Daignan-Fornier B", "reference": { "type": "PubMed", "id": "11223943", "url": "https://pubmed.ncbi.nlm.nih.gov/11223943" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P47143-1", "protein_name": "Adenosine kinase", "gene_name": "ADO1", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P47143", "url": "https://www.uniprot.org/uniprotkb/P47143" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.11223943", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Expression in Escherichia coli of a recombinant adenosine kinase from Saccharomyces cerevisiae: purification, kinetics and substrate analyses.", "journal": "Yeast (Chichester, England)", "date": "2003-10-15", "authors": "Barrado Patricia, Rodr\u00edguez Mar\u00eda Jos\u00e9, Jim\u00e9nez Antonio, Fern\u00e1ndez Lobato Mar\u00eda", "reference": { "type": "PubMed", "id": "14558146", "url": "https://pubmed.ncbi.nlm.nih.gov/14558146" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P47143-1", "protein_name": "Adenosine kinase", "gene_name": "ADO1", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P47143", "url": "https://www.uniprot.org/uniprotkb/P47143" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.14558146", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Reconstitution of the Ste24p-dependent N-terminal proteolytic step in yeast a-factor biogenesis.", "journal": "The Journal of biological chemistry", "date": "2000-03-03", "authors": "Schmidt W K, Tam A, Michaelis S", "reference": { "type": "PubMed", "id": "10692417", "url": "https://pubmed.ncbi.nlm.nih.gov/10692417" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P47154-1", "protein_name": "CAAX prenyl protease 1", "gene_name": "STE24", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P47154", "url": "https://www.uniprot.org/uniprotkb/P47154" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.10692417", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The CaaX proteases, Afc1p and Rce1p, have overlapping but distinct substrate specificities.", "journal": "Molecular and cellular biology", "date": "2000-06", "authors": "Trueblood C E, Boyartchuk V L, Picologlou E A, Rozema D, Poulter C D, Rine J", "reference": { "type": "PubMed", "id": "10825201", "url": "https://pubmed.ncbi.nlm.nih.gov/10825201" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P47154-1", "protein_name": "CAAX prenyl protease 1", "gene_name": "STE24", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q03530-1", "protein_name": "CAAX prenyl protease 2", "gene_name": "RCE1", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P47154", "url": "https://www.uniprot.org/uniprotkb/P47154" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.10825201", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The multispanning membrane protein Ste24p catalyzes CAAX proteolysis and NH2-terminal processing of the yeast a-factor precursor.", "journal": "J. Biol. Chem.", "date": "2001", "authors": "Tam A, Schmidt W K, Michaelis S", "reference": { "type": "PubMed", "id": "11581258", "url": "https://pubmed.ncbi.nlm.nih.gov/11581258" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P47154-1", "protein_name": "CAAX prenyl protease 1", "gene_name": "STE24", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P34165-1", "protein_name": "Mating hormone A-factor 1", "gene_name": "MFA1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P34166-1", "protein_name": "Mating hormone A-factor 2", "gene_name": "MFA2", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q03530-1", "protein_name": "CAAX prenyl protease 2", "gene_name": "RCE1", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P47154", "url": "https://www.uniprot.org/uniprotkb/P47154" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.11581258", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 4 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Analysis of prelamin A biogenesis reveals the nucleus to be a CaaX processing compartment.", "journal": "Mol. Biol. Cell", "date": "2008", "authors": "Michaelis S., Barrowman J., Hamblet C., George C.M.", "reference": { "type": "PubMed", "id": "18923140", "url": "https://pubmed.ncbi.nlm.nih.gov/18923140" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P47154-1", "protein_name": "CAAX prenyl protease 1", "gene_name": "STE24", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P32584-1", "protein_name": "Protein-S-isoprenylcysteine O-methyltransferase", "gene_name": "STE14", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P47154", "url": "https://www.uniprot.org/uniprotkb/P47154" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.18923140", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The Protease Ste24 Clears Clogged Translocons.", "journal": "Cell", "date": "2016-01-14", "authors": "Ast Tslil, Michaelis Susan, Schuldiner Maya", "reference": { "type": "PubMed", "id": "26771486", "url": "https://pubmed.ncbi.nlm.nih.gov/26771486" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P47154-1", "protein_name": "CAAX prenyl protease 1", "gene_name": "STE24", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P47154", "url": "https://www.uniprot.org/uniprotkb/P47154" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.26771486", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Ste24p Mediates Proteolysis of Both Isoprenylated and Non-prenylated Oligopeptides.", "journal": "The Journal of biological chemistry", "date": "2016-07-01", "authors": "Hildebrandt Emily R, Arachea Buenafe T, Wiener Michael C, Schmidt Walter K", "reference": { "type": "PubMed", "id": "27129777", "url": "https://pubmed.ncbi.nlm.nih.gov/27129777" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P47154-1", "protein_name": "CAAX prenyl protease 1", "gene_name": "STE24", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P47154", "url": "https://www.uniprot.org/uniprotkb/P47154" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.27129777", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The ER-associated protease Ste24 prevents N-terminal signal peptide-independent translocation into the endoplasmic reticulum in Saccharomyces cerevisiae.", "journal": "The Journal of biological chemistry", "date": "2020-07-24", "authors": "Hosomi Akira, Iida Kazuko, Cho Toshihiko, Iida Hidetoshi, Kaneko Masashi, Suzuki Tadashi", "reference": { "type": "PubMed", "id": "32513868", "url": "https://pubmed.ncbi.nlm.nih.gov/32513868" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P47154-1", "protein_name": "CAAX prenyl protease 1", "gene_name": "STE24", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P47154", "url": "https://www.uniprot.org/uniprotkb/P47154" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.32513868", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "A novel membrane-associated metalloprotease, Ste24p, is required for the first step of NH2-terminal processing of the yeast a-factor precursor.", "journal": "The Journal of cell biology", "date": "1997-01-27", "authors": "Fujimura-Kamada K, Nouvet F J, Michaelis S", "reference": { "type": "PubMed", "id": "9015299", "url": "https://pubmed.ncbi.nlm.nih.gov/9015299" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P47154-1", "protein_name": "CAAX prenyl protease 1", "gene_name": "STE24", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P47154", "url": "https://www.uniprot.org/uniprotkb/P47154" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.9015299", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Modulation of Ras and a-factor function by carboxyl-terminal proteolysis.", "journal": "Science (New York, N.Y.)", "date": "1997-03-21", "authors": "Boyartchuk V L, Ashby M N, Rine J", "reference": { "type": "PubMed", "id": "9065405", "url": "https://pubmed.ncbi.nlm.nih.gov/9065405" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P47154-1", "protein_name": "CAAX prenyl protease 1", "gene_name": "STE24", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q03530-1", "protein_name": "CAAX prenyl protease 2", "gene_name": "RCE1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P01119-1", "protein_name": "Ras-like protein 1", "gene_name": "RAS1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P01120-1", "protein_name": "Ras-like protein 2", "gene_name": "RAS2", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P47154", "url": "https://www.uniprot.org/uniprotkb/P47154" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.9065405", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 4 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Dual roles for Ste24p in yeast a-factor maturation: NH2-terminal proteolysis and COOH-terminal CAAX processing.", "journal": "The Journal of cell biology", "date": "1998-08-10", "authors": "Tam A, Nouvet F J, Fujimura-Kamada K, Slunt H, Sisodia S S, Michaelis S", "reference": { "type": "PubMed", "id": "9700155", "url": "https://pubmed.ncbi.nlm.nih.gov/9700155" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P47154-1", "protein_name": "CAAX prenyl protease 1", "gene_name": "STE24", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "O75844-1", "protein_name": "CAAX prenyl protease 1 homolog", "gene_name": "ZMPSTE24", "tax_name": "Human" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P47154", "url": "https://www.uniprot.org/uniprotkb/P47154" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.9700155", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Roles of prenyl protein proteases in maturation of Saccharomyces cerevisiae a-factor.", "journal": "Genetics", "date": "1998-09", "authors": "Boyartchuk V L, Rine J", "reference": { "type": "PubMed", "id": "9725832", "url": "https://pubmed.ncbi.nlm.nih.gov/9725832" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P47154-1", "protein_name": "CAAX prenyl protease 1", "gene_name": "STE24", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P47154", "url": "https://www.uniprot.org/uniprotkb/P47154" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.9725832", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Endoplasmic reticulum membrane localization of Rce1p and Ste24p, yeast proteases involved in carboxyl-terminal CAAX protein processing and amino-terminal a-factor cleavage.", "journal": "Proc. Natl. Acad. Sci. U.S.A.", "date": "1998", "authors": "Schmidt W K, Tam A, Fujimura-Kamada K, Michaelis S", "reference": { "type": "PubMed", "id": "9736709", "url": "https://pubmed.ncbi.nlm.nih.gov/9736709" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P47154-1", "protein_name": "CAAX prenyl protease 1", "gene_name": "STE24", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q03530-1", "protein_name": "CAAX prenyl protease 2", "gene_name": "RCE1", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P47154", "url": "https://www.uniprot.org/uniprotkb/P47154" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.9736709", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Phosphorylation of Jhd2 by the Ras-cAMP-PKA(Tpk2) pathway regulates histone modifications and autophagy.", "journal": "Nature communications", "date": "2022-09-27", "authors": "Yu Qi, Gong Xuanyunjing, Tong Yue, Wang Min, Duan Kai, Zhang Xinyu, Ge Feng, Yu Xilan, Li Shanshan", "reference": { "type": "PubMed", "id": "36167807", "url": "https://pubmed.ncbi.nlm.nih.gov/36167807" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P47156-1", "protein_name": "Histone demethylase JHD2", "gene_name": "JHD2", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P47156", "url": "https://www.uniprot.org/uniprotkb/P47156" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "phosphorylation": [ { "start_pos": 321, "end_pos": 321, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P47156", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P47156" }, { "database": "PubMed", "id": "36167807", "url": "https://pubmed.ncbi.nlm.nih.gov/36167807" }, { "database": "SGD", "id": "S000003880", "url": "https://www.yeastgenome.org/locus/S000003880" } ], "site_lbl": "Ser321", "uniprot_canonical_ac": "P47156-1" }, { "start_pos": 340, "end_pos": 340, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P47156", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P47156" }, { "database": "PubMed", "id": "36167807", "url": "https://pubmed.ncbi.nlm.nih.gov/36167807" }, { "database": "SGD", "id": "S000003880", "url": "https://www.yeastgenome.org/locus/S000003880" }, { "database": "PubMed", "id": "33334889", "url": "https://pubmed.ncbi.nlm.nih.gov/33334889" }, { "database": "PubMed", "id": "35183557", "url": "https://pubmed.ncbi.nlm.nih.gov/35183557" } ], "site_lbl": "Ser340", "uniprot_canonical_ac": "P47156-1" } ], "record_id": "pubmed.36167807", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Genome-wide analysis of yeast transcription upon calcium shortage.", "journal": "Cell Calcium", "date": "2002", "authors": "Lombard\u00eda L J, Becerra M, Rodr\u00edguez-Belmonte E, Hauser N C, Cerd\u00e1n M E", "reference": { "type": "PubMed", "id": "12161108", "url": "https://pubmed.ncbi.nlm.nih.gov/12161108" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P47158-1", "protein_name": "Iron-sulfur cluster assembly factor IBA57, mitochondrial", "gene_name": "IBA57", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P40893-1", "protein_name": "Regulation of enolase protein 1", "gene_name": "REE1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q08993-1", "protein_name": "Putative uncharacterized protein YPR202W", "gene_name": "P9677.1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q06058-1", "protein_name": "Seipin", "gene_name": "SEI1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P39943-1", "protein_name": "Transcription corepressor MIG3", "gene_name": "MIG3", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q04418-1", "protein_name": "RNA polymerase II-associated protein RBA50", "gene_name": "RBA50", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P47158", "url": "https://www.uniprot.org/uniprotkb/P47158" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.12161108", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 6 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Systematic mutagenesis of the leucine-rich repeat (LRR) domain of CCR4 reveals specific sites for binding to CAF1 and a separate critical role for the LRR in CCR4 deadenylase activity.", "journal": "J. Biol. Chem.", "date": "2004", "authors": "Clark Lisa B, Viswanathan Palaniswamy, Quigley Gloria, Chiang Yueh-Chin, McMahon Jeffrey S, Yao Gang, Chen Junji, Nelsbach Andreas, Denis Clyde L", "reference": { "type": "PubMed", "id": "14734555", "url": "https://pubmed.ncbi.nlm.nih.gov/14734555" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P47158-1", "protein_name": "Iron-sulfur cluster assembly factor IBA57, mitochondrial", "gene_name": "IBA57", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P47158", "url": "https://www.uniprot.org/uniprotkb/P47158" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.14734555", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Mitochondrial Iba57p is required for Fe/S cluster formation on aconitase and activation of radical SAM enzymes.", "journal": "Molecular and cellular biology", "date": "2008-03", "authors": "Gelling Cristy, Dawes Ian W, Richhardt Nadine, Lill Roland, M\u00fchlenhoff Ulrich", "reference": { "type": "PubMed", "id": "18086897", "url": "https://pubmed.ncbi.nlm.nih.gov/18086897" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P47158-1", "protein_name": "Iron-sulfur cluster assembly factor IBA57, mitochondrial", "gene_name": "IBA57", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P47158", "url": "https://www.uniprot.org/uniprotkb/P47158" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.18086897", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Yeast epsin-related proteins required for Golgi-endosome traffic define a gamma-adaptin ear-binding motif.", "journal": "Nature cell biology", "date": "2003-01", "authors": "Duncan Mara C, Costaguta Giancarlo, Payne Gregory S", "reference": { "type": "PubMed", "id": "12483220", "url": "https://pubmed.ncbi.nlm.nih.gov/12483220" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P47160-1", "protein_name": "Epsin-3", "gene_name": "ENT3", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q03769-1", "protein_name": "Epsin-5", "gene_name": "ENT5", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P38817-1", "protein_name": "ADP-ribosylation factor-binding protein GGA2", "gene_name": "GGA2", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P47160", "url": "https://www.uniprot.org/uniprotkb/P47160" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "mutagenesis": [ { "start_pos": 272, "end_pos": 272, "sequence_org": "F", "sequence_mut": "A", "comment": "Reduced binding to GGA2.", "evidence": [ { "database": "UniProtKB", "id": "P47160", "url": "https://www.uniprot.org/uniprotkb/P47160" }, { "database": "PubMed", "id": "12483220", "url": "https://pubmed.ncbi.nlm.nih.gov/12483220" } ], "uniprot_canonical_ac": "P47160-1" }, { "start_pos": 275, "end_pos": 275, "sequence_org": "F", "sequence_mut": "A", "comment": "Reduced binding to GGA2.", "evidence": [ { "database": "UniProtKB", "id": "P47160", "url": "https://www.uniprot.org/uniprotkb/P47160" }, { "database": "PubMed", "id": "12483220", "url": "https://pubmed.ncbi.nlm.nih.gov/12483220" } ], "uniprot_canonical_ac": "P47160-1" }, { "start_pos": 331, "end_pos": 331, "sequence_org": "F", "sequence_mut": "A", "comment": "Reduced binding to GGA2.", "evidence": [ { "database": "UniProtKB", "id": "Q03769", "url": "https://www.uniprot.org/uniprotkb/Q03769" }, { "database": "PubMed", "id": "12483220", "url": "https://pubmed.ncbi.nlm.nih.gov/12483220" } ], "uniprot_canonical_ac": "Q03769-1" }, { "start_pos": 334, "end_pos": 334, "sequence_org": "F", "sequence_mut": "A", "comment": "Reduced binding to GGA2.", "evidence": [ { "database": "UniProtKB", "id": "Q03769", "url": "https://www.uniprot.org/uniprotkb/Q03769" }, { "database": "PubMed", "id": "12483220", "url": "https://pubmed.ncbi.nlm.nih.gov/12483220" } ], "uniprot_canonical_ac": "Q03769-1" }, { "start_pos": 560, "end_pos": 560, "sequence_org": "K", "sequence_mut": "Q", "comment": "Reduced binding to ENT3.", "evidence": [ { "database": "UniProtKB", "id": "P38817", "url": "https://www.uniprot.org/uniprotkb/P38817" }, { "database": "PubMed", "id": "12483220", "url": "https://pubmed.ncbi.nlm.nih.gov/12483220" } ], "uniprot_canonical_ac": "P38817-1" }, { "start_pos": 563, "end_pos": 563, "sequence_org": "W", "sequence_mut": "A", "comment": "Reduced binding to ENT3 and ENT5.", "evidence": [ { "database": "UniProtKB", "id": "P38817", "url": "https://www.uniprot.org/uniprotkb/P38817" }, { "database": "PubMed", "id": "12483220", "url": "https://pubmed.ncbi.nlm.nih.gov/12483220" } ], "uniprot_canonical_ac": "P38817-1" }, { "start_pos": 564, "end_pos": 564, "sequence_org": "K", "sequence_mut": "Q", "comment": "Reduced binding to ENT3 and ENT5.", "evidence": [ { "database": "UniProtKB", "id": "P38817", "url": "https://www.uniprot.org/uniprotkb/P38817" }, { "database": "PubMed", "id": "12483220", "url": "https://pubmed.ncbi.nlm.nih.gov/12483220" } ], "uniprot_canonical_ac": "P38817-1" } ], "record_id": "pubmed.12483220", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Ent5p is required with Ent3p and Vps27p for ubiquitin-dependent protein sorting into the multivesicular body.", "journal": "Molecular biology of the cell", "date": "2004-07", "authors": "Eugster Anne, P\u00e9cheur Eve-Isabelle, Michel Fabrice, Winsor Barbara, Letourneur Fran\u00e7ois, Friant Sylvie", "reference": { "type": "PubMed", "id": "15107463", "url": "https://pubmed.ncbi.nlm.nih.gov/15107463" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P47160-1", "protein_name": "Epsin-3", "gene_name": "ENT3", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q03769-1", "protein_name": "Epsin-5", "gene_name": "ENT5", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P40343-1", "protein_name": "Vacuolar protein sorting-associated protein 27", "gene_name": "VPS27", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P47160", "url": "https://www.uniprot.org/uniprotkb/P47160" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.15107463", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Identifying protein kinase-specific effectors of the osmostress response in yeast.", "journal": "Science signaling", "date": "2017-03-07", "authors": "Romanov Natalie, Hollenstein David Maria, Janschitz Marion, Ammerer Gustav, Anrather Dorothea, Reiter Wolfgang", "reference": { "type": "PubMed", "id": "28270554", "url": "https://pubmed.ncbi.nlm.nih.gov/28270554" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P47160-1", "protein_name": "Epsin-3", "gene_name": "ENT3", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P53244-1", "protein_name": "Arrestin-related trafficking adapter 5", "gene_name": "ART5", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P53599-1", "protein_name": "MAP kinase kinase kinase SSK2", "gene_name": "SSK2", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q02805-1", "protein_name": "Protein ROD1", "gene_name": "ROD1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P32356-1", "protein_name": "Cytosolic neutral trehalase", "gene_name": "NTH1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P34219-1", "protein_name": "Transcriptional regulatory protein TOD6", "gene_name": "TOD6", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P38041-1", "protein_name": "BEM1-interacting protein 1", "gene_name": "BOI1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P38427-1", "protein_name": "Trehalose synthase complex regulatory subunit TSL1", "gene_name": "TSL1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P38623-1", "protein_name": "Serine/threonine-protein kinase RCK2", "gene_name": "RCK2", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q06146-1", "protein_name": "Uncharacterized protein YLR257W", "gene_name": "", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P54787-1", "protein_name": "Vacuolar protein sorting-associated protein 9", "gene_name": "VPS9", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q02100-1", "protein_name": "CRE-binding bZIP protein SKO1", "gene_name": "SKO1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P38970-1", "protein_name": "Serine/threonine-protein kinase HAL5", "gene_name": "HAL5", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P39523-1", "protein_name": "Uncharacterized protein