[ { "title": "Synaptotagmin 1-mediated cell membrane penetration and dopamine release enhancement by latroeggtoxin-VI.", "journal": "International journal of biological macromolecules", "date": "2022-09-01", "authors": "Tang Xiaochao, Yu Dianmei, Wang Haiyan, Lei Zhixiang, Zhai Yiwen, Sun Minglu, Chen Si, Wang Ying, Liu Zhen, Hu Weijun, Wang Xianchun", "reference": { "type": "PubMed", "id": "35914553", "url": "https://pubmed.ncbi.nlm.nih.gov/35914553" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P21707-1", "protein_name": "Synaptotagmin-1", "gene_name": "Syt1", "tax_name": "Rat" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "P21707", "url": "https://www.uniprot.org/uniprotkb/P21707" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "phosphorylation": [ { "start_pos": 195, "end_pos": 195, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P21707", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P21707" }, { "database": "PubMed", "id": "35914553", "url": "https://pubmed.ncbi.nlm.nih.gov/35914553" } ], "site_lbl": "Thr195", "uniprot_canonical_ac": "P21707-1" }, { "start_pos": 201, "end_pos": 201, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P21707", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P21707" }, { "database": "PubMed", "id": "35914553", "url": "https://pubmed.ncbi.nlm.nih.gov/35914553" } ], "site_lbl": "Thr201", "uniprot_canonical_ac": "P21707-1" } ], "record_id": "pubmed.35914553", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Structure of the first C2 domain of synaptotagmin I: a novel Ca2+/phospholipid-binding fold.", "journal": "Cell", "date": "1995", "authors": "Sutton R B, Davletov B A, Berghuis A M, S\u00fcdhof T C, Sprang S R", "reference": { "type": "PubMed", "id": "7697723", "url": "https://pubmed.ncbi.nlm.nih.gov/7697723" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P21707-1", "protein_name": "Synaptotagmin-1", "gene_name": "Syt1", "tax_name": "Rat" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "P21707", "url": "https://www.uniprot.org/uniprotkb/P21707" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "record_id": "pubmed.7697723", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Identification of protein receptor for Clostridium botulinum type B neurotoxin in rat brain synaptosomes.", "journal": "The Journal of biological chemistry", "date": "1994-04-08", "authors": "Nishiki T, Kamata Y, Nemoto Y, Omori A, Ito T, Takahashi M, Kozaki S", "reference": { "type": "PubMed", "id": "8144634", "url": "https://pubmed.ncbi.nlm.nih.gov/8144634" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P21707-1", "protein_name": "Synaptotagmin-1", "gene_name": "Syt1", "tax_name": "Rat" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "P21707", "url": "https://www.uniprot.org/uniprotkb/P21707" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "record_id": "pubmed.8144634", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Solution structures of the Ca2+-free and Ca2+-bound C2A domain of synaptotagmin I: does Ca2+ induce a conformational change?", "journal": "Biochemistry", "date": "1998", "authors": "Shao X, Fernandez I, S\u00fcdhof T C, Rizo J", "reference": { "type": "PubMed", "id": "9819203", "url": "https://pubmed.ncbi.nlm.nih.gov/9819203" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P21707-1", "protein_name": "Synaptotagmin-1", "gene_name": "Syt1", "tax_name": "Rat" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "P21707", "url": "https://www.uniprot.org/uniprotkb/P21707" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "record_id": "pubmed.9819203", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Muscle-specific RING finger 1 is a bona fide ubiquitin ligase that degrades cardiac troponin I.", "journal": "Proc. Natl. Acad. Sci. U.S.A.", "date": "2004", "authors": "Kedar Vishram, McDonough Holly, Arya Ranjana, Li Hui-Hua, Rockman Howard A, Patterson