YMR124W", "gene_name": "YM8564.06", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P40056-1", "protein_name": "Golgi to ER traffic protein 2", "gene_name": "GET2", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q01389-1", "protein_name": "Serine/threonine-protein kinase BCK1/SLK1/SSP31", "gene_name": "BCK1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q03213-1", "protein_name": "High-osmolarity-induced transcription protein 1", "gene_name": "HOT1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P48361-1", "protein_name": "Activator of SKN7 protein 10", "gene_name": "ASK10", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P53629-1", "protein_name": "Sterol O-acyltransferase 2", "gene_name": "ARE2", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q03016-1", "protein_name": "GLC7-interacting protein 3", "gene_name": "GIP3", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q06108-1", "protein_name": "Regulator of the glycerol channel 1", "gene_name": "RGC1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q08421-1", "protein_name": "Enhancer of translation termination 1", "gene_name": "ETT1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P25344-1", "protein_name": "Protein kinase regulator STE50", "gene_name": "STE50", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P33306-1", "protein_name": "Protein BCK2", "gene_name": "BCK2", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P33329-1", "protein_name": "Serine/threonine-protein phosphatase PP-Z2", "gene_name": "PPZ2", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P40563-1", "protein_name": "Altered inheritance of mitochondria protein 21", "gene_name": "AIM21", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P48524-1", "protein_name": "Ubiquitin ligase-binding protein BUL1", "gene_name": "BUL1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P10614-1", "protein_name": "Lanosterol 14-alpha demethylase CYP51", "gene_name": "ERG11", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P19659-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 15", "gene_name": "GAL11", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P39936-1", "protein_name": "Eukaryotic initiation factor 4F subunit p130", "gene_name": "TIF4632", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P50875-1", "protein_name": "SAGA complex subunit SPT20", "gene_name": "SPT20", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q00816-1", "protein_name": "Resistance to glucose repression protein 1", "gene_name": "REG1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q12114-1", "protein_name": "Chitin biosynthesis protein CHS5", "gene_name": "CHS5", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P07806-1", "protein_name": "Valine--tRNA ligase, mitochondrial", "gene_name": "VAS1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P20134-1", "protein_name": "Flocculation suppression protein", "gene_name": "SFL1", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P47160", "url": "https://www.uniprot.org/uniprotkb/P47160" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "phosphorylation": [ { "start_pos": 320, "end_pos": 320, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P47160", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P47160" }, { "database": "PubMed", "id": "18407956", "url": "https://pubmed.ncbi.nlm.nih.gov/18407956" }, { "database": "SGD", "id": "S000003886", "url": "https://www.yeastgenome.org/locus/S000003886" }, { "database": "PubMed", "id": "28270554", "url": "https://pubmed.ncbi.nlm.nih.gov/28270554" }, { "database": "PubMed", "id": "31208443", "url": "https://pubmed.ncbi.nlm.nih.gov/31208443" }, { "database": "PubMed", "id": "33481703", "url": "https://pubmed.ncbi.nlm.nih.gov/33481703" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" } ], "site_lbl": "Thr320", "uniprot_canonical_ac": "P47160-1" }, { "start_pos": 158, "end_pos": 158, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P53244", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P53244" }, { "database": "PubMed", "id": "15665377", "url": "https://pubmed.ncbi.nlm.nih.gov/15665377" }, { "database": "PubMed", "id": "18407956", "url": "https://pubmed.ncbi.nlm.nih.gov/18407956" }, { "database": "PubMed", "id": "19779198", "url": "https://pubmed.ncbi.nlm.nih.gov/19779198" }, { "database": "PubMed", "id": "20702584", "url": "https://pubmed.ncbi.nlm.nih.gov/20702584" }, { "database": "SGD", "id": "S000003300", "url": "https://www.yeastgenome.org/locus/S000003300" }, { "database": "PubMed", "id": "23749301", "url": "https://pubmed.ncbi.nlm.nih.gov/23749301" }, { "database": "PubMed", "id": "28270554", "url": "https://pubmed.ncbi.nlm.nih.gov/28270554" }, { "database": "PubMed", "id": "31208443", "url": "https://pubmed.ncbi.nlm.nih.gov/31208443" }, { "database": "PubMed", "id": "32597660", "url": "https://pubmed.ncbi.nlm.nih.gov/32597660" }, { "database": "PubMed", "id": "33481703", "url": "https://pubmed.ncbi.nlm.nih.gov/33481703" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" } ], "site_lbl": "Ser158", "uniprot_canonical_ac": "P53244-1" }, { "start_pos": 54, "end_pos": 54, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P53599", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P53599" }, { "database": "PubMed", "id": "17330950", "url": "https://pubmed.ncbi.nlm.nih.gov/17330950" }, { "database": "PubMed", "id": "18407956", "url": "https://pubmed.ncbi.nlm.nih.gov/18407956" }, { "database": "PubMed", "id": "19684113", "url": "https://pubmed.ncbi.nlm.nih.gov/19684113" }, { "database": "PubMed", "id": "19779198", "url": "https://pubmed.ncbi.nlm.nih.gov/19779198" }, { "database": "PubMed", "id": "21177495", "url": "https://pubmed.ncbi.nlm.nih.gov/21177495" }, { "database": "SGD", "id": "S000005314", "url": "https://www.yeastgenome.org/locus/S000005314" }, { "database": "PubMed", "id": "23749301", "url": "https://pubmed.ncbi.nlm.nih.gov/23749301" }, { "database": "PubMed", "id": "25734609", "url": "https://pubmed.ncbi.nlm.nih.gov/25734609" }, { "database": "PubMed", "id": "28270554", "url": "https://pubmed.ncbi.nlm.nih.gov/28270554" }, { "database": "PubMed", "id": "33481703", "url": "https://pubmed.ncbi.nlm.nih.gov/33481703" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" } ], "site_lbl": "Ser54", "uniprot_canonical_ac": "P53599-1" }, { "start_pos": 57, "end_pos": 57, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P53599", "url": "https://www.uniprot.org/uniprotkb/P53599" }, { "database": "PubMed", "id": "19779198", "url": "https://pubmed.ncbi.nlm.nih.gov/19779198" }, { "database": "iPTMnet", "id": "P53599", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P53599" }, { "database": "PubMed", "id": "17330950", "url": "https://pubmed.ncbi.nlm.nih.gov/17330950" }, { "database": "PubMed", "id": "18407956", "url": "https://pubmed.ncbi.nlm.nih.gov/18407956" }, { "database": "PubMed", "id": "19684113", "url": "https://pubmed.ncbi.nlm.nih.gov/19684113" }, { "database": "PubMed", "id": "21177495", "url": "https://pubmed.ncbi.nlm.nih.gov/21177495" }, { "database": "SGD", "id": "S000005314", "url": "https://www.yeastgenome.org/locus/S000005314" }, { "database": "PubMed", "id": "23749301", "url": "https://pubmed.ncbi.nlm.nih.gov/23749301" }, { "database": "PubMed", "id": "25734609", "url": "https://pubmed.ncbi.nlm.nih.gov/25734609" }, { "database": "PubMed", "id": "28270554", "url": "https://pubmed.ncbi.nlm.nih.gov/28270554" }, { "database": "PubMed", "id": "32597660", "url": "https://pubmed.ncbi.nlm.nih.gov/32597660" }, { "database": "PubMed", "id": "33481703", "url": "https://pubmed.ncbi.nlm.nih.gov/33481703" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" } ], "site_lbl": "Ser57", "uniprot_canonical_ac": "P53599-1" }, { "start_pos": 602, "end_pos": 602, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q02805", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q02805" }, { "database": "PubMed", "id": "17563356", "url": "https://pubmed.ncbi.nlm.nih.gov/17563356" }, { "database": "PubMed", "id": "18407956", "url": "https://pubmed.ncbi.nlm.nih.gov/18407956" }, { "database": "PubMed", "id": "19779198", "url": "https://pubmed.ncbi.nlm.nih.gov/19779198" }, { "database": "SGD", "id": "S000005544", "url": "https://www.yeastgenome.org/locus/S000005544" }, { "database": "PubMed", "id": "23749301", "url": "https://pubmed.ncbi.nlm.nih.gov/23749301" }, { "database": "PubMed", "id": "28270554", "url": "https://pubmed.ncbi.nlm.nih.gov/28270554" }, { "database": "PubMed", "id": "30610170", "url": "https://pubmed.ncbi.nlm.nih.gov/30610170" }, { "database": "PubMed", "id": "33481703", "url": "https://pubmed.ncbi.nlm.nih.gov/33481703" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" } ], "site_lbl": "Ser602", "uniprot_canonical_ac": "Q02805-1" }, { "start_pos": 608, "end_pos": 608, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "SGD", "id": "S000005544", "url": "https://www.yeastgenome.org/locus/S000005544" }, { "database": "iPTMnet", "id": "Q02805", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q02805" }, { "database": "PubMed", "id": "23749301", "url": "https://pubmed.ncbi.nlm.nih.gov/23749301" }, { "database": "PubMed", "id": "28270554", "url": "https://pubmed.ncbi.nlm.nih.gov/28270554" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" } ], "site_lbl": "Ser608", "uniprot_canonical_ac": "Q02805-1" }, { "start_pos": 66, "end_pos": 66, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P32356", "url": "https://www.uniprot.org/uniprotkb/P32356" }, { "database": "PubMed", "id": "19779198", "url": "https://pubmed.ncbi.nlm.nih.gov/19779198" }, { "database": "PubMed", "id": "18407956", "url": "https://pubmed.ncbi.nlm.nih.gov/18407956" }, { "database": "PubMed", "id": "17287358", "url": "https://pubmed.ncbi.nlm.nih.gov/17287358" }, { "database": "iPTMnet", "id": "P32356", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P32356" }, { "database": "PubMed", "id": "17563356", "url": "https://pubmed.ncbi.nlm.nih.gov/17563356" }, { "database": "PubMed", "id": "33441790", "url": "https://pubmed.ncbi.nlm.nih.gov/33441790" }, { "database": "SGD", "id": "S000002408", "url": "https://www.yeastgenome.org/locus/S000002408" }, { "database": "PubMed", "id": "23749301", "url": "https://pubmed.ncbi.nlm.nih.gov/23749301" }, { "database": "PubMed", "id": "27203178", "url": "https://pubmed.ncbi.nlm.nih.gov/27203178" }, { "database": "PubMed", "id": "27203179", "url": "https://pubmed.ncbi.nlm.nih.gov/27203179" }, { "database": "PubMed", "id": "28270554", "url": "https://pubmed.ncbi.nlm.nih.gov/28270554" }, { "database": "PubMed", "id": "33481703", "url": "https://pubmed.ncbi.nlm.nih.gov/33481703" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" } ], "site_lbl": "Ser66", "uniprot_canonical_ac": "P32356-1" }, { "start_pos": 152, "end_pos": 152, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "SGD", "id": "S000000150", "url": "https://www.yeastgenome.org/locus/S000000150" }, { "database": "iPTMnet", "id": "P34219", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P34219" }, { "database": "PubMed", "id": "28270554", "url": "https://pubmed.ncbi.nlm.nih.gov/28270554" }, { "database": "PubMed", "id": "31208443", "url": "https://pubmed.ncbi.nlm.nih.gov/31208443" } ], "site_lbl": "Thr152", "uniprot_canonical_ac": "P34219-1" }, { "start_pos": 647, "end_pos": 647, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P38041", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P38041" }, { "database": "PubMed", "id": "21177495", "url": "https://pubmed.ncbi.nlm.nih.gov/21177495" }, { "database": "SGD", "id": "S000000181", "url": "https://www.yeastgenome.org/locus/S000000181" }, { "database": "PubMed", "id": "23749301", "url": "https://pubmed.ncbi.nlm.nih.gov/23749301" }, { "database": "PubMed", "id": "28265048", "url": "https://pubmed.ncbi.nlm.nih.gov/28265048" }, { "database": "PubMed", "id": "28270554", "url": "https://pubmed.ncbi.nlm.nih.gov/28270554" }, { "database": "PubMed", "id": "31208443", "url": "https://pubmed.ncbi.nlm.nih.gov/31208443" }, { "database": "PubMed", "id": "32597660", "url": "https://pubmed.ncbi.nlm.nih.gov/32597660" }, { "database": "PubMed", "id": "33481703", "url": "https://pubmed.ncbi.nlm.nih.gov/33481703" } ], "site_lbl": "Thr647", "uniprot_canonical_ac": "P38041-1" }, { "start_pos": 135, "end_pos": 135, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P38427", "url": "https://www.uniprot.org/uniprotkb/P38427" }, { "database": "PubMed", "id": "18407956", "url": "https://pubmed.ncbi.nlm.nih.gov/18407956" }, { "database": "iPTMnet", "id": "P38427", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P38427" }, { "database": "PubMed", "id": "19779198", "url": "https://pubmed.ncbi.nlm.nih.gov/19779198" }, { "database": "PubMed", "id": "21126336", "url": "https://pubmed.ncbi.nlm.nih.gov/21126336" }, { "database": "PubMed", "id": "21177495", "url": "https://pubmed.ncbi.nlm.nih.gov/21177495" }, { "database": "SGD", "id": "S000004566", "url": "https://www.yeastgenome.org/locus/S000004566" }, { "database": "PubMed", "id": "24909858", "url": "https://pubmed.ncbi.nlm.nih.gov/24909858" }, { "database": "PubMed", "id": "28270554", "url": "https://pubmed.ncbi.nlm.nih.gov/28270554" }, { "database": "PubMed", "id": "32597660", "url": "https://pubmed.ncbi.nlm.nih.gov/32597660" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" }, { "database": "PubMed", "id": "34965436", "url": "https://pubmed.ncbi.nlm.nih.gov/34965436" } ], "site_lbl": "Ser135", "uniprot_canonical_ac": "P38427-1" }, { "start_pos": 147, "end_pos": 147, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P38427", "url": "https://www.uniprot.org/uniprotkb/P38427" }, { "database": "PubMed", "id": "18407956", "url": "https://pubmed.ncbi.nlm.nih.gov/18407956" }, { "database": "iPTMnet", "id": "P38427", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P38427" }, { "database": "PubMed", "id": "17563356", "url": "https://pubmed.ncbi.nlm.nih.gov/17563356" }, { "database": "PubMed", "id": "19779198", "url": "https://pubmed.ncbi.nlm.nih.gov/19779198" }, { "database": "PubMed", "id": "20702584", "url": "https://pubmed.ncbi.nlm.nih.gov/20702584" }, { "database": "PubMed", "id": "21126336", "url": "https://pubmed.ncbi.nlm.nih.gov/21126336" }, { "database": "PubMed", "id": "21177495", "url": "https://pubmed.ncbi.nlm.nih.gov/21177495" }, { "database": "SGD", "id": "S000004566", "url": "https://www.yeastgenome.org/locus/S000004566" }, { "database": "PubMed", "id": "23273919", "url": "https://pubmed.ncbi.nlm.nih.gov/23273919" }, { "database": "PubMed", "id": "23749301", "url": "https://pubmed.ncbi.nlm.nih.gov/23749301" }, { "database": "PubMed", "id": "24909858", "url": "https://pubmed.ncbi.nlm.nih.gov/24909858" }, { "database": "PubMed", "id": "28270554", "url": "https://pubmed.ncbi.nlm.nih.gov/28270554" }, { "database": "PubMed", "id": "32597660", "url": "https://pubmed.ncbi.nlm.nih.gov/32597660" }, { "database": "PubMed", "id": "33481703", "url": "https://pubmed.ncbi.nlm.nih.gov/33481703" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" } ], "site_lbl": "Ser147", "uniprot_canonical_ac": "P38427-1" }, { "start_pos": 350, "end_pos": 350, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine", "evidence": [ { "database": "UniProtKB", "id": "P38623", "url": "https://www.uniprot.org/uniprotkb/P38623" }, { "database": "PubMed", "id": "18407956", "url": "https://pubmed.ncbi.nlm.nih.gov/18407956" }, { "database": "iPTMnet", "id": "P38623", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P38623" }, { "database": "SGD", "id": "S000004238", "url": "https://www.yeastgenome.org/locus/S000004238" }, { "database": "PubMed", "id": "28270554", "url": "https://pubmed.ncbi.nlm.nih.gov/28270554" }, { "database": "PubMed", "id": "31208443", "url": "https://pubmed.ncbi.nlm.nih.gov/31208443" }, { "database": "PubMed", "id": "33481703", "url": "https://pubmed.ncbi.nlm.nih.gov/33481703" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" } ], "site_lbl": "Thr350", "uniprot_canonical_ac": "P38623-1" }, { "start_pos": 379, "end_pos": 379, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P38623", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P38623" }, { "database": "PubMed", "id": "11344302", "url": "https://pubmed.ncbi.nlm.nih.gov/11344302" }, { "database": "SGD", "id": "S000004238", "url": "https://www.yeastgenome.org/locus/S000004238" }, { "database": "PubMed", "id": "28270554", "url": "https://pubmed.ncbi.nlm.nih.gov/28270554" }, { "database": "PubMed", "id": "31208443", "url": "https://pubmed.ncbi.nlm.nih.gov/31208443" } ], "site_lbl": "Thr379", "uniprot_canonical_ac": "P38623-1" }, { "start_pos": 520, "end_pos": 520, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P38623", "url": "https://www.uniprot.org/uniprotkb/P38623" }, { "database": "PubMed", "id": "10805732", "url": "https://pubmed.ncbi.nlm.nih.gov/10805732" }, { "database": "iPTMnet", "id": "P38623", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P38623" }, { "database": "PubMed", "id": "11344302", "url": "https://pubmed.ncbi.nlm.nih.gov/11344302" }, { "database": "PubMed", "id": "14735355", "url": "https://pubmed.ncbi.nlm.nih.gov/14735355" }, { "database": "SGD", "id": "S000004238", "url": "https://www.yeastgenome.org/locus/S000004238" }, { "database": "PubMed", "id": "28270554", "url": "https://pubmed.ncbi.nlm.nih.gov/28270554" }, { "database": "PubMed", "id": "31208443", "url": "https://pubmed.ncbi.nlm.nih.gov/31208443" }, { "database": "PubMed", "id": "33481703", "url": "https://pubmed.ncbi.nlm.nih.gov/33481703" } ], "site_lbl": "Ser520", "uniprot_canonical_ac": "P38623-1" }, { "start_pos": 7, "end_pos": 7, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q06146", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q06146" }, { "database": "PubMed", "id": "15665377", "url": "https://pubmed.ncbi.nlm.nih.gov/15665377" }, { "database": "PubMed", "id": "20702584", "url": "https://pubmed.ncbi.nlm.nih.gov/20702584" }, { "database": "SGD", "id": "S000004247", "url": "https://www.yeastgenome.org/locus/S000004247" }, { "database": "PubMed", "id": "18407956", "url": "https://pubmed.ncbi.nlm.nih.gov/18407956" }, { "database": "PubMed", "id": "24909858", "url": "https://pubmed.ncbi.nlm.nih.gov/24909858" }, { "database": "PubMed", "id": "28270554", "url": "https://pubmed.ncbi.nlm.nih.gov/28270554" }, { "database": "PubMed", "id": "32597660", "url": "https://pubmed.ncbi.nlm.nih.gov/32597660" }, { "database": "PubMed", "id": "33481703", "url": "https://pubmed.ncbi.nlm.nih.gov/33481703" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" } ], "site_lbl": "Ser7", "uniprot_canonical_ac": "Q06146-1" }, { "start_pos": 8, "end_pos": 8, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q06146", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q06146" }, { "database": "PubMed", "id": "21177495", "url": "https://pubmed.ncbi.nlm.nih.gov/21177495" }, { "database": "SGD", "id": "S000004247", "url": "https://www.yeastgenome.org/locus/S000004247" }, { "database": "PubMed", "id": "18407956", "url": "https://pubmed.ncbi.nlm.nih.gov/18407956" }, { "database": "PubMed", "id": "23749301", "url": "https://pubmed.ncbi.nlm.nih.gov/23749301" }, { "database": "PubMed", "id": "24909858", "url": "https://pubmed.ncbi.nlm.nih.gov/24909858" }, { "database": "PubMed", "id": "28270554", "url": "https://pubmed.ncbi.nlm.nih.gov/28270554" }, { "database": "PubMed", "id": "32597660", "url": "https://pubmed.ncbi.nlm.nih.gov/32597660" }, { "database": "PubMed", "id": "33481703", "url": "https://pubmed.ncbi.nlm.nih.gov/33481703" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" } ], "site_lbl": "Thr8", "uniprot_canonical_ac": "Q06146-1" }, { "start_pos": 375, "end_pos": 375, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P54787", "url": "https://www.uniprot.org/uniprotkb/P54787" }, { "database": "PubMed", "id": "18407956", "url": "https://pubmed.ncbi.nlm.nih.gov/18407956" }, { "database": "iPTMnet", "id": "P54787", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P54787" }, { "database": "PubMed", "id": "19795423", "url": "https://pubmed.ncbi.nlm.nih.gov/19795423" }, { "database": "PubMed", "id": "19823750", "url": "https://pubmed.ncbi.nlm.nih.gov/19823750" }, { "database": "SGD", "id": "S000004563", "url": "https://www.yeastgenome.org/locus/S000004563" }, { "database": "PubMed", "id": "28270554", "url": "https://pubmed.ncbi.nlm.nih.gov/28270554" }, { "database": "PubMed", "id": "31208443", "url": "https://pubmed.ncbi.nlm.nih.gov/31208443" }, { "database": "PubMed", "id": "33481703", "url": "https://pubmed.ncbi.nlm.nih.gov/33481703" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" } ], "site_lbl": "Ser375", "uniprot_canonical_ac": "P54787-1" }, { "start_pos": 215, "end_pos": 215, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "SGD", "id": "S000005111", "url": "https://www.yeastgenome.org/locus/S000005111" }, { "database": "iPTMnet", "id": "Q02100", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q02100" }, { "database": "PubMed", "id": "22218487", "url": "https://pubmed.ncbi.nlm.nih.gov/22218487" }, { "database": "PubMed", "id": "23749301", "url": "https://pubmed.ncbi.nlm.nih.gov/23749301" }, { "database": "PubMed", "id": "28265048", "url": "https://pubmed.ncbi.nlm.nih.gov/28265048" }, { "database": "PubMed", "id": "28270554", "url": "https://pubmed.ncbi.nlm.nih.gov/28270554" }, { "database": "PubMed", "id": "31208443", "url": "https://pubmed.ncbi.nlm.nih.gov/31208443" }, { "database": "PubMed", "id": "33481703", "url": "https://pubmed.ncbi.nlm.nih.gov/33481703" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" } ], "site_lbl": "Thr215", "uniprot_canonical_ac": "Q02100-1" }, { "start_pos": 63, "end_pos": 63, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P38970", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P38970" }, { "database": "PubMed", "id": "18407956", "url": "https://pubmed.ncbi.nlm.nih.gov/18407956" }, { "database": "PubMed", "id": "19684113", "url": "https://pubmed.ncbi.nlm.nih.gov/19684113" }, { "database": "PubMed", "id": "19779198", "url": "https://pubmed.ncbi.nlm.nih.gov/19779198" }, { "database": "SGD", "id": "S000003701", "url": "https://www.yeastgenome.org/locus/S000003701" }, { "database": "PubMed", "id": "28270554", "url": "https://pubmed.ncbi.nlm.nih.gov/28270554" }, { "database": "PubMed", "id": "32597660", "url": "https://pubmed.ncbi.nlm.nih.gov/32597660" }, { "database": "PubMed", "id": "33481703", "url": "https://pubmed.ncbi.nlm.nih.gov/33481703" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" } ], "site_lbl": "Ser63", "uniprot_canonical_ac": "P38970-1" }, { "start_pos": 