Cam", "reference": { "type": "PubMed", "id": "15601779", "url": "https://pubmed.ncbi.nlm.nih.gov/15601779" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P23693-1", "protein_name": "Troponin I, cardiac muscle", "gene_name": "Tnni3", "tax_name": "Rat" }, { "uniprot_canonical_ac": "Q38HM4-1", "protein_name": "E3 ubiquitin-protein ligase TRIM63", "gene_name": "Trim63", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "P19429-1", "protein_name": "Troponin I, cardiac muscle", "gene_name": "TNNI3", "tax_name": "Human" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "P23693", "url": "https://www.uniprot.org/uniprotkb/P23693" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "record_id": "pubmed.15601779", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Protection against endotoxemia-induced contractile dysfunction in mice with cardiac-specific expression of slow skeletal troponin I.", "journal": "FASEB journal : official publication of the Federation of American Societies for Experimental Biology", "date": "2005", "authors": "Layland J, Cave AC, Warren C, Grieve DJ, Sparks E, Kentish JC, Solaro RJ, Shah AM", "reference": { "type": "PubMed", "id": "15855227", "url": "https://pubmed.ncbi.nlm.nih.gov/15855227" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P23693-1", "protein_name": "Troponin I, cardiac muscle", "gene_name": "Tnni3", "tax_name": "Rat" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "P23693", "url": "https://www.uniprot.org/uniprotkb/P23693" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "phosphorylation": [ { "start_pos": 23, "end_pos": 23, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by PKA and PKD/PRKD1", "evidence": [ { "database": "UniProtKB", "id": "P23693", "url": "https://www.uniprot.org/uniprotkb/P23693" }, { "database": "iPTMnet", "id": "P23693", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P23693" }, { "database": "PubMed", "id": "15855227", "url": "https://pubmed.ncbi.nlm.nih.gov/15855227" }, { "database": "PubMed", "id": "17446435", "url": "https://pubmed.ncbi.nlm.nih.gov/17446435" }, { "database": "PubMed", "id": "19507043", "url": "https://pubmed.ncbi.nlm.nih.gov/19507043" }, { "database": "PubMed", "id": "20925105", "url": "https://pubmed.ncbi.nlm.nih.gov/20925105" }, { "database": "PubMed", "id": "22684024", "url": "https://pubmed.ncbi.nlm.nih.gov/22684024" }, { "database": "PubMed", "id": "26391394", "url": "https://pubmed.ncbi.nlm.nih.gov/26391394" }, { "database": "PubMed", "id": "26406887", "url": "https://pubmed.ncbi.nlm.nih.gov/26406887" }, { "database": "PubMed", "id": "30467191", "url": "https://pubmed.ncbi.nlm.nih.gov/30467191" }, { "database": "PubMed", "id": "34208541", "url": "https://pubmed.ncbi.nlm.nih.gov/34208541" }, { "database": "PubMed", "id": "35482324", "url": "https://pubmed.ncbi.nlm.nih.gov/35482324" } ], "site_lbl": "Ser23", "uniprot_canonical_ac": "P23693-1" }, { "start_pos": 24, "end_pos": 24, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by PKA and PKD/PRKD1", "evidence": [ { "database": "UniProtKB", "id": "P23693", "url": "https://www.uniprot.org/uniprotkb/P23693" }, { "database": "iPTMnet", "id": "P23693", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P23693" }, { "database": "PubMed", "id": "15855227", "url": "https://pubmed.ncbi.nlm.nih.gov/15855227" }, { "database": "PubMed", "id": "17446435", "url": "https://pubmed.ncbi.nlm.nih.gov/17446435" }, { "database": "PubMed", "id": "19507043", "url": "https://pubmed.ncbi.nlm.nih.gov/19507043" }, { "database": "PubMed", "id": "20925105", "url": "https://pubmed.ncbi.nlm.nih.gov/20925105" }, { "database": "PubMed", "id": "22684024", "url": "https://pubmed.ncbi.nlm.nih.gov/22684024" }, { "database": "PubMed", "id": "26391394", "url": "https://pubmed.ncbi.nlm.nih.gov/26391394" }, { "database": "PubMed", "id": "26406887", "url": "https://pubmed.ncbi.nlm.nih.gov/26406887" }, { "database": "PubMed", "id": "30467191", "url": "https://pubmed.ncbi.nlm.nih.gov/30467191" }, { "database": "PubMed", "id": "34208541", "url": "https://pubmed.ncbi.nlm.nih.gov/34208541" }, { "database": "PubMed", "id": "35482324", "url": "https://pubmed.ncbi.nlm.nih.gov/35482324" } ], "site_lbl": "Ser24", "uniprot_canonical_ac": "P23693-1" } ], "record_id": "pubmed.15855227", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The