66, "end_pos": 66, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P38970", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P38970" }, { "database": "PubMed", "id": "19684113", "url": "https://pubmed.ncbi.nlm.nih.gov/19684113" }, { "database": "PubMed", "id": "19779198", "url": "https://pubmed.ncbi.nlm.nih.gov/19779198" }, { "database": "SGD", "id": "S000003701", "url": "https://www.yeastgenome.org/locus/S000003701" }, { "database": "PubMed", "id": "28270554", "url": "https://pubmed.ncbi.nlm.nih.gov/28270554" }, { "database": "PubMed", "id": "33481703", "url": "https://pubmed.ncbi.nlm.nih.gov/33481703" } ], "site_lbl": "Ser66", "uniprot_canonical_ac": "P38970-1" }, { "start_pos": 209, "end_pos": 209, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "SGD", "id": "S000004731", "url": "https://www.yeastgenome.org/locus/S000004731" }, { "database": "iPTMnet", "id": "P39523", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P39523" }, { "database": "PubMed", "id": "28270554", "url": "https://pubmed.ncbi.nlm.nih.gov/28270554" }, { "database": "PubMed", "id": "31208443", "url": "https://pubmed.ncbi.nlm.nih.gov/31208443" } ], "site_lbl": "Ser209", "uniprot_canonical_ac": "P39523-1" }, { "start_pos": 45, "end_pos": 45, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P40056", "url": "https://www.uniprot.org/uniprotkb/P40056" }, { "database": "PubMed", "id": "17330950", "url": "https://pubmed.ncbi.nlm.nih.gov/17330950" }, { "database": "iPTMnet", "id": "P40056", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P40056" }, { "database": "SGD", "id": "S000000885", "url": "https://www.yeastgenome.org/locus/S000000885" }, { "database": "PubMed", "id": "23749301", "url": "https://pubmed.ncbi.nlm.nih.gov/23749301" }, { "database": "PubMed", "id": "28270554", "url": "https://pubmed.ncbi.nlm.nih.gov/28270554" }, { "database": "PubMed", "id": "31208443", "url": "https://pubmed.ncbi.nlm.nih.gov/31208443" }, { "database": "PubMed", "id": "32597660", "url": "https://pubmed.ncbi.nlm.nih.gov/32597660" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" } ], "site_lbl": "Ser45", "uniprot_canonical_ac": "P40056-1" }, { "start_pos": 765, "end_pos": 765, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "SGD", "id": "S000003631", "url": "https://www.yeastgenome.org/locus/S000003631" }, { "database": "iPTMnet", "id": "Q01389", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q01389" }, { "database": "PubMed", "id": "28270554", "url": "https://pubmed.ncbi.nlm.nih.gov/28270554" }, { "database": "PubMed", "id": "31208443", "url": "https://pubmed.ncbi.nlm.nih.gov/31208443" } ], "site_lbl": "Thr765", "uniprot_canonical_ac": "Q01389-1" }, { "start_pos": 153, "end_pos": 153, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "Q03213", "url": "https://www.uniprot.org/uniprotkb/Q03213" }, { "database": "PubMed", "id": "19779198", "url": "https://pubmed.ncbi.nlm.nih.gov/19779198" }, { "database": "iPTMnet", "id": "Q03213", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q03213" }, { "database": "PubMed", "id": "18407956", "url": "https://pubmed.ncbi.nlm.nih.gov/18407956" }, { "database": "SGD", "id": "S000004783", "url": "https://www.yeastgenome.org/locus/S000004783" }, { "database": "PubMed", "id": "12743037", "url": "https://pubmed.ncbi.nlm.nih.gov/12743037" }, { "database": "PubMed", "id": "23749301", "url": "https://pubmed.ncbi.nlm.nih.gov/23749301" }, { "database": "PubMed", "id": "28270554", "url": "https://pubmed.ncbi.nlm.nih.gov/28270554" }, { "database": "PubMed", "id": "33481703", "url": "https://pubmed.ncbi.nlm.nih.gov/33481703" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" } ], "site_lbl": "Ser153", "uniprot_canonical_ac": "Q03213-1" }, { "start_pos": 808, "end_pos": 808, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine", "evidence": [ { "database": "UniProtKB", "id": "P48361", "url": "https://www.uniprot.org/uniprotkb/P48361" }, { "database": "PubMed", "id": "18407956", "url": "https://pubmed.ncbi.nlm.nih.gov/18407956" }, { "database": "iPTMnet", "id": "P48361", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P48361" }, { "database": "PubMed", "id": "19684113", "url": "https://pubmed.ncbi.nlm.nih.gov/19684113" }, { "database": "PubMed", "id": "19779198", "url": "https://pubmed.ncbi.nlm.nih.gov/19779198" }, { "database": "PubMed", "id": "20489023", "url": "https://pubmed.ncbi.nlm.nih.gov/20489023" }, { "database": "SGD", "id": "S000003329", "url": "https://www.yeastgenome.org/locus/S000003329" }, { "database": "PubMed", "id": "22218487", "url": "https://pubmed.ncbi.nlm.nih.gov/22218487" }, { "database": "PubMed", "id": "23749301", "url": "https://pubmed.ncbi.nlm.nih.gov/23749301" }, { "database": "PubMed", "id": "24298058", "url": "https://pubmed.ncbi.nlm.nih.gov/24298058" }, { "database": "PubMed", "id": "24909858", "url": "https://pubmed.ncbi.nlm.nih.gov/24909858" }, { "database": "PubMed", "id": "28265048", "url": "https://pubmed.ncbi.nlm.nih.gov/28265048" }, { "database": "PubMed", "id": "28270554", "url": "https://pubmed.ncbi.nlm.nih.gov/28270554" }, { "database": "PubMed", "id": "31208443", "url": "https://pubmed.ncbi.nlm.nih.gov/31208443" }, { "database": "PubMed", "id": "33481703", "url": "https://pubmed.ncbi.nlm.nih.gov/33481703" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" } ], "site_lbl": "Thr808", "uniprot_canonical_ac": "P48361-1" }, { "start_pos": 175, "end_pos": 175, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P53629", "url": "https://www.uniprot.org/uniprotkb/P53629" }, { "database": "PubMed", "id": "17330950", "url": "https://pubmed.ncbi.nlm.nih.gov/17330950" }, { "database": "PubMed", "id": "19779198", "url": "https://pubmed.ncbi.nlm.nih.gov/19779198" }, { "database": "iPTMnet", "id": "P53629", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P53629" }, { "database": "PubMed", "id": "17287358", "url": "https://pubmed.ncbi.nlm.nih.gov/17287358" }, { "database": "PubMed", "id": "17563356", "url": "https://pubmed.ncbi.nlm.nih.gov/17563356" }, { "database": "PubMed", "id": "18407956", "url": "https://pubmed.ncbi.nlm.nih.gov/18407956" }, { "database": "PubMed", "id": "19795423", "url": "https://pubmed.ncbi.nlm.nih.gov/19795423" }, { "database": "PubMed", "id": "19823750", "url": "https://pubmed.ncbi.nlm.nih.gov/19823750" }, { "database": "PubMed", "id": "20702584", "url": "https://pubmed.ncbi.nlm.nih.gov/20702584" }, { "database": "PubMed", "id": "21126336", "url": "https://pubmed.ncbi.nlm.nih.gov/21126336" }, { "database": "SGD", "id": "S000005302", "url": "https://www.yeastgenome.org/locus/S000005302" }, { "database": "PubMed", "id": "22218487", "url": "https://pubmed.ncbi.nlm.nih.gov/22218487" }, { "database": "PubMed", "id": "23749301", "url": "https://pubmed.ncbi.nlm.nih.gov/23749301" }, { "database": "PubMed", "id": "24909858", "url": "https://pubmed.ncbi.nlm.nih.gov/24909858" }, { "database": "PubMed", "id": "28270554", "url": "https://pubmed.ncbi.nlm.nih.gov/28270554" }, { "database": "PubMed", "id": "31208443", "url": "https://pubmed.ncbi.nlm.nih.gov/31208443" }, { "database": "PubMed", "id": "32597660", "url": "https://pubmed.ncbi.nlm.nih.gov/32597660" }, { "database": "PubMed", "id": "33481703", "url": "https://pubmed.ncbi.nlm.nih.gov/33481703" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" } ], "site_lbl": "Ser175", "uniprot_canonical_ac": "P53629-1" }, { "start_pos": 260, "end_pos": 260, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "Q03016", "url": "https://www.uniprot.org/uniprotkb/Q03016" }, { "database": "PubMed", "id": "17330950", "url": "https://pubmed.ncbi.nlm.nih.gov/17330950" }, { "database": "iPTMnet", "id": "Q03016", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q03016" }, { "database": "PubMed", "id": "19684113", "url": "https://pubmed.ncbi.nlm.nih.gov/19684113" }, { "database": "SGD", "id": "S000006058", "url": "https://www.yeastgenome.org/locus/S000006058" }, { "database": "PubMed", "id": "23749301", "url": "https://pubmed.ncbi.nlm.nih.gov/23749301" }, { "database": "PubMed", "id": "28270554", "url": "https://pubmed.ncbi.nlm.nih.gov/28270554" }, { "database": "PubMed", "id": "33481703", "url": "https://pubmed.ncbi.nlm.nih.gov/33481703" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" }, { "database": "PubMed", "id": "34965436", "url": "https://pubmed.ncbi.nlm.nih.gov/34965436" } ], "site_lbl": "Ser260", "uniprot_canonical_ac": "Q03016-1" }, { "start_pos": 264, "end_pos": 264, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine", "evidence": [ { "database": "UniProtKB", "id": "Q03016", "url": "https://www.uniprot.org/uniprotkb/Q03016" }, { "database": "PubMed", "id": "17330950", "url": "https://pubmed.ncbi.nlm.nih.gov/17330950" }, { "database": "iPTMnet", "id": "Q03016", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q03016" }, { "database": "PubMed", "id": "18407956", "url": "https://pubmed.ncbi.nlm.nih.gov/18407956" }, { "database": "PubMed", "id": "19684113", "url": "https://pubmed.ncbi.nlm.nih.gov/19684113" }, { "database": "SGD", "id": "S000006058", "url": "https://www.yeastgenome.org/locus/S000006058" }, { "database": "PubMed", "id": "23749301", "url": "https://pubmed.ncbi.nlm.nih.gov/23749301" }, { "database": "PubMed", "id": "28270554", "url": "https://pubmed.ncbi.nlm.nih.gov/28270554" }, { "database": "PubMed", "id": "32597660", "url": "https://pubmed.ncbi.nlm.nih.gov/32597660" }, { "database": "PubMed", "id": "33481703", "url": "https://pubmed.ncbi.nlm.nih.gov/33481703" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" } ], "site_lbl": "Thr264", "uniprot_canonical_ac": "Q03016-1" }, { "start_pos": 774, "end_pos": 774, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "SGD", "id": "S000006319", "url": "https://www.yeastgenome.org/locus/S000006319" }, { "database": "iPTMnet", "id": "Q06108", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q06108" }, { "database": "PubMed", "id": "28270554", "url": "https://pubmed.ncbi.nlm.nih.gov/28270554" }, { "database": "PubMed", "id": "33481703", "url": "https://pubmed.ncbi.nlm.nih.gov/33481703" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" } ], "site_lbl": "Thr774", "uniprot_canonical_ac": "Q06108-1" }, { "start_pos": 975, "end_pos": 975, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "Q06108", "url": "https://www.uniprot.org/uniprotkb/Q06108" }, { "database": "PubMed", "id": "19779198", "url": "https://pubmed.ncbi.nlm.nih.gov/19779198" }, { "database": "SGD", "id": "S000006319", "url": "https://www.yeastgenome.org/locus/S000006319" }, { "database": "iPTMnet", "id": "Q06108", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q06108" }, { "database": "PubMed", "id": "18407956", "url": "https://pubmed.ncbi.nlm.nih.gov/18407956" }, { "database": "PubMed", "id": "20489023", "url": "https://pubmed.ncbi.nlm.nih.gov/20489023" }, { "database": "PubMed", "id": "23749301", "url": "https://pubmed.ncbi.nlm.nih.gov/23749301" }, { "database": "PubMed", "id": "24298058", "url": "https://pubmed.ncbi.nlm.nih.gov/24298058" }, { "database": "PubMed", "id": "28270554", "url": "https://pubmed.ncbi.nlm.nih.gov/28270554" }, { "database": "PubMed", "id": "30516470", "url": "https://pubmed.ncbi.nlm.nih.gov/30516470" }, { "database": "PubMed", "id": "31208443", "url": "https://pubmed.ncbi.nlm.nih.gov/31208443" }, { "database": "PubMed", "id": "33481703", "url": "https://pubmed.ncbi.nlm.nih.gov/33481703" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" } ], "site_lbl": "Ser975", "uniprot_canonical_ac": "Q06108-1" }, { "start_pos": 33, "end_pos": 33, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q08421", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q08421" }, { "database": "PubMed", "id": "17563356", "url": "https://pubmed.ncbi.nlm.nih.gov/17563356" }, { "database": "PubMed", "id": "18407956", "url": "https://pubmed.ncbi.nlm.nih.gov/18407956" }, { "database": "PubMed", "id": "19779198", "url": "https://pubmed.ncbi.nlm.nih.gov/19779198" }, { "database": "PubMed", "id": "20702584", "url": "https://pubmed.ncbi.nlm.nih.gov/20702584" }, { "database": "PubMed", "id": "21177495", "url": "https://pubmed.ncbi.nlm.nih.gov/21177495" }, { "database": "SGD", "id": "S000005577", "url": "https://www.yeastgenome.org/locus/S000005577" }, { "database": "PubMed", "id": "28270554", "url": "https://pubmed.ncbi.nlm.nih.gov/28270554" }, { "database": "PubMed", "id": "32597660", "url": "https://pubmed.ncbi.nlm.nih.gov/32597660" }, { "database": "PubMed", "id": "33481703", "url": "https://pubmed.ncbi.nlm.nih.gov/33481703" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" } ], "site_lbl": "Ser33", "uniprot_canonical_ac": "Q08421-1" }, { "start_pos": 34, "end_pos": 34, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q08421", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q08421" }, { "database": "PubMed", "id": "17563356", "url": "https://pubmed.ncbi.nlm.nih.gov/17563356" }, { "database": "PubMed", "id": "19684113", "url": "https://pubmed.ncbi.nlm.nih.gov/19684113" }, { "database": "PubMed", "id": "19779198", "url": "https://pubmed.ncbi.nlm.nih.gov/19779198" }, { "database": "PubMed", "id": "20702584", "url": "https://pubmed.ncbi.nlm.nih.gov/20702584" }, { "database": "PubMed", "id": "21177495", "url": "https://pubmed.ncbi.nlm.nih.gov/21177495" }, { "database": "SGD", "id": "S000005577", "url": "https://www.yeastgenome.org/locus/S000005577" }, { "database": "PubMed", "id": "18407956", "url": "https://pubmed.ncbi.nlm.nih.gov/18407956" }, { "database": "PubMed", "id": "23749301", "url": "https://pubmed.ncbi.nlm.nih.gov/23749301" }, { "database": "PubMed", "id": "28270554", "url": "https://pubmed.ncbi.nlm.nih.gov/28270554" }, { "database": "PubMed", "id": "32597660", "url": "https://pubmed.ncbi.nlm.nih.gov/32597660" }, { "database": "PubMed", "id": "33481703", "url": "https://pubmed.ncbi.nlm.nih.gov/33481703" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" } ], "site_lbl": "Thr34", "uniprot_canonical_ac": "Q08421-1" }, { "start_pos": 244, "end_pos": 244, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine", "evidence": [ { "database": "UniProtKB", "id": "P25344", "url": "https://www.uniprot.org/uniprotkb/P25344" }, { "database": "PubMed", "id": "19779198", "url": "https://pubmed.ncbi.nlm.nih.gov/19779198" }, { "database": "iPTMnet", "id": "P25344", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P25344" }, { "database": "PubMed", "id": "17330950", "url": "https://pubmed.ncbi.nlm.nih.gov/17330950" }, { "database": "PubMed", "id": "20932477", "url": "https://pubmed.ncbi.nlm.nih.gov/20932477" }, { "database": "PubMed", "id": "21177495", "url": "https://pubmed.ncbi.nlm.nih.gov/21177495" }, { "database": "SGD", "id": "S000000537", "url": "https://www.yeastgenome.org/locus/S000000537" }, { "database": "PubMed", "id": "23749301", "url": "https://pubmed.ncbi.nlm.nih.gov/23749301" }, { "database": "PubMed", "id": "28270554", "url": "https://pubmed.ncbi.nlm.nih.gov/28270554" }, { "database": "PubMed", "id": "31208443", "url": "https://pubmed.ncbi.nlm.nih.gov/31208443" }, { "database": "PubMed", "id": "33481703", "url": "https://pubmed.ncbi.nlm.nih.gov/33481703" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" } ], "site_lbl": "Thr244", "uniprot_canonical_ac": "P25344-1" }, { "start_pos": 258, "end_pos": 258, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "SGD", "id": "S000000969", "url": "https://www.yeastgenome.org/locus/S000000969" }, { "database": "iPTMnet", "id": "P33306", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P33306" }, { "database": "PubMed", "id": "28270554", "url": "https://pubmed.ncbi.nlm.nih.gov/28270554" }, { "database": "PubMed", "id": "31208443", "url": "https://pubmed.ncbi.nlm.nih.gov/31208443" } ], "site_lbl": "Ser258", "uniprot_canonical_ac": "P33306-1" }, { "start_pos": 310, "end_pos": 310, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P33329", "url": "https://www.uniprot.org/uniprotkb/P33329" }, { "database": "PubMed", "id": "19779198", "url": "https://pubmed.ncbi.nlm.nih.gov/19779198" }, { "database": "SGD", "id": "S000002844", "url": "https://www.yeastgenome.org/locus/S000002844" }, { "database": "iPTMnet", "id": "P33329", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P33329" }, { "database": "PubMed", "id": "18407956", "url": "https://pubmed.ncbi.nlm.nih.gov/18407956" }, { "database": "PubMed", "id": "20489023", "url": "https://pubmed.ncbi.nlm.nih.gov/20489023" }, { "database": "PubMed", "id": "20702584", "url": "https://pubmed.ncbi.nlm.nih.gov/20702584" }, { "database": "PubMed", "id": "23749301", "url": "https://pubmed.ncbi.nlm.nih.gov/23749301" }, { "database": "PubMed", "id": "28270554", "url": "https://pubmed.ncbi.nlm.nih.gov/28270554" }, { "database": "PubMed", "id": "32597660", "url": "https://pubmed.ncbi.nlm.nih.gov/32597660" }, { "database": "PubMed", "id": "33481703", "url": "https://pubmed.ncbi.nlm.nih.gov/33481703" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" } ], "site_lbl": "Ser310", "uniprot_canonical_ac": "P33329-1" }, { "start_pos": 476, "end_pos": 476, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P40563", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P40563" }, { "database": "PubMed", "id": "18407956", "url": "https://pubmed.ncbi.nlm.nih.gov/18407956" }, { "database": "SGD", "id": "S000001442", "url": "https://www.yeastgenome.org/locus/S000001442" }, { "database": "PubMed", "id": "23749301", "url": "https://pubmed.ncbi.nlm.nih.gov/23749301" }, { "database": "PubMed", "id": "28270554", "url": "https://pubmed.ncbi.nlm.nih.gov/28270554" }, { "database": "PubMed", "id": "31208443", "url": "https://pubmed.ncbi.nlm.nih.gov/31208443" }, { "database": "PubMed", "id": "32597660", "url": "https://pubmed.ncbi.nlm.nih.gov/32597660" }, { "database": "PubMed", "id": "33481703", "url": "https://pubmed.ncbi.nlm.nih.gov/33481703" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" } ], "site_lbl": "Ser476", "uniprot_canonical_ac": "P40563-1" }, { "start_pos": 107, "end_pos": 107, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P48524", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P48524" }, { "database": "PubMed", "id": "17287358", "url": "https://pubmed.ncbi.nlm.nih.gov/17287358" }, { "database": "PubMed", "id": "18407956", "url": "https://pubmed.ncbi.nlm.nih.gov/18407956" }, { "database": "SGD", "id": "S000004888", "url": "https://www.yeastgenome.org/locus/S000004888" }, { "database": "PubMed", "id": "23749301", "url": "https://pubmed.ncbi.nlm.nih.gov/23749301" }, { "database": "PubMed", "id": "28270554", "url": "https://pubmed.ncbi.nlm.nih.gov/28270554" }, { "database": "PubMed", "id": "32597660", "url": "https://pubmed.ncbi.nlm.nih.gov/32597660" }, { "database": "PubMed", "id": "33481703", "url": "https://pubmed.ncbi.nlm.nih.gov/33481703" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" } ], "site_lbl": "Thr107", "uniprot_canonical_ac": "P48524-1" }, { "start_pos": 111, "end_pos": 111, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P48524", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P48524" }, { "database": "PubMed", "id": "17287358", "url": "https://pubmed.ncbi.nlm.nih.gov/17287358" }, { "database": "SGD", "id": "S000004888", "url": "https://www.yeastgenome.org/locus/S000004888" }, { "database": "PubMed", "id": "23749301", "url": "https://pubmed.ncbi.nlm.nih.gov/23749301" }, { "database": "PubMed", "id": "28270554", "url": "https://pubmed.ncbi.nlm.nih.gov/28270554" }, { "database": "PubMed", "id": "32597660", "url": "https://pubmed.ncbi.nlm.nih.gov/32597660" }, { "database": "PubMed", "id": "33481703", "url": "https://pubmed.ncbi.nlm.nih.gov/33481703" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" } ], "site_lbl": "Thr111", "uniprot_canonical_ac": "P48524-1" }, { "start_pos": 458, "end_pos": 458, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P10614", "url": "https://www.uniprot.org/uniprotkb/P10614" }, { "database": "PubMed", "id": "17330950", "url": "https://pubmed.ncbi.nlm.nih.gov/17330950" }, { "database": "iPTMnet", "id": "P10614", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P10614" }, { "database": "PubMed", "id": "18407956", "url": "https://pubmed.ncbi.nlm.nih.gov/18407956" }, { "database": "SGD", "id": "S000001049", "url": "https://www.yeastgenome.org/locus/S000001049" }, { "database": "PubMed", "id": "28270554", "url": "https://pubmed.ncbi.nlm.nih.gov/28270554" }, { "database": "PubMed", "id": "32597660", "url": "https://pubmed.ncbi.nlm.nih.gov/32597660" }, { "database": "PubMed", "id": "33481703", "url": "https://pubmed.ncbi.nlm.nih.gov/33481703" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" } ], "site_lbl": "Ser458", "uniprot_canonical_ac": "P10614-1" }, { "start_pos": 750, "end_pos": 750, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P19659", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P19659" }, { "database": "PubMed", "id": "18407956", "url": "https://pubmed.ncbi.nlm.nih.gov/18407956" }, { "database": "SGD", "id": "S000005411", "url": "https://www.yeastgenome.org/locus/S000005411" }, { "database": "PubMed", "id": "19779198", "url": "https://pubmed.ncbi.nlm.nih.gov/19779198" }, { "database": "PubMed", "id": "28270554", "url": "https://pubmed.ncbi.nlm.nih.gov/28270554" }, { "database": "PubMed", "id": "31208443", "url": "https://pubmed.ncbi.nlm.nih.gov/31208443" }, { "database": "PubMed", "id": "33481703", "url": "https://pubmed.ncbi.nlm.nih.gov/33481703" } ], "site_lbl": "Thr750", "uniprot_canonical_ac": "P19659-1" }, { "start_pos": 196, "end_pos": 196, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine", "evidence": [ { "database": "UniProtKB", "id": "P39936", "url": "https://www.uniprot.org/uniprotkb/P39936" }, { "database": "PubMed", "id": "19779198", "url": "https://pubmed.ncbi.nlm.nih.gov/19779198" }, { "database": "PubMed", "id": "18407956", "url": "https://pubmed.ncbi.nlm.nih.gov/18407956" }, { "database": "iPTMnet", "id": "P39936", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P39936" }, { "database": "PubMed", "id": "17563356", "url": "https://pubmed.ncbi.nlm.nih.gov/17563356" }, { "database": "PubMed", "id": "19795423", "url": "https://pubmed.ncbi.nlm.nih.gov/19795423" }, { "database": "PubMed", "id": "19823750", "url": "https://pubmed.ncbi.nlm.nih.gov/19823750" }, { "database": "PubMed", "id": "20702584", "url": "https://pubmed.ncbi.nlm.nih.gov/20702584" }, { "database": "PubMed", "id": "21126336", "url": "https://pubmed.ncbi.nlm.nih.gov/21126336" }, { "database": "SGD", "id": "S000003017", "url": "https://www.yeastgenome.org/locus/S000003017" }, { "database": "PubMed", "id": "23749301", "url": "https://pubmed.ncbi.nlm.nih.gov/23749301" }, { "database": "PubMed", "id": "27821475", "url": "https://pubmed.ncbi.nlm.nih.gov/27821475" }, { "database": "PubMed", "id": "28270554", "url": "https://pubmed.ncbi.nlm.nih.gov/28270554" }, { "database": "PubMed", "id": "30516470", "url": "https://pubmed.ncbi.nlm.nih.gov/30516470" }, { "database": "PubMed", "id": "31208443", "url": "https://pubmed.ncbi.nlm.nih.gov/31208443" }, { "database": "PubMed", "id": "32597660", "url": "https://pubmed.ncbi.nlm.nih.gov/32597660" }, { "database": "PubMed", "id": "33481703", "url": "https://pubmed.ncbi.nlm.nih.gov/33481703" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" } ], "site_lbl": "Thr196", "uniprot_canonical_ac": "P39936-1" }, { "start_pos": 