troponin C G159D mutation blunts myofilament desensitization induced by troponin I Ser23/24 phosphorylation.", "journal": "Circulation research", "date": "2007", "authors": "Biesiadecki BJ, Kobayashi T, Walker JS, Solaro RJ, de Tombe PP", "reference": { "type": "PubMed", "id": "17446435", "url": "https://pubmed.ncbi.nlm.nih.gov/17446435" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P23693-1", "protein_name": "Troponin I, cardiac muscle", "gene_name": "Tnni3", "tax_name": "Rat" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "P23693", "url": "https://www.uniprot.org/uniprotkb/P23693" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "phosphorylation": [ { "start_pos": 23, "end_pos": 23, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by PKA and PKD/PRKD1", "evidence": [ { "database": "UniProtKB", "id": "P23693", "url": "https://www.uniprot.org/uniprotkb/P23693" }, { "database": "iPTMnet", "id": "P23693", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P23693" }, { "database": "PubMed", "id": "15855227", "url": "https://pubmed.ncbi.nlm.nih.gov/15855227" }, { "database": "PubMed", "id": "17446435", "url": "https://pubmed.ncbi.nlm.nih.gov/17446435" }, { "database": "PubMed", "id": "19507043", "url": "https://pubmed.ncbi.nlm.nih.gov/19507043" }, { "database": "PubMed", "id": "20925105", "url": "https://pubmed.ncbi.nlm.nih.gov/20925105" }, { "database": "PubMed", "id": "22684024", "url": "https://pubmed.ncbi.nlm.nih.gov/22684024" }, { "database": "PubMed", "id": "26391394", "url": "https://pubmed.ncbi.nlm.nih.gov/26391394" }, { "database": "PubMed", "id": "26406887", "url": "https://pubmed.ncbi.nlm.nih.gov/26406887" }, { "database": "PubMed", "id": "30467191", "url": "https://pubmed.ncbi.nlm.nih.gov/30467191" }, { "database": "PubMed", "id": "34208541", "url": "https://pubmed.ncbi.nlm.nih.gov/34208541" }, { "database": "PubMed", "id": "35482324", "url": "https://pubmed.ncbi.nlm.nih.gov/35482324" } ], "site_lbl": "Ser23", "uniprot_canonical_ac": "P23693-1" }, { "start_pos": 24, "end_pos": 24, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by PKA and PKD/PRKD1", "evidence": [ { "database": "UniProtKB", "id": "P23693", "url": "https://www.uniprot.org/uniprotkb/P23693" }, { "database": "iPTMnet", "id": "P23693", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P23693" }, { "database": "PubMed", "id": "15855227", "url": "https://pubmed.ncbi.nlm.nih.gov/15855227" }, { "database": "PubMed", "id": "17446435", "url": "https://pubmed.ncbi.nlm.nih.gov/17446435" }, { "database": "PubMed", "id": "19507043", "url": "https://pubmed.ncbi.nlm.nih.gov/19507043" }, { "database": "PubMed", "id": "20925105", "url": "https://pubmed.ncbi.nlm.nih.gov/20925105" }, { "database": "PubMed", "id": "22684024", "url": "https://pubmed.ncbi.nlm.nih.gov/22684024" }, { "database": "PubMed", "id": "26391394", "url": "https://pubmed.ncbi.nlm.nih.gov/26391394" }, { "database": "PubMed", "id": "26406887", "url": "https://pubmed.ncbi.nlm.nih.gov/26406887" }, { "database": "PubMed", "id": "30467191", "url": "https://pubmed.ncbi.nlm.nih.gov/30467191" }, { "database": "PubMed", "id": "34208541", "url": "https://pubmed.ncbi.nlm.nih.gov/34208541" }, { "database": "PubMed", "id": "35482324", "url": "https://pubmed.ncbi.nlm.nih.gov/35482324" } ], "site_lbl": "Ser24", "uniprot_canonical_ac": "P23693-1" } ], "record_id": "pubmed.17446435", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Molecular cloning and developmental expression of the rat cardiac-specific isoform of troponin