516, "end_pos": 516, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine", "evidence": [ { "database": "UniProtKB", "id": "P50875", "url": "https://www.uniprot.org/uniprotkb/P50875" }, { "database": "PubMed", "id": "18407956", "url": "https://pubmed.ncbi.nlm.nih.gov/18407956" }, { "database": "iPTMnet", "id": "P50875", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P50875" }, { "database": "SGD", "id": "S000005508", "url": "https://www.yeastgenome.org/locus/S000005508" }, { "database": "PubMed", "id": "28270554", "url": "https://pubmed.ncbi.nlm.nih.gov/28270554" }, { "database": "PubMed", "id": "32597660", "url": "https://pubmed.ncbi.nlm.nih.gov/32597660" }, { "database": "PubMed", "id": "33481703", "url": "https://pubmed.ncbi.nlm.nih.gov/33481703" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" } ], "site_lbl": "Thr516", "uniprot_canonical_ac": "P50875-1" }, { "start_pos": 898, "end_pos": 898, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "Q00816", "url": "https://www.uniprot.org/uniprotkb/Q00816" }, { "database": "PubMed", "id": "19779198", "url": "https://pubmed.ncbi.nlm.nih.gov/19779198" }, { "database": "iPTMnet", "id": "Q00816", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q00816" }, { "database": "SGD", "id": "S000002435", "url": "https://www.yeastgenome.org/locus/S000002435" }, { "database": "PubMed", "id": "18407956", "url": "https://pubmed.ncbi.nlm.nih.gov/18407956" }, { "database": "PubMed", "id": "23749301", "url": "https://pubmed.ncbi.nlm.nih.gov/23749301" }, { "database": "PubMed", "id": "28270554", "url": "https://pubmed.ncbi.nlm.nih.gov/28270554" }, { "database": "PubMed", "id": "33481703", "url": "https://pubmed.ncbi.nlm.nih.gov/33481703" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" } ], "site_lbl": "Ser898", "uniprot_canonical_ac": "Q00816-1" }, { "start_pos": 373, "end_pos": 373, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q12114", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q12114" }, { "database": "PubMed", "id": "19795423", "url": "https://pubmed.ncbi.nlm.nih.gov/19795423" }, { "database": "PubMed", "id": "19823750", "url": "https://pubmed.ncbi.nlm.nih.gov/19823750" }, { "database": "SGD", "id": "S000004322", "url": "https://www.yeastgenome.org/locus/S000004322" }, { "database": "PubMed", "id": "28270554", "url": "https://pubmed.ncbi.nlm.nih.gov/28270554" }, { "database": "PubMed", "id": "31208443", "url": "https://pubmed.ncbi.nlm.nih.gov/31208443" }, { "database": "PubMed", "id": "33481703", "url": "https://pubmed.ncbi.nlm.nih.gov/33481703" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" } ], "site_lbl": "Thr373", "uniprot_canonical_ac": "Q12114-1" }, { "start_pos": 294, "end_pos": 294, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P07806", "url": "https://www.uniprot.org/uniprotkb/P07806" }, { "database": "PubMed", "id": "18407956", "url": "https://pubmed.ncbi.nlm.nih.gov/18407956" }, { "database": "iPTMnet", "id": "P07806", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P07806" }, { "database": "SGD", "id": "S000003326", "url": "https://www.yeastgenome.org/locus/S000003326" }, { "database": "PubMed", "id": "23749301", "url": "https://pubmed.ncbi.nlm.nih.gov/23749301" }, { "database": "PubMed", "id": "28270554", "url": "https://pubmed.ncbi.nlm.nih.gov/28270554" }, { "database": "PubMed", "id": "32597660", "url": "https://pubmed.ncbi.nlm.nih.gov/32597660" }, { "database": "PubMed", "id": "33481703", "url": "https://pubmed.ncbi.nlm.nih.gov/33481703" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" } ], "site_lbl": "Ser294", "uniprot_canonical_ac": "P07806-1" }, { "start_pos": 556, "end_pos": 556, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P20134", "url": "https://www.uniprot.org/uniprotkb/P20134" }, { "database": "PubMed", "id": "19779198", "url": "https://pubmed.ncbi.nlm.nih.gov/19779198" }, { "database": "PubMed", "id": "18407956", "url": "https://pubmed.ncbi.nlm.nih.gov/18407956" }, { "database": "iPTMnet", "id": "P20134", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P20134" }, { "database": "SGD", "id": "S000005666", "url": "https://www.yeastgenome.org/locus/S000005666" }, { "database": "PubMed", "id": "23749301", "url": "https://pubmed.ncbi.nlm.nih.gov/23749301" }, { "database": "PubMed", "id": "28270554", "url": "https://pubmed.ncbi.nlm.nih.gov/28270554" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" } ], "site_lbl": "Ser556", "uniprot_canonical_ac": "P20134-1" } ], "record_id": "pubmed.28270554", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 35 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 46 }, { "field": "total_sites", "count": 45 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Cysteine is essential for transcriptional regulation of the sulfur assimilation genes in Saccharomyces cerevisiae.", "journal": "Molecular & general genetics : MGG", "date": "2000-04", "authors": "Hansen J, Johannesen P F", "reference": { "type": "PubMed", "id": "10821189", "url": "https://pubmed.ncbi.nlm.nih.gov/10821189" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P47164-1", "protein_name": "Cystathionine gamma-synthase", "gene_name": "STR2", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P53101-1", "protein_name": "Cystathionine beta-lyase", "gene_name": "STR3", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P47164", "url": "https://www.uniprot.org/uniprotkb/P47164" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.10821189", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Chromatin Central: towards the comparative proteome by accurate mapping of the yeast proteomic environment.", "journal": "Genome Biol.", "date": "2008", "authors": "Shevchenko Anna, Roguev Assen, Schaft Daniel, Buchanan Luke, Habermann Bianca, Sakalar Cagri, Thomas Henrik, Krogan Nevan J, Shevchenko Andrej, Stewart A Francis", "reference": { "type": "PubMed", "id": "19040720", "url": "https://pubmed.ncbi.nlm.nih.gov/19040720" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P47168-1", "protein_name": "TEL2-interacting protein 2", "gene_name": "TTI2", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P53127-1", "protein_name": "E3 ubiquitin-protein ligase SNT2", "gene_name": "SNT2", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P34219-1", "protein_name": "Transcriptional regulatory protein TOD6", "gene_name": "TOD6", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P36097-1", "protein_name": "TEL2-interacting protein 1", "gene_name": "TTI1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P40059-1", "protein_name": "Transcriptional regulatory protein DOT6", "gene_name": "DOT6", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q06822-1", "protein_name": "ASTRA-associated protein 1", "gene_name": "ASA1", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P47168", "url": "https://www.uniprot.org/uniprotkb/P47168" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.19040720", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 6 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Studies on yeast sulfite reductase. IV. Structure and steady-state kinetics.", "journal": "Biochim. Biophys. Acta", "date": "1982", "authors": "Kobayashi K, Yoshimoto A", "reference": { "type": "PubMed", "id": "6751400", "url": "https://pubmed.ncbi.nlm.nih.gov/6751400" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P47169-1", "protein_name": "Sulfite reductase [NADPH] subunit beta", "gene_name": "MET5", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P39692-1", "protein_name": "Sulfite reductase [NADPH] flavoprotein component", "gene_name": "MET10", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P47169", "url": "https://www.uniprot.org/uniprotkb/P47169" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.6751400", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "A conserved coatomer-related complex containing Sec13 and Seh1 dynamically associates with the vacuole in Saccharomyces cerevisiae.", "journal": "Molecular & cellular proteomics : MCP", "date": "2011-06", "authors": "Dokudovskaya Svetlana, Waharte Francois, Schlessinger Avner, Pieper Ursula, Devos Damien P, Cristea Ileana M, Williams Rosemary, Salamero Jean, Chait Brian T, Sali Andrej, Field Mark C, Rout Michael P, Dargemont Catherine", "reference": { "type": "PubMed", "id": "21454883", "url": "https://pubmed.ncbi.nlm.nih.gov/21454883" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P47170-1", "protein_name": "Vacuolar membrane-associated protein IML1", "gene_name": "IML1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P53011-1", "protein_name": "Nucleoporin SEH1", "gene_name": "SEH1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q04491-1", "protein_name": "Protein transport protein SEC13", "gene_name": "SEC13", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q03897-1", "protein_name": "Maintenance of telomere capping protein 5", "gene_name": "MTC5", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q08281-1", "protein_name": "Restriction of telomere capping protein 1", "gene_name": "RTC1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P38742-1", "protein_name": "Nitrogen permease regulator 3", "gene_name": "NPR3", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P39923-1", "protein_name": "Nitrogen permease regulator 2", "gene_name": "NPR2", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P38164-1", "protein_name": "SEH-associated protein 4", "gene_name": "SEA4", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P47170", "url": "https://www.uniprot.org/uniprotkb/P47170" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.21454883", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 8 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Defects in SPT16 or POB3 (yFACT) in Saccharomyces cerevisiae cause dependence on the Hir/Hpc pathway: polymerase passage may degrade chromatin structure.", "journal": "Genetics", "date": "2002-12", "authors": "Formosa Tim, Ruone Susan, Adams Melissa D, Olsen Aileen E, Eriksson Peter, Yu Yaxin, Rhoades Alison R, Kaufman Paul D, Stillman David J", "reference": { "type": "PubMed", "id": "12524332", "url": "https://pubmed.ncbi.nlm.nih.gov/12524332" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P47171-1", "protein_name": "Histone transcription regulator 3", "gene_name": "HIR3", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P32479-1", "protein_name": "Protein HIR1", "gene_name": "HIR1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P32480-1", "protein_name": "Protein HIR2", "gene_name": "HIR2", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P32558-1", "protein_name": "FACT complex subunit SPT16", "gene_name": "SPT16", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q01448-1", "protein_name": "Histone promoter control protein 2", "gene_name": "HPC2", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q04636-1", "protein_name": "FACT complex subunit POB3", "gene_name": "POB3", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P47171", "url": "https://www.uniprot.org/uniprotkb/P47171" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.12524332", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 6 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The HIR corepressor complex binds to nucleosomes generating a distinct protein/DNA complex resistant to remodeling by SWI/SNF.", "journal": "Genes Dev.", "date": "2005", "authors": "Prochasson Philippe, Florens Laurence, Swanson Selene K, Washburn Michael P, Workman Jerry L", "reference": { "type": "PubMed", "id": "16264190", "url": "https://pubmed.ncbi.nlm.nih.gov/16264190" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P47171-1", "protein_name": "Histone transcription regulator 3", "gene_name": "HIR3", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P32479-1", "protein_name": "Protein HIR1", "gene_name": "HIR1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P32480-1", "protein_name": "Protein HIR2", "gene_name": "HIR2", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q01448-1", "protein_name": "Histone promoter control protein 2", "gene_name": "HPC2", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P47171", "url": "https://www.uniprot.org/uniprotkb/P47171" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.16264190", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 4 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Replication-independent histone deposition by the HIR complex and Asf1.", "journal": "Curr. Biol.", "date": "2005", "authors": "Green EM, Antczak AJ, Bailey AO, Franco AA, Wu KJ, Yates JR 3rd, Kaufman PD", "reference": { "type": "PubMed", "id": "16303565", "url": "https://pubmed.ncbi.nlm.nih.gov/16303565" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P47171-1", "protein_name": "Histone transcription regulator 3", "gene_name": "HIR3", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P32479-1", "protein_name": "Protein HIR1", "gene_name": "HIR1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P32480-1", "protein_name": "Protein HIR2", "gene_name": "HIR2", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q01448-1", "protein_name": "Histone promoter control protein 2", "gene_name": "HPC2", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P32447-1", "protein_name": "Histone chaperone ASF1", "gene_name": "ASF1", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P47171", "url": "https://www.uniprot.org/uniprotkb/P47171" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "mutagenesis": [ { "start_pos": 36, "end_pos": 37, "sequence_org": "HD", "sequence_mut": "AA", "comment": "Abrogates stimulation of replication-independent chromatin assembly by the HIR complex and abrogates telomeric silencing.", "evidence": [ { "database": "UniProtKB", "id": "P32447", "url": "https://www.uniprot.org/uniprotkb/P32447" }, { "database": "PubMed", "id": "16303565", "url": "https://pubmed.ncbi.nlm.nih.gov/16303565" }, { "database": "PubMed", "id": "14680630", "url": "https://pubmed.ncbi.nlm.nih.gov/14680630" } ], "uniprot_canonical_ac": "P32447-1" } ], "record_id": "pubmed.16303565", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 5 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Two-color cell array screen reveals interdependent roles for histone chaperones and a chromatin boundary regulator in histone gene repression.", "journal": "Mol. Cell", "date": "2009", "authors": "Fillingham Jeffrey, Kainth Pinay, Lambert Jean-Philippe, van Bakel Harm, Tsui Kyle, Pe\u00f1a-Castillo Lourdes, Nislow Corey, Figeys Daniel, Hughes Timothy R, Greenblatt Jack, Andrews Brenda J", "reference": { "type": "PubMed", "id": "19683497", "url": "https://pubmed.ncbi.nlm.nih.gov/19683497" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P47171-1", "protein_name": "Histone transcription regulator 3", "gene_name": "HIR3", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P32479-1", "protein_name": "Protein HIR1", "gene_name": "HIR1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P32480-1", "protein_name": "Protein HIR2", "gene_name": "HIR2", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P32558-1", "protein_name": "FACT complex subunit SPT16", "gene_name": "SPT16", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P35208-1", "protein_name": "Protein SPT10", "gene_name": "SPT10", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P40340-1", "protein_name": "ATPase histone chaperone YTA7", "gene_name": "YTA7", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q01448-1", "protein_name": "Histone promoter control protein 2", "gene_name": "HPC2", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P13712-1", "protein_name": "Histone-binding protein MSI1", "gene_name": "MSI1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P23615-1", "protein_name": "Transcription elongation factor SPT6", "gene_name": "SPT6", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P32914-1", "protein_name": "Transcription elongation factor SPT4", "gene_name": "SPT4", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q04199-1", "protein_name": "Chromatin assembly factor 1 subunit B", "gene_name": "CAC2", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q04636-1", "protein_name": "FACT complex subunit POB3", "gene_name": "POB3", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q07794-1", "protein_name": "Histone acetyltransferase RTT109", "gene_name": "RTT109", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P04911-1", "protein_name": "Histone H2A.1", "gene_name": "HTA1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P27692-1", "protein_name": "Transcription elongation factor SPT5", "gene_name": "SPT5", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P40161-1", "protein_name": "Histone chaperone RTT106", "gene_name": "RTT106", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P47171", "url": "https://www.uniprot.org/uniprotkb/P47171" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.19683497", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 16 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Hir1p and Hir2p function as transcriptional corepressors to regulate histone gene transcription in the Saccharomyces cerevisiae cell cycle.", "journal": "Molecular and cellular biology", "date": "1997-02", "authors": "Spector M S, Raff A, DeSilva H, Lee K, Osley M A", "reference": { "type": "PubMed", "id": "9001207", "url": "https://pubmed.ncbi.nlm.nih.gov/9001207" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P47171-1", "protein_name": "Histone transcription regulator 3", "gene_name": "HIR3", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P32479-1", "protein_name": "Protein HIR1", "gene_name": "HIR1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P32480-1", "protein_name": "Protein HIR2", "gene_name": "HIR2", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P47171", "url": "https://www.uniprot.org/uniprotkb/P47171" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.9001207", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Yeast Ty1 retrotransposition is stimulated by a synergistic interaction between mutations in chromatin assembly factor I and histone regulatory proteins.", "journal": "Mol. Cell. Biol.", "date": "1998", "authors": "Qian Z, Huang H, Hong J Y, Burck C L, Johnston S D, Berman J, Carol A, Liebman S W", "reference": { "type": "PubMed", "id": "9671488", "url": "https://pubmed.ncbi.nlm.nih.gov/9671488" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P47171-1", "protein_name": "Histone transcription regulator 3", "gene_name": "HIR3", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P32479-1", "protein_name": "Protein HIR1", "gene_name": "HIR1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P32480-1", "protein_name": "Protein HIR2", "gene_name": "HIR2", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P47171", "url": "https://www.uniprot.org/uniprotkb/P47171" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.9671488", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "A complete inventory of all enzymes in the eukaryotic methionine salvage pathway.", "journal": "The FEBS journal", "date": "2008-08", "authors": "Pirkov Ivan, Norbeck Joakim, Gustafsson Lena, Albers Eva", "reference": { "type": "PubMed", "id": "18625006", "url": "https://pubmed.ncbi.nlm.nih.gov/18625006" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P47176-1", "protein_name": "Branched-chain-amino-acid aminotransferase, cytosolic", "gene_name": "BAT2", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P53090-1", "protein_name": "Aromatic/aminoadipate aminotransferase 1", "gene_name": "ARO8", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q03677-1", "protein_name": "Acireductone dioxygenase", "gene_name": "ADI1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q06489-1", "protein_name": "Methylthioribose-1-phosphate isomerase", "gene_name": "MRI1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q07938-1", "protein_name": "S-methyl-5'-thioadenosine phosphorylase", "gene_name": "MEU1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P38840-1", "protein_name": "Aromatic amino acid aminotransferase 2", "gene_name": "ARO9", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P38891-1", "protein_name": "Branched-chain-amino-acid aminotransferase, mitochondrial", "gene_name": "BAT1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P47095-1", "protein_name": "Methylthioribulose-1-phosphate dehydratase", "gene_name": "MDE1", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P47176", "url": "https://www.uniprot.org/uniprotkb/P47176" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.18625006", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 8 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Saccharomyces cerevisiae Bat1 and Bat2 aminotransferases have functionally diverged from the ancestral-like Kluyveromyces lactis orthologous enzyme.", "journal": "PloS one", "date": "2011-01-18", "authors": "Col\u00f3n Maritrini, Hern\u00e1ndez Fabiola, L\u00f3pez Karla, Quezada H\u00e9ctor, Gonz\u00e1lez James, L\u00f3pez Geovani, Aranda Cristina, Gonz\u00e1lez Alicia", "reference": { "type": "PubMed", "id": "21267457", "url": "https://pubmed.ncbi.nlm.nih.gov/21267457" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P47176-1", "protein_name": "Branched-chain-amino-acid aminotransferase, cytosolic", "gene_name": "BAT2", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P38891-1", "protein_name": "Branched-chain-amino-acid aminotransferase, mitochondrial", "gene_name": "BAT1", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P47176", "url": "https://www.uniprot.org/uniprotkb/P47176" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.21267457", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Diversification of transcriptional regulation determines subfunctionalization of paralogous branched chain aminotransferases in the yeast Saccharomyces cerevisiae.", "journal": "Genetics", "date": "2017", "authors": "Gonz\u00e1lez James, L\u00f3pez Geovani, Argueta Stefany, Escalera-Fanjul Ximena, El Hafidi Mohammed, Campero-Basaldua Carlos, Strauss Joseph, Riego-Ruiz Lina, Gonz\u00e1lez Alicia", "reference": { "type": "PubMed", "id": "28912343", "url": "https://pubmed.ncbi.nlm.nih.gov/28912343" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P47176-1", "protein_name": "Branched-chain-amino-acid aminotransferase, cytosolic", "gene_name": "BAT2", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P38891-1", "protein_name": "Branched-chain-amino-acid aminotransferase, mitochondrial", "gene_name": "BAT1", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P47176", "url": "https://www.uniprot.org/uniprotkb/P47176" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.28912343", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Uncovering the role of branched-chain amino acid transaminases in Saccharomyces cerevisiae isobutanol biosynthesis.", "journal": "Metab. Eng.", "date": "2017", "authors": "Hammer Sarah K, Avalos Jos\u00e9 L", "reference": { "type": "PubMed", "id": "29037781", "url": "https://pubmed.ncbi.nlm.nih.gov/29037781" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P47176-1", "protein_name": "Branched-chain-amino-acid aminotransferase, cytosolic", "gene_name": "BAT2", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P38891-1", "protein_name": "Branched-chain-amino-acid aminotransferase, mitochondrial", "gene_name": "BAT1", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P47176", "url": "https://www.uniprot.org/uniprotkb/P47176" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.29037781", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Two yeast homologs of ECA39, a target for c-Myc regulation, code for cytosolic and mitochondrial branched-chain amino acid aminotransferases.", "journal": "The Journal of biological chemistry", "date": "1996", "authors": "Eden A, Simchen G, Benvenisty N", "reference": { "type": "PubMed", "id": "8702755", "url": "https://pubmed.ncbi.nlm.nih.gov/8702755" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P47176-1", "protein_name": "Branched-chain-amino-acid aminotransferase, cytosolic", "gene_name": "BAT2", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P38891-1", "protein_name": "Branched-chain-amino-acid aminotransferase, mitochondrial", "gene_name": "BAT1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "O15382-1", "protein_name": "Branched-chain-amino-acid aminotransferase, mitochondrial", "gene_name": "BCAT2", "tax_name": "Human" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P47176", "url": "https://www.uniprot.org/uniprotkb/P47176" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.8702755", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Mitochondrial and cytosolic branched-chain amino acid transaminases from yeast, homologs of the myc oncogene-regulated Eca39 protein.", "journal": "The Journal of biological chemistry", "date": "1996-10-04", "authors": "Kispal G, Steiner H, Court D A, Rolinski B, Lill R", "reference": { "type": "PubMed", "id": "8798704", "url": "https://pubmed.ncbi.nlm.nih.gov/8798704" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P47176-1", "protein_name": "Branched-chain-amino-acid aminotransferase, cytosolic", "gene_name": "BAT2", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P38891-1", "protein_name": "Branched-chain-amino-acid aminotransferase, mitochondrial", "gene_name": "BAT1", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P47176", "url": "https://www.uniprot.org/uniprotkb/P47176" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.8798704", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Deletion of new covalently linked cell wall glycoproteins alters the electrophoretic mobility of phosphorylated wall components of Saccharomyces cerevisiae.", "journal": "J. Bacteriol.", "date": "1999", "authors": "Mrsa V, Ecker M, Strahl-Bolsinger S, Nimtz M, Lehle L, Tanner W", "reference": { "type": "PubMed", "id": "10322008", "url": "https://pubmed.ncbi.nlm.nih.gov/10322008" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P47178-1", "protein_name": "Cell wall protein DAN1", "gene_name": "DAN1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q12127-1", "protein_name": "Covalently-linked cell wall protein 12", "gene_name": "CCW12", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "O13547-1", "protein_name": "Covalently-linked cell wall protein 14", "gene_name": "CCW14", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P47178", "url": "https://www.uniprot.org/uniprotkb/P47178" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.10322008", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The DAN1 gene of S. cerevisiae is regulated in parallel with the hypoxic genes, but by a different mechanism.", "journal": "Gene", "date": "1997", "authors": "Sertil O, Cohen B D, Davies K J, Lowry C V", "reference": { "type": "PubMed", "id": "9224891", "url": "https://pubmed.ncbi.nlm.nih.gov/9224891" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P47178-1", "protein_name": "Cell wall protein DAN1", "gene_name": "DAN1", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P47178", "url": "https://www.uniprot.org/uniprotkb/P47178" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.9224891", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "CCC1 suppresses mitochondrial damage in the yeast model of Friedreich's ataxia by limiting mitochondrial iron accumulation.", "journal": "J. Biol. Chem.", "date": "2000", "authors": "Chen O S, Kaplan J", "reference": { "type": "PubMed", "id": "10713071", "url": "https://pubmed.ncbi.nlm.nih.gov/10713071" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P47818-1", "protein_name": "Protein CCC1", "gene_name": "CCC1", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P47818", "url": "https://www.uniprot.org/uniprotkb/P47818" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.10713071", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "CCC1 is a transporter that mediates vacuolar iron storage in yeast.", "journal": "The Journal of biological chemistry", "date": "2001-08-03", "authors": "Li L, Chen O S, McVey Ward D, Kaplan J", "reference": { "type": "PubMed", "id": "11390404", "url": "https://pubmed.ncbi.nlm.nih.gov/11390404" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P47818-1", "protein_name": "Protein CCC1", "gene_name": "CCC1", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P47818", "url": "https://www.uniprot.org/uniprotkb/P47818" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.11390404", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "A mitochondrial-vacuolar signaling pathway in yeast that affects iron and copper metabolism.", "journal": "J. Biol. Chem.", "date": "2004", "authors": "Li Liangtao, Kaplan Jerry", "reference": { "type": "PubMed", "id": "15161905", "url": "https://pubmed.ncbi.nlm.nih.gov/15161905" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P47818-1", "protein_name": "Protein CCC1", "gene_name": "CCC1", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P47818", "url": "https://www.uniprot.org/uniprotkb/P47818" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.15161905", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Coordinated remodeling of cellular metabolism during iron deficiency through targeted mRNA degradation.", "journal": "Cell", "date": "2005", "authors": "Puig Sergi, Askeland Eric, Thiele Dennis J", "reference": { "type": "PubMed", "id": "15652485", "url": "https://pubmed.ncbi.nlm.nih.gov/15652485" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P47818-1", "protein_name": "Protein CCC1", "gene_name": "CCC1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P47977-1", "protein_name": "mRNA decay factor CTH2", "gene_name": "TIS11", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P47818", "url": "https://www.uniprot.org/uniprotkb/P47818" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "mutagenesis": [ { "start_pos": 190, "end_pos": 190, "sequence_org": "C", "sequence_mut": "A", "comment": "Abolishes mRNA binding.", "evidence": [ { "database": "UniProtKB", "id": "P47977", "url": "https://www.uniprot.org/uniprotkb/P47977" }, { "database": "PubMed", "id": "15652485", "url": "https://pubmed.ncbi.nlm.nih.gov/15652485" } ], "uniprot_canonical_ac": "P47977-1" }, { "start_pos": 190, "end_pos": 190, "sequence_org": "C", "sequence_mut": "R", "comment": "Abolishes mRNA binding.", "evidence": [ { "database": "UniProtKB", "id": "P47977", "url": "https://www.uniprot.org/uniprotkb/P47977" }, { "database": "PubMed", "id": "15652485", "url": "https://pubmed.ncbi.nlm.nih.gov/15652485" } ], "uniprot_canonical_ac": "P47977-1" }, { "start_pos": 213, "end_pos": 213, "sequence_org": "C", "sequence_mut": "A", "comment": "Abolishes mRNA binding.", "evidence": [ { "database": "UniProtKB", "id": "P47977", "url": "https://www.uniprot.org/uniprotkb/P47977" }, { "database": "PubMed", "id": "15652485", "url": "https://pubmed.ncbi.nlm.nih.gov/15652485" } ], "uniprot_canonical_ac": "P47977-1" }, { "start_pos": 213, "end_pos": 213, "sequence_org": "C", "sequence_mut": "R", "comment": "Abolishes mRNA binding.", "evidence": [ { "database": "UniProtKB", "id": "P47977", "url": "https://www.uniprot.org/uniprotkb/P47977" }, { "database": "PubMed", "id": "15652485", "url": "https://pubmed.ncbi.nlm.nih.gov/15652485" } ], "uniprot_canonical_ac": "P47977-1" } ], "record_id": "pubmed.15652485", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Golgi manganese transport is required for rapamycin signaling in Saccharomyces cerevisiae.", "journal": "Genetics", "date": "2007", "authors": "Devasahayam Gina, Burke Daniel J, Sturgill Thomas W", "reference": { "type": "PubMed", "id": "17603109", "url": "https://pubmed.ncbi.nlm.nih.gov/17603109" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P47818-1", "protein_name": "Protein CCC1", "gene_name": "CCC1", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P47818", "url": "https://www.uniprot.org/uniprotkb/P47818" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.17603109", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Yap5 is an iron-responsive transcriptional activator that regulates vacuolar iron storage in yeast.", "journal": "Mol. Cell. Biol.", "date": "2008", "authors": "Li Liangtao, Bagley Dustin, Ward Diane M, Kaplan Jerry", "reference": { "type": "PubMed", "id": "18070921", "url": "https://pubmed.ncbi.nlm.nih.gov/18070921" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P47818-1", "protein_name": "Protein CCC1", "gene_name": "CCC1", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P47818", "url": "https://www.uniprot.org/uniprotkb/P47818" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.18070921", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Sequence, mapping and disruption of CCC1, a gene that cross-complements the Ca(2+)-sensitive phenotype of csg1 mutants.", "journal": "Yeast", "date": "1994", "authors": "Fu D, Beeler T, Dunn T", "reference": { "type": "PubMed", "id": "7941738", "url": "https://pubmed.ncbi.nlm.nih.gov/7941738" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P47818-1", "protein_name": "Protein CCC1", "gene_name": "CCC1", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P47818", "url": "https://www.uniprot.org/uniprotkb/P47818" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.7941738", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The product of HUM1, a novel yeast gene, is required for vacuolar Ca2+/H+ exchange and is related to mammalian Na+/Ca2+ exchangers.", "journal": "Molecular and cellular biology", "date": "1996-07", "authors": "Pozos T C, Sekler I, Cyert M S", "reference": { "type": "PubMed", "id": "8668190", "url": "https://pubmed.ncbi.nlm.nih.gov/8668190" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P47818-1", "protein_name": "Protein CCC1", "gene_name": "CCC1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q99385-1", "protein_name": "Vacuolar calcium ion transporter", "gene_name": "VCX1", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P47818", "url": "https://www.uniprot.org/uniprotkb/P47818" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.8668190", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The role of the Saccharomyces cerevisiae CCC1 gene in the homeostasis of manganese ions.", "journal": "Molecular microbiology", "date": "1996-08", "authors": "Lapinskas P J, Lin S J, Culotta V C", "reference": { "type": "PubMed", "id": "8866476", "url": "https://pubmed.ncbi.nlm.nih.gov/8866476" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P47818-1", "protein_name": "Protein CCC1", "gene_name": "CCC1", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P47818", "url": "https://www.uniprot.org/uniprotkb/P47818" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.8866476", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Interaction of a transcriptional repressor with the RNA polymerase II holoenzyme plays a crucial role in repression.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2001-02-27", "authors": "Zaman Z, Ansari A Z, Koh S S, Young R, Ptashne M", "reference": { "type": "PubMed", "id": "11226276", "url": "https://pubmed.ncbi.nlm.nih.gov/11226276" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P47821-1", "protein_name": "RNA polymerase II holoenzyme cyclin-like subunit", "gene_name": "SSN8", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P39073-1", "protein_name": "Meiotic mRNA stability protein kinase SSN3", "gene_name": "SSN3", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P47821", "url": "https://www.uniprot.org/uniprotkb/P47821" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "mutagenesis": [ { "start_pos": 304, "end_pos": 304, "sequence_org": "D", "sequence_mut": "A", "comment": "Abrogates kinase activity and transcriptional repression.", "evidence": [ { "database": "UniProtKB", "id": "P39073", "url": "https://www.uniprot.org/uniprotkb/P39073" }, { "database": "PubMed", "id": "11226276", "url": "https://pubmed.ncbi.nlm.nih.gov/11226276" }, { "database": "PubMed", "id": "12200444", "url": "https://pubmed.ncbi.nlm.nih.gov/12200444" }, { "database": "PubMed", "id": "9702190", "url": "https://pubmed.ncbi.nlm.nih.gov/9702190" }, { "database": "PubMed", "id": "10360183", "url": "https://pubmed.ncbi.nlm.nih.gov/10360183" }, { "database": "PubMed", "id": "11331604", "url": "https://pubmed.ncbi.nlm.nih.gov/11331604" }, { "database": "PubMed", "id": "12520306", "url": "https://pubmed.ncbi.nlm.nih.gov/12520306" }, { "database": "PubMed", "id": "15240822", "url": "https://pubmed.ncbi.nlm.nih.gov/15240822" } ], "uniprot_canonical_ac": "P39073-1" } ], "record_id": "pubmed.11226276", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The structural and functional organization of the yeast mediator complex.", "journal": "The Journal of biological chemistry", "date": "2001-11-09", "authors": "Kang J S, Kim S H, Hwang M S, Han S J, Lee Y C, Kim Y J", "reference": { "type": "PubMed", "id": "11555651", "url": "https://pubmed.ncbi.nlm.nih.gov/11555651" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P47821-1", "protein_name": "RNA polymerase II holoenzyme cyclin-like subunit", "gene_name": "SSN8", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P47822-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 21", "gene_name": "SRB7", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q08278-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 7", "gene_name": "MED7", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q12343-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 4", "gene_name": "MED4", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P32569-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 17", "gene_name": "SRB4", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P32585-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 18", "gene_name": "SRB5", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P33308-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 9", "gene_name": "CSE2", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P39073-1", "protein_name": "Meiotic mRNA stability protein kinase SSN3", "gene_name": "SSN3", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q99278-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 11", "gene_name": "MED11", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P25046-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 19", "gene_name": "ROX3", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P38304-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 8", "gene_name": "MED8", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q06213-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 10", "gene_name": "NUT2", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q12321-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 1", "gene_name": "MED1", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P47821", "url": "https://www.uniprot.org/uniprotkb/P47821" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.11555651", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 13 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "A complex of the Srb8, -9, -10, and -11 transcriptional regulatory proteins from yeast.", "journal": "The Journal of biological chemistry", "date": "2002-11-15", "authors": "Borggrefe Tilman, Davis Ralph, Erdjument-Bromage Hediye, Tempst Paul, Kornberg Roger D", "reference": { "type": "PubMed", "id": "12200444", "url": "https://pubmed.ncbi.nlm.nih.gov/12200444" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P47821-1", "protein_name": "RNA polymerase II holoenzyme cyclin-like subunit", "gene_name": "SSN8", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P39073-1", "protein_name": "Meiotic mRNA stability protein kinase SSN3", "gene_name": "SSN3", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P25648-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 12", "gene_name": "SRB8", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P38931-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 13", "gene_name": "SSN2", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P47821", "url": "https://www.uniprot.org/uniprotkb/P47821" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "mutagenesis": [ { "start_pos": 304, "end_pos": 304, "sequence_org": "D", "sequence_mut": "A", "comment": "Abrogates kinase activity and transcriptional repression.", "evidence": [ { "database": "UniProtKB", "id": "P39073", "url": "https://www.uniprot.org/uniprotkb/P39073" }, { "database": "PubMed", "id": "11226276", "url": "https://pubmed.ncbi.nlm.nih.gov/11226276" }, { "database": "PubMed", "id": "12200444", "url": "https://pubmed.ncbi.nlm.nih.gov/12200444" }, { "database": "PubMed", "id": "9702190", "url": "https://pubmed.ncbi.nlm.nih.gov/9702190" }, { "database": "PubMed", "id": "10360183", "url": "https://pubmed.ncbi.nlm.nih.gov/10360183" }, { "database": "PubMed", "id": "11331604", "url": "https://pubmed.ncbi.nlm.nih.gov/11331604" }, { "database": "PubMed", "id": "12520306", "url": "https://pubmed.ncbi.nlm.nih.gov/12520306" }, { "database": "PubMed", "id": "15240822", "url": "https://pubmed.ncbi.nlm.nih.gov/15240822" } ], "uniprot_canonical_ac": "P39073-1" } ], "record_id": "pubmed.12200444", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 4 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Srb10/Cdk8 regulates yeast filamentous growth by phosphorylating the transcription factor Ste12.", "journal": "Nature", "date": "2003-01-09", "authors": "Nelson Chris, Goto Susan, Lund Karen, Hung Wesley, Sadowski Ivan", "reference": { "type": "PubMed", "id": "12520306", "url": "https://pubmed.ncbi.nlm.nih.gov/12520306" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P47821-1", "protein_name": "RNA polymerase II holoenzyme cyclin-like subunit", "gene_name": "SSN8", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P39073-1", "protein_name": "Meiotic mRNA stability protein kinase SSN3", "gene_name": "SSN3", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P13574-1", "protein_name": "Protein STE12", "gene_name": "STE12", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P14681-1", "protein_name": "Mitogen-activated protein kinase KSS1", "gene_name": "KSS1", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P47821", "url": "https://www.uniprot.org/uniprotkb/P47821" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "mutagenesis": [ { "start_pos": 304, "end_pos": 304, "sequence_org": "D", "sequence_mut": "A", "comment": "Abrogates kinase activity and transcriptional repression.", "evidence": [ { "database": "UniProtKB", "id": "P39073", "url": "https://www.uniprot.org/uniprotkb/P39073" }, { "database": "PubMed", "id": "11226276", "url": "https://pubmed.ncbi.nlm.nih.gov/11226276" }, { "database": "PubMed", "id": "12200444", "url": "https://pubmed.ncbi.nlm.nih.gov/12200444" }, { "database": "PubMed", "id": "9702190", "url": "https://pubmed.ncbi.nlm.nih.gov/9702190" }, { "database": "PubMed", "id": "10360183", "url": "https://pubmed.ncbi.nlm.nih.gov/10360183" }, { "database": "PubMed", "id": "11331604", "url": "https://pubmed.ncbi.nlm.nih.gov/11331604" }, { "database": "PubMed", "id": "12520306", "url": "https://pubmed.ncbi.nlm.nih.gov/12520306" }, { "database": "PubMed", "id": "15240822", "url": "https://pubmed.ncbi.nlm.nih.gov/15240822" } ], "uniprot_canonical_ac": "P39073-1" } ], "phosphorylation": [ { "start_pos": 261, "end_pos": 261, "kinase_uniprot_canonical_ac": "P39073-1", "kinase_gene_name": "SSN3", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P13574", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P13574" }, { "database": "PubMed", "id": "12520306", "url": "https://pubmed.ncbi.nlm.nih.gov/12520306" }, { "database": "PubMed", "id": "18407956", "url": "https://pubmed.ncbi.nlm.nih.gov/18407956" }, { "database": "PubMed", "id": "20489023", "url": "https://pubmed.ncbi.nlm.nih.gov/20489023" } ], "site_lbl": "Ser261", "uniprot_canonical_ac": "P13574-1" }, { "start_pos": 261, "end_pos": 261, "kinase_uniprot_canonical_ac": "P47821-1", "kinase_gene_name": "SSN8", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P13574", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P13574" }, { "database": "PubMed", "id": "12520306", "url": "https://pubmed.ncbi.nlm.nih.gov/12520306" }, { "database": "PubMed", "id": "18407956", "url": "https://pubmed.ncbi.nlm.nih.gov/18407956" }, { "database": "PubMed", "id": "20489023", "url": "https://pubmed.ncbi.nlm.nih.gov/20489023" } ], "site_lbl": "Ser261", "uniprot_canonical_ac": "P13574-1" }, { "start_pos": 451, "end_pos": 451, "kinase_uniprot_canonical_ac": "P39073-1", "kinase_gene_name": "SSN3", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P13574", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P13574" }, { "database": "PubMed", "id": "12520306", "url": "https://pubmed.ncbi.nlm.nih.gov/12520306" } ], "site_lbl": "Ser451", "uniprot_canonical_ac": "P13574-1" }, { "start_pos": 451, "end_pos": 451, "kinase_uniprot_canonical_ac": "P47821-1", "kinase_gene_name": "SSN8", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P13574", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P13574" }, { "database": "PubMed", "id": "12520306", "url": "https://pubmed.ncbi.nlm.nih.gov/12520306" } ], "site_lbl": "Ser451", "uniprot_canonical_ac": "P13574-1" } ], "record_id": "pubmed.12520306", "abstract": "", "glycosylation": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 4 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 4 }, { "field": "total_sites", "count": 2 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Ask10p mediates the oxidative stress-induced destruction of the Saccharomyces cerevisiae C-type cyclin Ume3p/Srb11p.", "journal": "Eukaryot. Cell", "date": "2003", "authors": "Cohen Todd J, Lee Kun, Rutkowski Lisa H, Strich Randy", "reference": { "type": "PubMed", "id": "14555478", "url": "https://pubmed.ncbi.nlm.nih.gov/14555478" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P47821-1", "protein_name": "RNA polymerase II holoenzyme cyclin-like subunit", "gene_name": "SSN8", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P48361-1", "protein_name": "Activator of SKN7 protein 10", "gene_name": "ASK10", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P04050-1", "protein_name": "DNA-directed RNA polymerase II subunit RPB1", "gene_name": "RPO21", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P47821", "url": "https://www.uniprot.org/uniprotkb/P47821" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.14555478", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The Saccharomyces cerevisiae Srb8-Srb11 complex functions with the SAGA complex during Gal4-activated transcription.", "journal": "Molecular and cellular biology", "date": "2005-01", "authors": "Larschan Erica, Winston Fred", "reference": { "type": "PubMed", "id": "15601835", "url": "https://pubmed.ncbi.nlm.nih.gov/15601835" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P47821-1", "protein_name": "RNA polymerase II holoenzyme cyclin-like subunit", "gene_name": "SSN8", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P39073-1", "protein_name": "Meiotic mRNA stability protein kinase SSN3", "gene_name": "SSN3", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P25648-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 12", "gene_name": "SRB8", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P38931-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 13", "gene_name": "SSN2", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P47821", "url": "https://www.uniprot.org/uniprotkb/P47821" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.15601835", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 4 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Transcriptional activating regions target attached substrates to a cyclin-dependent kinase.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2005-02-15", "authors": "Ansari Aseem Z, Ogirala Anuja, Ptashne Mark", "reference": { "type": "PubMed", "id": "15687503", "url": "https://pubmed.ncbi.nlm.nih.gov/15687503" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P47821-1", "protein_name": "RNA polymerase II holoenzyme cyclin-like subunit", "gene_name": "SSN8", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P39073-1", "protein_name": "Meiotic mRNA stability protein kinase SSN3", "gene_name": "SSN3", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P47821", "url": "https://www.uniprot.org/uniprotkb/P47821" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.15687503", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Mediator and TFIIH govern carboxyl-terminal domain-dependent transcription in yeast extracts.", "journal": "The Journal of biological chemistry", "date": "2005-10-07", "authors": "Nair Dhanalakshmi, Kim Yeejin, Myers Lawrence C", "reference": { "type": "PubMed", "id": "16076843", "url": "https://pubmed.ncbi.nlm.nih.gov/16076843" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P47821-1", "protein_name": "RNA polymerase II holoenzyme cyclin-like subunit", "gene_name": "SSN8", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P47822-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 21", "gene_name": "SRB7", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q08278-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 7", "gene_name": "MED7", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q12343-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 4", "gene_name": "MED4", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P32259-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 16", "gene_name": "SIN4", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P32569-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 17", "gene_name": "SRB4", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P32570-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 22", "gene_name": "SRB6", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P32585-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 18", "gene_name": "SRB5", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P33308-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 9", "gene_name": "CSE2", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P34162-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 20", "gene_name": "SRB2", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P38633-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 31", "gene_name": "SOH1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P38782-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 6", "gene_name": "MED6", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q12124-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 2", "gene_name": "MED2", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P39073-1", "protein_name": "Meiotic mRNA stability protein kinase SSN3", "gene_name": "SSN3", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P53114-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 5", "gene_name": "NUT1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q99278-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 11", "gene_name": "MED11", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P19263-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 14", "gene_name": "RGR1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P25046-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 19", "gene_name": "ROX3", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P25648-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 12", "gene_name": "SRB8", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P38304-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 8", "gene_name": "MED8", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P40356-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 3", "gene_name": "PGD1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q06213-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 10", "gene_name": "NUT2", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q12321-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 1", "gene_name": "MED1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P19659-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 15", "gene_name": "GAL11", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P38931-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 13", "gene_name": "SSN2", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P47821", "url": "https://www.uniprot.org/uniprotkb/P47821" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.16076843", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 25 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Mediator expression profiling epistasis reveals a signal transduction pathway with antagonistic submodules and highly specific downstream targets.", "journal": "Molecular cell", "date": "2005-08-19", "authors": "van de Peppel Jeroen, Kettelarij Nienke, van Bakel Harm, Kockelkorn Thessa T J P, van Leenen Dik, Holstege Frank C P", "reference": { "type": "PubMed", "id": "16109375", "url": "https://pubmed.ncbi.nlm.nih.gov/16109375" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P47821-1", "protein_name": "RNA polymerase II holoenzyme cyclin-like subunit", "gene_name": "SSN8", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P32259-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 16", "gene_name": "SIN4", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P32585-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 18", "gene_name": "SRB5", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P33308-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 9", "gene_name": "CSE2", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P34162-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 20", "gene_name": "SRB2", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P38633-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 31", "gene_name": "SOH1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q12124-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 2", "gene_name": "MED2", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P39073-1", "protein_name": "Meiotic mRNA stability protein kinase SSN3", "gene_name": "SSN3", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P53114-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 5", "gene_name": "NUT1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P25648-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 12", "gene_name": "SRB8", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P40356-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 3", "gene_name": "PGD1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q12321-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 1", "gene_name": "MED1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P19659-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 15", "gene_name": "GAL11", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P38931-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 13", "gene_name": "SSN2", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P47821", "url": "https://www.uniprot.org/uniprotkb/P47821" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "mutagenesis": [ { "start_pos": 208, "end_pos": 208, "sequence_org": "S", "sequence_mut": "A", "comment": "Reduces expression of several genes from the endogenous 2-micron plasmid and augments expression of numerous iron-response genes.", "evidence": [ { "database": "UniProtKB", "id": "Q12124", "url": "https://www.uniprot.org/uniprotkb/Q12124" }, { "database": "PubMed", "id": "14988503", "url": "https://pubmed.ncbi.nlm.nih.gov/14988503" }, { "database": "PubMed", "id": "16109375", "url": "https://pubmed.ncbi.nlm.nih.gov/16109375" } ], "uniprot_canonical_ac": "Q12124-1" } ], "phosphorylation": [ { "start_pos": 208, "end_pos": 208, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by CDK8", "evidence": [ { "database": "UniProtKB", "id": "Q12124", "url": "https://www.uniprot.org/uniprotkb/Q12124" }, { "database": "iPTMnet", "id": "Q12124", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q12124" }, { "database": "PubMed", "id": "14988503", "url": "https://pubmed.ncbi.nlm.nih.gov/14988503" }, { "database": "SGD", "id": "S000002163", "url": "https://www.yeastgenome.org/locus/S000002163" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" }, { "database": "PubMed", "id": "16109375", "url": "https://pubmed.ncbi.nlm.nih.gov/16109375" } ], "site_lbl": "Ser208", "uniprot_canonical_ac": "Q12124-1" } ], "record_id": "pubmed.16109375", "abstract": "", "glycosylation": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 14 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Genome-wide location of the coactivator mediator: Binding without activation and transient Cdk8 interaction on DNA.", "journal": "Molecular cell", "date": "2006-04-21", "authors": "Andrau Jean-Christophe, van de Pasch Loes, Lijnzaad Philip, Bijma Theo, Koerkamp Marian Groot, van de Peppel Jeroen, Werner Michel, Holstege Frank C P", "reference": { "type": "PubMed", "id": "16630888", "url": "https://pubmed.ncbi.nlm.nih.gov/16630888" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P47821-1", "protein_name": "RNA polymerase II holoenzyme cyclin-like subunit", "gene_name": "SSN8", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q08278-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 7", "gene_name": "MED7", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P32569-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 17", "gene_name": "SRB4", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P39073-1", "protein_name": "Meiotic mRNA stability protein kinase SSN3", "gene_name": "SSN3", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q96RN5-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 15", "gene_name": "MED15", "tax_name": "Human" }, { "uniprot_canonical_ac": "P19263-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 14", "gene_name": "RGR1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P25046-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 19", "gene_name": "ROX3", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P40356-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 3", "gene_name": "PGD1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P19659-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 15", "gene_name": "GAL11", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P38931-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 13", "gene_name": "SSN2", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P47821", "url": "https://www.uniprot.org/uniprotkb/P47821" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.16630888", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 10 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Slt2p phosphorylation induces cyclin C nuclear-to-cytoplasmic translocation in response to oxidative stress.", "journal": "Molecular biology of the cell", "date": "2014-04", "authors": "Jin Chunyan, Strich Randy, Cooper Katrina F", "reference": { "type": "PubMed", "id": "24554767", "url": "https://pubmed.ncbi.nlm.nih.gov/24554767" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P47821-1", "protein_name": "RNA polymerase II holoenzyme cyclin-like subunit", "gene_name": "SSN8", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P47821", "url": "https://www.uniprot.org/uniprotkb/P47821" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "phosphorylation": [ { "start_pos": 266, "end_pos": 266, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "SGD", "id": "S000004970", "url": "https://www.yeastgenome.org/locus/S000004970" }, { "database": "iPTMnet", "id": "P47821", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P47821" }, { "database": "PubMed", "id": "18407956", "url": "https://pubmed.ncbi.nlm.nih.gov/18407956" }, { "database": "PubMed", "id": "24554767", "url": "https://pubmed.ncbi.nlm.nih.gov/24554767" }, { "database": "PubMed", "id": "33933450", "url": "https://pubmed.ncbi.nlm.nih.gov/33933450" } ], "site_lbl": "Ser266", "uniprot_canonical_ac": "P47821-1" } ], "record_id": "pubmed.24554767", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Cyclin-dependent protein kinase and cyclin homologs SSN3 and SSN8 contribute to transcriptional control in yeast.", "journal": "Proc. Natl. Acad. Sci. U.S.A.", "date": "1995", "authors": "Kuchin S, Yeghiayan P, Carlson M", "reference": { "type": "PubMed", "id": "7732022", "url": "https://pubmed.ncbi.nlm.nih.gov/7732022" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P47821-1", "protein_name": "RNA polymerase II holoenzyme cyclin-like subunit", "gene_name": "SSN8", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P47821", "url": "https://www.uniprot.org/uniprotkb/P47821" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.7732022", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "A kinase-cyclin pair in the RNA polymerase II holoenzyme.", "journal": "Nature", "date": "1995-03-09", "authors": "Liao S M, Zhang J, Jeffery D A, Koleske A J, Thompson C M, Chao D M, Viljoen M, van Vuuren H J, Young R A", "reference": { "type": "PubMed", "id": "7877695", "url": "https://pubmed.ncbi.nlm.nih.gov/7877695" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P47821-1", "protein_name": "RNA polymerase II holoenzyme cyclin-like subunit", "gene_name": "SSN8", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P39073-1", "protein_name": "Meiotic mRNA stability protein kinase SSN3", "gene_name": "SSN3", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P47821", "url": "https://www.uniprot.org/uniprotkb/P47821" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.7877695", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Temporal regulation of RNA polymerase II by Srb10 and Kin28 cyclin-dependent kinases.", "journal": "Molecular cell", "date": "1998-07", "authors": "Hengartner C J, Myer V E, Liao S M, Wilson C J, Koh S S, Young R A", "reference": { "type": "PubMed", "id": "9702190", "url": "https://pubmed.ncbi.nlm.nih.gov/9702190" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P47821-1", "protein_name": "RNA polymerase II holoenzyme cyclin-like subunit", "gene_name": "SSN8", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P39073-1", "protein_name": "Meiotic mRNA stability protein kinase SSN3", "gene_name": "SSN3", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P04050-1", "protein_name": "DNA-directed RNA polymerase II subunit RPB1", "gene_name": "RPO21", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P47821", "url": "https://www.uniprot.org/uniprotkb/P47821" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "mutagenesis": [ { "start_pos": 304, "end_pos": 304, "sequence_org": "D", "sequence_mut": "A", "comment": "Abrogates kinase activity and transcriptional repression.", "evidence": [ { "database": "UniProtKB", "id": "P39073", "url": "https://www.uniprot.org/uniprotkb/P39073" }, { "database": "PubMed", "id": "11226276", "url": "https://pubmed.ncbi.nlm.nih.gov/11226276" }, { "database": "PubMed", "id": "12200444", "url": "https://pubmed.ncbi.nlm.nih.gov/12200444" }, { "database": "PubMed", "id": "9702190", "url": "https://pubmed.ncbi.nlm.nih.gov/9702190" }, { "database": "PubMed", "id": "10360183", "url": "https://pubmed.ncbi.nlm.nih.gov/10360183" }, { "database": "PubMed", "id": "11331604", "url": "https://pubmed.ncbi.nlm.nih.gov/11331604" }, { "database": "PubMed", "id": "12520306", "url": "https://pubmed.ncbi.nlm.nih.gov/12520306" }, { "database": "PubMed", "id": "15240822", "url": "https://pubmed.ncbi.nlm.nih.gov/15240822" } ], "uniprot_canonical_ac": "P39073-1" } ], "record_id": "pubmed.9702190", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Structure of the yeast RNA polymerase II holoenzyme: mediator conformation and polymerase interaction.", "journal": "Mol. Cell", "date": "2002", "authors": "Davis Joshua A, Takagi Yuichiro, Kornberg Roger D, Asturias Francisco A", "reference": { "type": "PubMed", "id": "12191485", "url": "https://pubmed.ncbi.nlm.nih.gov/12191485" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P47822-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 21", "gene_name": "SRB7", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q08278-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 7", "gene_name": "MED7", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q12343-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 4", "gene_name": "MED4", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P32259-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 16", "gene_name": "SIN4", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P32569-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 17", "gene_name": "SRB4", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P32570-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 22", "gene_name": "SRB6", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P32585-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 18", "gene_name": "SRB5", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P33308-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 9", "gene_name": "CSE2", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P34162-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 20", "gene_name": "SRB2", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P38633-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 31", "gene_name": "SOH1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P38782-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 6", "gene_name": "MED6", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q12124-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 2", "gene_name": "MED2", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P53114-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 5", "gene_name": "NUT1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q99278-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 11", "gene_name": "MED11", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P19263-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 14", "gene_name": "RGR1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P25046-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 19", "gene_name": "ROX3", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P38304-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 8", "gene_name": "MED8", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P40356-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 3", "gene_name": "PGD1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q06213-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 10", "gene_name": "NUT2", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q12321-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 1", "gene_name": "MED1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P19659-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 15", "gene_name": "GAL11", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P47822", "url": "https://www.uniprot.org/uniprotkb/P47822" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.12191485", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 21 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "A conserved mediator hinge revealed in the structure of the MED7-MED21 (Med7-Srb7) heterodimer.", "journal": "J. Biol. Chem.", "date": "2005", "authors": "Baumli Sonja, Hoeppner Sabine, Cramer Patrick", "reference": { "type": "PubMed", "id": "15710619", "url": "https://pubmed.ncbi.nlm.nih.gov/15710619" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P47822-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 21", "gene_name": "SRB7", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q08278-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 7", "gene_name": "MED7", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q12343-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 4", "gene_name": "MED4", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P32569-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 17", "gene_name": "SRB4", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P38782-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 6", "gene_name": "MED6", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q06213-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 10", "gene_name": "NUT2", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P47822", "url": "https://www.uniprot.org/uniprotkb/P47822" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.15710619", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 6 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Preponderance of free mediator in the yeast Saccharomyces cerevisiae.", "journal": "J. Biol. Chem.", "date": "2005", "authors": "Takagi Yuichiro, Chadick James Z, Davis Joshua A, Asturias Francisco J", "reference": { "type": "PubMed", "id": "16002404", "url": "https://pubmed.ncbi.nlm.nih.gov/16002404" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P47822-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 21", "gene_name": "SRB7", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q08278-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 7", "gene_name": "MED7", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q12343-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 4", "gene_name": "MED4", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P32259-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 16", "gene_name": "SIN4", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P32569-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 17", "gene_name": "SRB4", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P32570-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 22", "gene_name": "SRB6", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P32585-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 18", "gene_name": "SRB5", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P33308-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 9", "gene_name": "CSE2", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P34162-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 20", "gene_name": "SRB2", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P38633-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 31", "gene_name": "SOH1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P38782-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 6", "gene_name": "MED6", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q12124-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 2", "gene_name": "MED2", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P53114-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 5", "gene_name": "NUT1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q99278-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 11", "gene_name": "MED11", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P19263-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 14", "gene_name": "RGR1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P25046-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 19", "gene_name": "ROX3", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P38304-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 8", "gene_name": "MED8", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P40356-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 3", "gene_name": "PGD1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q06213-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 10", "gene_name": "NUT2", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q12321-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 1", "gene_name": "MED1", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P47822", "url": "https://www.uniprot.org/uniprotkb/P47822" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.16002404", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 20 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Mediator as a general transcription factor.", "journal": "The Journal of biological chemistry", "date": "2006-01-06", "authors": "Takagi Yuichiro, Kornberg Roger D", "reference": { "type": "PubMed", "id": "16263706", "url": "https://pubmed.ncbi.nlm.nih.gov/16263706" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P47822-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 21", "gene_name": "SRB7", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q08278-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 7", "gene_name": "MED7", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q12343-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 4", "gene_name": "MED4", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P32259-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 16", "gene_name": "SIN4", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P32569-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 17", "gene_name": "SRB4", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P32570-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 22", "gene_name": "SRB6", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P32585-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 18", "gene_name": "SRB5", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P33308-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 9", "gene_name": "CSE2", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P34162-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 20", "gene_name": "SRB2", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P38633-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 31", "gene_name": "SOH1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P38782-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 6", "gene_name": "MED6", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q12124-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 2", "gene_name": "MED2", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P53114-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 5", "gene_name": "NUT1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q99278-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 11", "gene_name": "MED11", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P19263-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 14", "gene_name": "RGR1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P25046-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 19", "gene_name": "ROX3", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P38304-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 8", "gene_name": "MED8", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P40356-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 3", "gene_name": "PGD1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q06213-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 10", "gene_name": "NUT2", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q12321-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 1", "gene_name": "MED1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P19659-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 15", "gene_name": "GAL11", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P47822", "url": "https://www.uniprot.org/uniprotkb/P47822" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.16263706", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 21 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Med19(Rox3) regulates intermodule interactions in the Saccharomyces cerevisiae mediator complex.", "journal": "J. Biol. Chem.", "date": "2007", "authors": "Baidoobonso Shamara M, Guidi Benjamin W, Myers Lawrence C", "reference": { "type": "PubMed", "id": "17192271", "url": "https://pubmed.ncbi.nlm.nih.gov/17192271" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P47822-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 21", "gene_name": "SRB7", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q08278-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 7", "gene_name": "MED7", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q12343-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 4", "gene_name": "MED4", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P32259-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 16", "gene_name": "SIN4", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P32569-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 17", "gene_name": "SRB4", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P32570-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 22", "gene_name": "SRB6", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P32585-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 18", "gene_name": "SRB5", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P33308-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 9", "gene_name": "CSE2", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P34162-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 20", "gene_name": "SRB2", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P38782-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 6", "gene_name": "MED6", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q12124-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 2", "gene_name": "MED2", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P53114-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 5", "gene_name": "NUT1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q99278-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 11", "gene_name": "MED11", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P19263-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 14", "gene_name": "RGR1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P25046-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 19", "gene_name": "ROX3", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P38304-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 8", "gene_name": "MED8", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P40356-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 3", "gene_name": "PGD1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q06213-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 10", "gene_name": "NUT2", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q12321-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 1", "gene_name": "MED1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P19659-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 15", "gene_name": "GAL11", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P47822", "url": "https://www.uniprot.org/uniprotkb/P47822" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.17192271", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 20 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Association of an activator with an RNA polymerase II holoenzyme.", "journal": "Genes & development", "date": "1995-04-15", "authors": "Hengartner C J, Thompson C M, Zhang J, Chao D M, Liao S M, Koleske A J, Okamura S, Young R A", "reference": { "type": "PubMed", "id": "7774808", "url": "https://pubmed.ncbi.nlm.nih.gov/7774808" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P47822-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 21", "gene_name": "SRB7", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P25648-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 12", "gene_name": "SRB8", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P38931-1", "protein_name": "Mediator of RNA polymerase II transcription subunit 13", "gene_name": "SSN2", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P47822", "url": "https://www.uniprot.org/uniprotkb/P47822" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "mutagenesis": [ { "start_pos": 21, "end_pos": 21, "sequence_org": "A", "sequence_mut": "T", "comment": "In SRB7-1; suppresses the phenotypic defects of an RNA polymerase IICTD truncation.", "evidence": [ { "database": "UniProtKB", "id": "P47822", "url": "https://www.uniprot.org/uniprotkb/P47822" }, { "database": "PubMed", "id": "7774808", "url": "https://pubmed.ncbi.nlm.nih.gov/7774808" } ], "uniprot_canonical_ac": "P47822-1" } ], "record_id": "pubmed.7774808", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The Acyl-CoA synthetases encoded within FAA1 and FAA4 in Saccharomyces cerevisiae function as components of the fatty acid transport system linking import, activation, and intracellular Utilization.", "journal": "The Journal of biological chemistry", "date": "2001-10-05", "authors": "Faergeman N J, Black P N, Zhao X D, Knudsen J, DiRusso C C", "reference": { "type": "PubMed", "id": "11477098", "url": "https://pubmed.ncbi.nlm.nih.gov/11477098" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P47912-1", "protein_name": "Long-chain-fatty-acid--CoA ligase 4", "gene_name": "FAA4", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P30624-1", "protein_name": "Long-chain-fatty-acid--CoA ligase 1", "gene_name": "FAA1", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P47912", "url": "https://www.uniprot.org/uniprotkb/P47912" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.11477098", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Vectorial acylation in Saccharomyces cerevisiae. Fat1p and fatty acyl-CoA synthetase are interacting components of a fatty acid import complex.", "journal": "The Journal of biological chemistry", "date": "2003-05-02", "authors": "Zou Zhiying, Tong Fumin, Faergeman Nils J, B\u00f8rsting Claus, Black Paul N, DiRusso Concetta C", "reference": { "type": "PubMed", "id": "12601005", "url": "https://pubmed.ncbi.nlm.nih.gov/12601005" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P47912-1", "protein_name": "Long-chain-fatty-acid--CoA ligase 4", "gene_name": "FAA4", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P30624-1", "protein_name": "Long-chain-fatty-acid--CoA ligase 1", "gene_name": "FAA1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P38225-1", "protein_name": "Very long-chain fatty acid transport protein", "gene_name": "FAT1", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P47912", "url": "https://www.uniprot.org/uniprotkb/P47912" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.12601005", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Lipid particles/droplets of the yeast Saccharomyces cerevisiae revisited: lipidome meets proteome.", "journal": "Biochim. Biophys. Acta", "date": "2011", "authors": "Grillitsch Karlheinz, Connerth Melanie, K\u00f6feler Harald, Arrey Tabiwang N, Rietschel Benjamin, Wagner Brigitte, Karas Michael, Daum G\u00fcnther", "reference": { "type": "PubMed", "id": "21820081", "url": "https://pubmed.ncbi.nlm.nih.gov/21820081" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P47912-1", "protein_name": "Long-chain-fatty-acid--CoA ligase 4", "gene_name": "FAA4", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q12043-1", "protein_name": "Triacylglycerol lipase 5", "gene_name": "TGL5", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P28321-1", "protein_name": "Monoglyceride lipase", "gene_name": "YJU3", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P30624-1", "protein_name": "Long-chain-fatty-acid--CoA ligase 1", "gene_name": "FAA1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P33333-1", "protein_name": "1-acyl-sn-glycerol-3-phosphate acyltransferase", "gene_name": "SLC1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P34163-1", "protein_name": "Sterol esterase TGL1", "gene_name": "TGL1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P36165-1", "protein_name": "Triacylglycerol lipase 4", "gene_name": "TGL4", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q06508-1", "protein_name": "Lysophosphatidic acid:oleoyl-CoA acyltransferase 1", "gene_name": "LOA1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q08650-1", "protein_name": "Diacylglycerol O-acyltransferase 1", "gene_name": "DGA1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P38225-1", "protein_name": "Very long-chain fatty acid transport protein", "gene_name": "FAT1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P40308-1", "protein_name": "Triacylglycerol lipase 3", "gene_name": "TGL3", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P40471-1", "protein_name": "NADPH-dependent 1-acyldihydroxyacetone phosphate reductase", "gene_name": "AYR1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P40219-1", "protein_name": "Lipid droplet organization protein LDO16", "gene_name": "LDO16", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P47912", "url": "https://www.uniprot.org/uniprotkb/P47912" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.21820081", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 13 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The Sjogren-Larsson syndrome gene encodes a hexadecenal dehydrogenase of the sphingosine 1-phosphate degradation pathway.", "journal": "Molecular cell", "date": "2012", "authors": "Nakahara K, Ohkuni A, Kitamura T, Abe K, Naganuma T, Ohno Y, Zoeller RA, Kihara A", "reference": { "type": "PubMed", "id": "22633490", "url": "https://pubmed.ncbi.nlm.nih.gov/22633490" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P47912-1", "protein_name": "Long-chain-fatty-acid--CoA ligase 4", "gene_name": "FAA4", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P30624-1", "protein_name": "Long-chain-fatty-acid--CoA ligase 1", "gene_name": "FAA1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q04458-1", "protein_name": "Fatty aldehyde dehydrogenase HFD1", "gene_name": "HFD1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q9UKU0-4", "protein_name": "Long-chain-fatty-acid--CoA ligase 6", "gene_name": "ACSL6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P33121-1", "protein_name": "Long-chain-fatty-acid--CoA ligase 1", "gene_name": "ACSL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9ULC5-1", "protein_name": "Long-chain-fatty-acid--CoA ligase 5", "gene_name": "ACSL5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51648-1", "protein_name": "Aldehyde dehydrogenase family 3 member A2", "gene_name": "ALDH3A2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60488-1", "protein_name": "Long-chain-fatty-acid--CoA ligase 4", "gene_name": "ACSL4", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95573-1", "protein_name": "Fatty acid CoA ligase Acsl3", "gene_name": "ACSL3", "tax_name": "Human" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P47912", "url": "https://www.uniprot.org/uniprotkb/P47912" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.22633490", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 9 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Identification of acyl-CoA synthetases involved in the mammalian sphingosine 1-phosphate metabolic pathway.", "journal": "Biochem. Biophys. Res. Commun.", "date": "2013", "authors": "Ohkuni A, Ohno Y, Kihara A", "reference": { "type": "PubMed", "id": "24269233", "url": "https://pubmed.ncbi.nlm.nih.gov/24269233" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P47912-1", "protein_name": "Long-chain-fatty-acid--CoA ligase 4", "gene_name": "FAA4", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P30624-1", "protein_name": "Long-chain-fatty-acid--CoA ligase 1", "gene_name": "FAA1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q6P1M0-1", "protein_name": "Long-chain fatty acid transport protein 4", "gene_name": "SLC27A4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UKU0-4", "protein_name": "Long-chain-fatty-acid--CoA ligase 6", "gene_name": "ACSL6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P33121-1", "protein_name": "Long-chain-fatty-acid--CoA ligase 1", "gene_name": "ACSL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9ULC5-1", "protein_name": "Long-chain-fatty-acid--CoA ligase 5", "gene_name": "ACSL5", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14975-1", "protein_name": "Long-chain fatty acid transport protein 2", "gene_name": "SLC27A2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96GR2-1", "protein_name": "Long-chain-fatty-acid--CoA ligase ACSBG1", "gene_name": "ACSBG1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60488-1", "protein_name": "Long-chain-fatty-acid--CoA ligase 4", "gene_name": "ACSL4", "tax_name": "Human" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P47912", "url": "https://www.uniprot.org/uniprotkb/P47912" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.24269233", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 9 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "High-confidence proteomic analysis of yeast lipid droplets identifies additional droplet proteins and reveals connections to dolichol synthesis and sterol acetylation.", "journal": "J. Lipid Res.", "date": "2014", "authors": "Currie Erin, Guo Xiuling, Christiano Romain, Chitraju Chandramohan, Kory Nora, Harrison Kenneth, Haas Joel, Walther Tobias C, Farese Robert V", "reference": { "type": "PubMed", "id": "24868093", "url": "https://pubmed.ncbi.nlm.nih.gov/24868093" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P47912-1", "protein_name": "Long-chain-fatty-acid--CoA ligase 4", "gene_name": "FAA4", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q12043-1", "protein_name": "Triacylglycerol lipase 5", "gene_name": "TGL5", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P28321-1", "protein_name": "Monoglyceride lipase", "gene_name": "YJU3", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P30624-1", "protein_name": "Long-chain-fatty-acid--CoA ligase 1", "gene_name": "FAA1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P33333-1", "protein_name": "1-acyl-sn-glycerol-3-phosphate acyltransferase", "gene_name": "SLC1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P34163-1", "protein_name": "Sterol esterase TGL1", "gene_name": "TGL1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P36165-1", "protein_name": "Triacylglycerol lipase 4", "gene_name": "TGL4", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q04458-1", "protein_name": "Fatty aldehyde dehydrogenase HFD1", "gene_name": "HFD1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q04958-1", "protein_name": "Lysophospholipase NTE1", "gene_name": "NTE1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q06522-1", "protein_name": "Lipid droplet-associated triacylglycerol lipase", "gene_name": "", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q08650-1", "protein_name": "Diacylglycerol O-acyltransferase 1", "gene_name": "DGA1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q08959-1", "protein_name": "Phosphatidylglycerol phospholipase C", "gene_name": "PGC1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P38225-1", "protein_name": "Very long-chain fatty acid transport protein", "gene_name": "FAT1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P40308-1", "protein_name": "Triacylglycerol lipase 3", "gene_name": "TGL3", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P40471-1", "protein_name": "NADPH-dependent 1-acyldihydroxyacetone phosphate reductase", "gene_name": "AYR1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P36090-1", "protein_name": "Uncharacterized protein ANR2", "gene_name": "ANR2", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P47912", "url": "https://www.uniprot.org/uniprotkb/P47912" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.24868093", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 16 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Long-chain bases of sphingolipids are transported into cells via the acyl-CoA synthetases.", "journal": "Scientific reports", "date": "2016", "authors": "Narita T, Naganuma T, Sase Y, Kihara A", "reference": { "type": "PubMed", "id": "27136724", "url": "https://pubmed.ncbi.nlm.nih.gov/27136724" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P47912-1", "protein_name": "Long-chain-fatty-acid--CoA ligase 4", "gene_name": "FAA4", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P30624-1", "protein_name": "Long-chain-fatty-acid--CoA ligase 1", "gene_name": "FAA1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P18163-1", "protein_name": "Long-chain-fatty-acid--CoA ligase 1", "gene_name": "Acsl1", "tax_name": "Rat" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P47912", "url": "https://www.uniprot.org/uniprotkb/P47912" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "mutagenesis": [ { "start_pos": 271, "end_pos": 271, "sequence_org": "S", "sequence_mut": "A", "comment": "Likely essential for ATP utilization. Reduces catalytic activity by 89%. Reduces the LCA palmitic acid transport activity by 71%. has no effect on the LCB dihydrosphingosine (DHS) transport activity.", "evidence": [ { "database": "UniProtKB", "id": "P30624", "url": "https://www.uniprot.org/uniprotkb/P30624" }, { "database": "PubMed", "id": "27136724", "url": "https://pubmed.ncbi.nlm.nih.gov/27136724" } ], "uniprot_canonical_ac": "P30624-1" }, { "start_pos": 538, "end_pos": 538, "sequence_org": "D", "sequence_mut": "A", "comment": "Abolishes catalytic activity. Reduces the LCA palmitic acid transport activity by 96%. Abolishes the LCB dihydrosphingosine (DHS) transport activity.", "evidence": [ { "database": "UniProtKB", "id": "P30624", "url": "https://www.uniprot.org/uniprotkb/P30624" }, { "database": "PubMed", "id": "27136724", "url": "https://pubmed.ncbi.nlm.nih.gov/27136724" } ], "uniprot_canonical_ac": "P30624-1" } ], "record_id": "pubmed.27136724", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Saccharomyces cerevisiae contains four fatty acid activation (FAA) genes: an assessment of their role in regulating protein N-myristoylation and cellular lipid metabolism.", "journal": "The Journal of cell biology", "date": "1994-11", "authors": "Johnson D R, Knoll L J, Levin D E, Gordon J I", "reference": { "type": "PubMed", "id": "7962057", "url": "https://pubmed.ncbi.nlm.nih.gov/7962057" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P47912-1", "protein_name": "Long-chain-fatty-acid--CoA ligase 4", "gene_name": "FAA4", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P47912", "url": "https://www.uniprot.org/uniprotkb/P47912" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.7962057", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Cooperation of two mRNA-binding proteins drives metabolic adaptation to iron deficiency.", "journal": "Cell metabolism", "date": "2008-06", "authors": "Puig Sergi, Vergara Sandra V, Thiele Dennis J", "reference": { "type": "PubMed", "id": "18522836", "url": "https://pubmed.ncbi.nlm.nih.gov/18522836" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P47977-1", "protein_name": "mRNA decay factor CTH2", "gene_name": "TIS11", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P47976-1", "protein_name": "mRNA decay factor CTH1", "gene_name": "CTH1", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P47977", "url": "https://www.uniprot.org/uniprotkb/P47977" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "mutagenesis": [ { "start_pos": 225, "end_pos": 225, "sequence_org": "C", "sequence_mut": "R", "comment": "Abolishes mRNA binding.", "evidence": [ { "database": "UniProtKB", "id": "P47976", "url": "https://www.uniprot.org/uniprotkb/P47976" }, { "database": "PubMed", "id": "18522836", "url": "https://pubmed.ncbi.nlm.nih.gov/18522836" } ], "uniprot_canonical_ac": "P47976-1" } ], "record_id": "pubmed.18522836", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The Cth2 ARE-binding protein recruits the Dhh1 helicase to promote the decay of succinate dehydrogenase SDH4 mRNA in response to iron deficiency.", "journal": "The Journal of biological chemistry", "date": "2008-10-17", "authors": "Pedro-Segura Elisa, Vergara Sandra V, Rodr\u00edguez-Navarro Susana, Parker Roy, Thiele Dennis J, Puig Sergi", "reference": { "type": "PubMed", "id": "18715869", "url": "https://pubmed.ncbi.nlm.nih.gov/18715869" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P47977-1", "protein_name": "mRNA decay factor CTH2", "gene_name": "TIS11", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P22147-1", "protein_name": "5'-3' exoribonuclease 1", "gene_name": "XRN1", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P47977", "url": "https://www.uniprot.org/uniprotkb/P47977" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.18715869", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Regulation of ARE transcript 3' end processing by the yeast Cth2 mRNA decay factor.", "journal": "The EMBO journal", "date": "2008-11-19", "authors": "Prouteau Mano\u00ebl, Daugeron Marie-Claire, S\u00e9raphin Bertrand", "reference": { "type": "PubMed", "id": "18923425", "url": "https://pubmed.ncbi.nlm.nih.gov/18923425" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P47977-1", "protein_name": "mRNA decay factor CTH2", "gene_name": "TIS11", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P47977", "url": "https://www.uniprot.org/uniprotkb/P47977" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.18923425", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Phosphorylation and Proteasome Recognition of the mRNA-Binding Protein Cth2 Facilitates Yeast Adaptation to Iron Deficiency.", "journal": "mBio", "date": "2018-09-18", "authors": "Romero Antonia M, Mart\u00ednez-Pastor Mar, Du Gang, Sol\u00e9 Carme, Carlos Mar\u00eda, Vergara Sandra V, Sanvisens Nerea, Wohlschlegel James A, Toczyski David P, Posas Francesc, de Nadal Eul\u00e0lia, Mart\u00ednez-Pastor Mar\u00eda T, Thiele Dennis J, Puig Sergi", "reference": { "type": "PubMed", "id": "30228242", "url": "https://pubmed.ncbi.nlm.nih.gov/30228242" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P47977-1", "protein_name": "mRNA decay factor CTH2", "gene_name": "TIS11", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P47976-1", "protein_name": "mRNA decay factor CTH1", "gene_name": "CTH1", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P47977", "url": "https://www.uniprot.org/uniprotkb/P47977" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "phosphorylation": [ { "start_pos": 64, "end_pos": 64, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P47977", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P47977" }, { "database": "PubMed", "id": "30228242", "url": "https://pubmed.ncbi.nlm.nih.gov/30228242" }, { "database": "SGD", "id": "S000004126", "url": "https://www.yeastgenome.org/locus/S000004126" } ], "site_lbl": "Ser64", "uniprot_canonical_ac": "P47977-1" }, { "start_pos": 65, "end_pos": 65, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P47977", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P47977" }, { "database": "PubMed", "id": "30228242", "url": "https://pubmed.ncbi.nlm.nih.gov/30228242" }, { "database": "SGD", "id": "S000004126", "url": "https://www.yeastgenome.org/locus/S000004126" } ], "site_lbl": "Ser65", "uniprot_canonical_ac": "P47977-1" }, { "start_pos": 68, "end_pos": 68, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P47977", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P47977" }, { "database": "PubMed", "id": "30228242", "url": "https://pubmed.ncbi.nlm.nih.gov/30228242" }, { "database": "SGD", "id": "S000004126", "url": "https://www.yeastgenome.org/locus/S000004126" } ], "site_lbl": "Ser68", "uniprot_canonical_ac": "P47977-1" }, { "start_pos": 70, "end_pos": 70, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P47977", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P47977" }, { "database": "PubMed", "id": "30228242", "url": "https://pubmed.ncbi.nlm.nih.gov/30228242" }, { "database": "SGD", "id": "S000004126", "url": "https://www.yeastgenome.org/locus/S000004126" } ], "site_lbl": "Ser70", "uniprot_canonical_ac": "P47977-1" }, { "start_pos": 75, "end_pos": 75, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "SGD", "id": "S000002558", "url": "https://www.yeastgenome.org/locus/S000002558" }, { "database": "iPTMnet", "id": "P47976", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P47976" }, { "database": "PubMed", "id": "30228242", "url": "https://pubmed.ncbi.nlm.nih.gov/30228242" } ], "site_lbl": "Ser75", "uniprot_canonical_ac": "P47976-1" }, { "start_pos": 78, "end_pos": 78, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "SGD", "id": "S000002558", "url": "https://www.yeastgenome.org/locus/S000002558" }, { "database": "iPTMnet", "id": "P47976", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P47976" }, { "database": "PubMed", "id": "30228242", "url": "https://pubmed.ncbi.nlm.nih.gov/30228242" } ], "site_lbl": "Ser78", "uniprot_canonical_ac": "P47976-1" } ], "record_id": "pubmed.30228242", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 6 }, { "field": "total_sites", "count": 6 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The yeast homologue YTIS11, of the mammalian TIS11 gene family is a non-essential, glucose repressible gene.", "journal": "Oncogene", "date": "1995", "authors": "Ma Q, Herschman H R", "reference": { "type": "PubMed", "id": "7845673", "url": "https://pubmed.ncbi.nlm.nih.gov/7845673" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P47977-1", "protein_name": "mRNA decay factor CTH2", "gene_name": "TIS11", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P47977", "url": "https://www.uniprot.org/uniprotkb/P47977" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.7845673", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Cloning and characterization of two yeast genes encoding members of the CCCH class of zinc finger proteins: zinc finger-mediated impairment of cell growth.", "journal": "Gene", "date": "1996", "authors": "Thompson M J, Lai W S, Taylor G A, Blackshear P J", "reference": { "type": "PubMed", "id": "8890739", "url": "https://pubmed.ncbi.nlm.nih.gov/8890739" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P47977-1", "protein_name": "mRNA decay factor CTH2", "gene_name": "TIS11", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P47976-1", "protein_name": "mRNA decay factor CTH1", "gene_name": "CTH1", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P47977", "url": "https://www.uniprot.org/uniprotkb/P47977" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.8890739", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The transmembrane domain of acid trehalase mediates ubiquitin-independent multivesicular body pathway sorting.", "journal": "Molecular biology of the cell", "date": "2007-07", "authors": "Huang Ju, Reggiori Fulvio, Klionsky Daniel J", "reference": { "type": "PubMed", "id": "17475771", "url": "https://pubmed.ncbi.nlm.nih.gov/17475771" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P48016-1", "protein_name": "Periplasmic acid trehalase ATH1", "gene_name": "ATH1", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P48016", "url": "https://www.uniprot.org/uniprotkb/P48016" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "mutagenesis": [ { "start_pos": 27, "end_pos": 27, "sequence_org": "K", "sequence_mut": "R", "comment": "Abolishes its ubiquitination; when associated with R-27 and R-37. Normal protein targeting to vacuolar lumen; when associated with R-2 and R-37.", "evidence": [ { "database": "UniProtKB", "id": "P48016", "url": "https://www.uniprot.org/uniprotkb/P48016" }, { "database": "PubMed", "id": "17475771", "url": "https://pubmed.ncbi.nlm.nih.gov/17475771" } ], "uniprot_canonical_ac": "P48016-1" }, { "start_pos": 2, "end_pos": 2, "sequence_org": "K", "sequence_mut": "R", "comment": "Abolishes its ubiquitination; when associated with R-27 and R-37. Normal protein targeting to vacuolar lumen; when associated with R-27 and R-37.", "evidence": [ { "database": "UniProtKB", "id": "P48016", "url": "https://www.uniprot.org/uniprotkb/P48016" }, { "database": "PubMed", "id": "17475771", "url": "https://pubmed.ncbi.nlm.nih.gov/17475771" } ], "uniprot_canonical_ac": "P48016-1" }, { "start_pos": 37, "end_pos": 37, "sequence_org": "K", "sequence_mut": "R", "comment": "Abolishes its ubiquitination; when associated with R-27 and R-37. Normal protein targeting to vacuolar lumen; when associated with R-2 and R-27.", "evidence": [ { "database": "UniProtKB", "id": "P48016", "url": "https://www.uniprot.org/uniprotkb/P48016" }, { "database": "PubMed", "id": "17475771", "url": "https://pubmed.ncbi.nlm.nih.gov/17475771" } ], "uniprot_canonical_ac": "P48016-1" }, { "start_pos": 49, "end_pos": 68, "sequence_org": "NSILLLMMLFLLAIFVTALY", "sequence_mut": "VAILLLMMLFLLAIFVVALF", "comment": "Protein mislocalized to the vacuolar membrane in a small proportion of cells.", "evidence": [ { "database": "UniProtKB", "id": "P48016", "url": "https://www.uniprot.org/uniprotkb/P48016" }, { "database": "PubMed", "id": "17475771", "url": "https://pubmed.ncbi.nlm.nih.gov/17475771" } ], "uniprot_canonical_ac": "P48016-1" } ], "record_id": "pubmed.17475771", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The Saccharomyces cerevisiae vacuolar acid trehalase is targeted at the cell surface for its physiological function.", "journal": "The FEBS journal", "date": "2009-10", "authors": "He Susu, Bystricky Kerstin, Leon Sebastien, Fran\u00e7ois Jean M, Parrou Jean L", "reference": { "type": "PubMed", "id": "19703229", "url": "https://pubmed.ncbi.nlm.nih.gov/19703229" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P48016-1", "protein_name": "Periplasmic acid trehalase ATH1", "gene_name": "ATH1", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P48016", "url": "https://www.uniprot.org/uniprotkb/P48016" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "mutagenesis": [ { "start_pos": 1, "end_pos": 100, "sequence_org": "MKRIRSLWFNAEASYSNLNNSPSLRNKNSTGNNSRSKNYRSFSRFDLINSILLLMMLFLLAIFVTALYLTKSSRLTYSHASRAALFNPLGVISPSLGNHT", "sequence_mut": "", "comment": "Abolishes cell surface localization. Abolishes acid trehalase activity.", "evidence": [ { "database": "UniProtKB", "id": "P48016", "url": "https://www.uniprot.org/uniprotkb/P48016" }, { "database": "PubMed", "id": "19703229", "url": "https://pubmed.ncbi.nlm.nih.gov/19703229" } ], "uniprot_canonical_ac": "P48016-1" }, { "start_pos": 47, "end_pos": 69, "sequence_org": "LINSILLLMMLFLLAIFVTALYL", "sequence_mut": "", "comment": "Abnormal protein expression.", "evidence": [ { "database": "UniProtKB", "id": "P48016", "url": "https://www.uniprot.org/uniprotkb/P48016" }, { "database": "PubMed", "id": "19703229", "url": "https://pubmed.ncbi.nlm.nih.gov/19703229" } ], "uniprot_canonical_ac": "P48016-1" } ], "record_id": "pubmed.19703229", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Isolation and characterization of a novel yeast gene, ATH1, that is required for vacuolar acid trehalase activity.", "journal": "Yeast (Chichester, England)", "date": "1995-09-15", "authors": "Destruelle M, Holzer H, Klionsky D J", "reference": { "type": "PubMed", "id": "7502577", "url": "https://pubmed.ncbi.nlm.nih.gov/7502577" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P48016-1", "protein_name": "Periplasmic acid trehalase ATH1", "gene_name": "ATH1", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P48016", "url": "https://www.uniprot.org/uniprotkb/P48016" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.7502577", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Deletion of the ATH1 gene in Saccharomyces cerevisiae prevents growth on trehalose.", "journal": "FEBS letters", "date": "1996-05-20", "authors": "Nwaka S, Mechler B, Holzer H", "reference": { "type": "PubMed", "id": "8647289", "url": "https://pubmed.ncbi.nlm.nih.gov/8647289" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P48016-1", "protein_name": "Periplasmic acid trehalase ATH1", "gene_name": "ATH1", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P48016", "url": "https://www.uniprot.org/uniprotkb/P48016" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.8647289", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Purification and biochemical characterization of the ATH1 gene product, vacuolar acid trehalase, from Saccharomyces cerevisiae.", "journal": "FEBS letters", "date": "1996-08-12", "authors": "Alizadeh P, Klionsky D J", "reference": { "type": "PubMed", "id": "8764988", "url": "https://pubmed.ncbi.nlm.nih.gov/8764988" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P48016-1", "protein_name": "Periplasmic acid trehalase ATH1", "gene_name": "ATH1", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P48016", "url": "https://www.uniprot.org/uniprotkb/P48016" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.8764988", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The small-subunit processome is a ribosome assembly intermediate.", "journal": "Eukaryotic cell", "date": "2004-12", "authors": "Bernstein Kara A, Gallagher Jennifer E G, Mitchell Brianna M, Granneman Sander, Baserga Susan J", "reference": { "type": "PubMed", "id": "15590835", "url": "https://pubmed.ncbi.nlm.nih.gov/15590835" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P48164-1", "protein_name": "Small ribosomal subunit protein eS7B", "gene_name": "RPS7B", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q06512-1", "protein_name": "Nucleolar complex protein 4", "gene_name": "NOC4", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P35194-1", "protein_name": "U3 small nucleolar RNA-associated protein 20", "gene_name": "UTP20", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P47083-1", "protein_name": "U3 small nucleolar RNA-associated protein MPP10", "gene_name": "MPP10", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P39516-1", "protein_name": "Small ribosomal subunit protein uS11B", "gene_name": "RPS14B", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P25443-1", "protein_name": "Small ribosomal subunit protein uS5", "gene_name": "RPS2", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P25586-1", "protein_name": "KRR1 small subunit processome component", "gene_name": "KRR1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P26786-1", "protein_name": "Small ribosomal subunit protein eS7A", "gene_name": "RPS7A", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P40362-1", "protein_name": "U3 small nucleolar RNA-associated protein 18", "gene_name": "UTP18", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P48234-1", "protein_name": "Ribosome biogenesis protein ENP2", "gene_name": "ENP2", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P53254-1", "protein_name": "U3 small nucleolar RNA-associated protein 22", "gene_name": "UTP22", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q02354-1", "protein_name": "U3 small nucleolar RNA-associated protein 6", "gene_name": "UTP6", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q06078-1", "protein_name": "U3 small nucleolar RNA-associated protein 21", "gene_name": "UTP21", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "O13516-1", "protein_name": "Small ribosomal subunit protein uS4A", "gene_name": "RPS9A", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P05755-1", "protein_name": "Small ribosomal subunit protein uS4B", "gene_name": "RPS9B", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P06367-1", "protein_name": "Small ribosomal subunit protein uS11A", "gene_name": "RPS14A", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P0CX37-1", "protein_name": "Small ribosomal subunit protein eS6A", "gene_name": "RPS6A", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P0CX38-1", "protein_name": "Small ribosomal subunit protein eS6B", "gene_name": "RPS6B", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q06287-1", "protein_name": "Ribosomal RNA small subunit methyltransferase NEP1", "gene_name": "EMG1", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P48164", "url": "https://www.uniprot.org/uniprotkb/P48164" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.15590835", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 19 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] } ]