I.", "journal": "J. Mol. Cell. Cardiol.", "date": "1991", "authors": "Martin A F, Orlowski J", "reference": { "type": "PubMed", "id": "1886137", "url": "https://pubmed.ncbi.nlm.nih.gov/1886137" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P23693-1", "protein_name": "Troponin I, cardiac muscle", "gene_name": "Tnni3", "tax_name": "Rat" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "P23693", "url": "https://www.uniprot.org/uniprotkb/P23693" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "record_id": "pubmed.1886137", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Developmental expression of rat cardiac troponin I mRNA.", "journal": "Development", "date": "1991", "authors": "Ausoni S, De Nardi C, Moretti P, Gorza L, Schiaffino S", "reference": { "type": "PubMed", "id": "1935696", "url": "https://pubmed.ncbi.nlm.nih.gov/1935696" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P23693-1", "protein_name": "Troponin I, cardiac muscle", "gene_name": "Tnni3", "tax_name": "Rat" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "P23693", "url": "https://www.uniprot.org/uniprotkb/P23693" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "record_id": "pubmed.1935696", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Reduced force production during low blood flow to the heart correlates with altered troponin I phosphorylation.", "journal": "Journal of muscle research and cell motility", "date": "2009", "authors": "Christopher B, Pizarro GO, Nicholson B, Yuen S, Hoit BD, Ogut O", "reference": { "type": "PubMed", "id": "19507043", "url": "https://pubmed.ncbi.nlm.nih.gov/19507043" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P23693-1", "protein_name": "Troponin I, cardiac muscle", "gene_name": "Tnni3", "tax_name": "Rat" }, { "uniprot_canonical_ac": "P13413-1", "protein_name": "Troponin I, slow skeletal muscle", "gene_name": "Tnni1", "tax_name": "Rat" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "P23693", "url": "https://www.uniprot.org/uniprotkb/P23693" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "phosphorylation": [ { "start_pos": 23, "end_pos": 23, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by PKA and PKD/PRKD1", "evidence": [ { "database": "UniProtKB", "id": "P23693", "url": "https://www.uniprot.org/uniprotkb/P23693" }, { "database": "iPTMnet", "id": "P23693", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P23693" }, { "database": "PubMed", "id": "15855227", "url": "https://pubmed.ncbi.nlm.nih.gov/15855227" }, { "database": "PubMed", "id": "17446435", "url": "https://pubmed.ncbi.nlm.nih.gov/17446435" }, { "database": "PubMed", "id": "19507043", "url": "https://pubmed.ncbi.nlm.nih.gov/19507043" }, { "database": "PubMed", "id": "20925105", "url": "https://pubmed.ncbi.nlm.nih.gov/20925105" }, { "database": "PubMed", "id": "22684024", "url": "https://pubmed.ncbi.nlm.nih.gov/22684024" }, { "database": "PubMed", "id": "26391394", "url": "https://pubmed.ncbi.nlm.nih.gov/26391394" }, { "database": "PubMed", "id": "26406887", "url": "https://pubmed.ncbi.nlm.nih.gov/26406887" }, { "database": "PubMed", "id": "30467191", "url": "https://pubmed.ncbi.nlm.nih.gov/30467191" }, { "database": "PubMed", "id": "34208541", "url": "https://pubmed.ncbi.nlm.nih.gov/34208541" }, { "database": "PubMed", "id": "35482324", "url": "https://pubmed.ncbi.nlm.nih.gov/35482324" } ], "site_lbl": "Ser23", "uniprot_canonical_ac": "P23693-1" }, { "start_pos": 24, "end_pos": 24, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by PKA and PKD/PRKD1", "evidence": [ { "database": "UniProtKB", "id": "P23693", "url": "https://www.uniprot.org/uniprotkb/P23693" }, { "database": "iPTMnet", "id": "P23693", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P23693" }, { "database": "PubMed", "id": "15855227", "url": "https://pubmed.ncbi.nlm.nih.gov/15855227" }, { "database": "PubMed", "id": "17446435", "url": "https://pubmed.ncbi.nlm.nih.gov/17446435" }, { "database": "PubMed", "id": "19507043", "url": "https://pubmed.ncbi.nlm.nih.gov/19507043" }, { "database": "PubMed", "id": "20925105", "url": "https://pubmed.ncbi.nlm.nih.gov/20925105" }, { "database": "PubMed", "id": "22684024", "url": "https://pubmed.ncbi.nlm.nih.gov/22684024" }, { "database": "PubMed", "id": "26391394", "url": "https://pubmed.ncbi.nlm.nih.gov/26391394" }, { "database": "PubMed", "id": "26406887", "url": "https://pubmed.ncbi.nlm.nih.gov/26406887" }, { "database": "PubMed", "id": "30467191", "url": "https://pubmed.ncbi.nlm.nih.gov/30467191" }, { "database": "PubMed", "id": "34208541", "url": "https://pubmed.ncbi.nlm.nih.gov/34208541" }, { "database": "PubMed", "id": "35482324", "url": "https://pubmed.ncbi.nlm.nih.gov/35482324" } ], "site_lbl": "Ser24", "uniprot_canonical_ac": "P23693-1" }, { "start_pos": 43, "end_pos": 43, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by PKC/PRKCE", "evidence": [ { "database": "UniProtKB", "id": "P23693", "url": "https://www.uniprot.org/uniprotkb/P23693" }, { "database": "iPTMnet", "id": "P23693", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P23693" }, { "database": "PubMed", "id": "19507043", "url": "https://pubmed.ncbi.nlm.nih.gov/19507043" } ], "site_lbl": "Ser43", "uniprot_canonical_ac": "P23693-1" }, { "start_pos": 45, "end_pos": 45, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by PKC/PRKCE", "evidence": [ { "database": "UniProtKB", "id": "P23693", "url": "https://www.uniprot.org/uniprotkb/P23693" }, { "database": "iPTMnet", "id": "P23693", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P23693" }, { "database": "PubMed", "id": "19507043", "url": "https://pubmed.ncbi.nlm.nih.gov/19507043" } ], "site_lbl": "Ser45", "uniprot_canonical_ac": "P23693-1" } ], "record_id": "pubmed.19507043", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 4 }, { "field": "total_sites", "count": 4 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Molecular cloning of rat cardiac troponin I and analysis of troponin I isoform expression in developing rat heart.", "journal": "Biochemistry", "date": "1991", "authors": "Murphy A M, Jones L, Sims H F, Strauss A W", "reference": { "type": "PubMed", "id": "1988058", "url": "https://pubmed.ncbi.nlm.nih.gov/1988058" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P23693-1", "protein_name": "Troponin I, cardiac muscle", "gene_name": "Tnni3", "tax_name": "Rat" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "P23693", "url": "https://www.uniprot.org/uniprotkb/P23693" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "record_id": "pubmed.1988058", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Force relaxation and thin filament protein phosphorylation during acute myocardial ischemia.", "journal": "Cytoskeleton (Hoboken, N.J.)", "date": "2011", "authors": "Han YS, Ogut O", "reference": { "type": "PubMed", "id": "20925105", "url": "https://pubmed.ncbi.nlm.nih.gov/20925105" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P23693-1", "protein_name": "Troponin I, cardiac muscle", "gene_name": "Tnni3", "tax_name": "Rat" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "P23693", "url": "https://www.uniprot.org/uniprotkb/P23693" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "phosphorylation": [ { "start_pos": 23, "end_pos": 23, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by PKA and PKD/PRKD1", "evidence": [ { "database": "UniProtKB", "id": "P23693", "url": "https://www.uniprot.org/uniprotkb/P23693" }, { "database": "iPTMnet", "id": "P23693", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P23693" }, { "database": "PubMed", "id": "15855227", "url": "https://pubmed.ncbi.nlm.nih.gov/15855227" }, { "database": "PubMed", "id": "17446435", "url": "https://pubmed.ncbi.nlm.nih.gov/17446435" }, { "database": "PubMed", "id": "19507043", "url": "https://pubmed.ncbi.nlm.nih.gov/19507043" }, { "database": "PubMed", "id": "20925105", "url": "https://pubmed.ncbi.nlm.nih.gov/20925105" }, { "database": "PubMed", "id": "22684024", "url": "https://pubmed.ncbi.nlm.nih.gov/22684024" }, { "database": "PubMed", "id": "26391394", "url": "https://pubmed.ncbi.nlm.nih.gov/26391394" }, { "database": "PubMed", "id": "26406887", "url": "https://pubmed.ncbi.nlm.nih.gov/26406887" }, { "database": "PubMed", "id": "30467191", "url": "https://pubmed.ncbi.nlm.nih.gov/30467191" }, { "database": "PubMed", "id": "34208541", "url": "https://pubmed.ncbi.nlm.nih.gov/34208541" }, { "database": "PubMed", "id": "35482324", "url": "https://pubmed.ncbi.nlm.nih.gov/35482324" } ], "site_lbl": "Ser23", "uniprot_canonical_ac": "P23693-1" }, { "start_pos": 24, "end_pos": 24, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by PKA and PKD/PRKD1", "evidence": [ { "database": "UniProtKB", "id": "P23693", "url": "https://www.uniprot.org/uniprotkb/P23693" }, { "database": "iPTMnet", "id": "P23693", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P23693" }, { "database": "PubMed", "id": "15855227", "url": "https://pubmed.ncbi.nlm.nih.gov/15855227" }, { "database": "PubMed", "id": "17446435", "url": "https://pubmed.ncbi.nlm.nih.gov/17446435" }, { "database": "PubMed", "id": "19507043", "url": "https://pubmed.ncbi.nlm.nih.gov/19507043" }, { "database": "PubMed", "id": "20925105", "url": "https://pubmed.ncbi.nlm.nih.gov/20925105" }, { "database": "PubMed", "id": "22684024", "url": "https://pubmed.ncbi.nlm.nih.gov/22684024" }, { "database": "PubMed", "id": "26391394", "url": "https://pubmed.ncbi.nlm.nih.gov/26391394" }, { "database": "PubMed", "id": "26406887", "url": "https://pubmed.ncbi.nlm.nih.gov/26406887" }, { "database": "PubMed", "id": "30467191", "url": "https://pubmed.ncbi.nlm.nih.gov/30467191" }, { "database": "PubMed", "id": "34208541", "url": "https://pubmed.ncbi.nlm.nih.gov/34208541" }, { "database": "PubMed", "id": "35482324", "url": "https://pubmed.ncbi.nlm.nih.gov/35482324" } ], "site_lbl": "Ser24", "uniprot_canonical_ac": "P23693-1" } ], "record_id": "pubmed.20925105", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Alanine or aspartic acid substitutions at serine23/24 of cardiac troponin I decrease thin filament activation, with no effect on crossbridge detachment kinetics.", "journal": "Archives of biochemistry and biophysics", "date": "2012", "authors": "Mamidi R, Gollapudi SK, Mallampalli SL, Chandra M", "reference": { "type": "PubMed", "id": "22684024", "url": "https://pubmed.ncbi.nlm.nih.gov/22684024" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P23693-1", "protein_name": "Troponin I, cardiac muscle", "gene_name": "Tnni3", "tax_name": "Rat" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "P23693", "url": "https://www.uniprot.org/uniprotkb/P23693" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "phosphorylation": [ { "start_pos": 23, "end_pos": 23, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by PKA and PKD/PRKD1", "evidence": [ { "database": "UniProtKB", "id": "P23693", "url": "https://www.uniprot.org/uniprotkb/P23693" }, { "database": "iPTMnet", "id": "P23693", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P23693" }, { "database": "PubMed", "id": "15855227", "url": "https://pubmed.ncbi.nlm.nih.gov/15855227" }, { "database": "PubMed", "id": "17446435", "url": "https://pubmed.ncbi.nlm.nih.gov/17446435" }, { "database": "PubMed", "id": "19507043", "url": "https://pubmed.ncbi.nlm.nih.gov/19507043" }, { "database": "PubMed", "id": "20925105", "url": "https://pubmed.ncbi.nlm.nih.gov/20925105" }, { "database": "PubMed", "id": "22684024", "url": "https://pubmed.ncbi.nlm.nih.gov/22684024" }, { "database": "PubMed", "id": "26391394", "url": "https://pubmed.ncbi.nlm.nih.gov/26391394" }, { "database": "PubMed", "id": "26406887", "url": "https://pubmed.ncbi.nlm.nih.gov/26406887" }, { "database": "PubMed", "id": "30467191", "url": "https://pubmed.ncbi.nlm.nih.gov/30467191" }, { "database": "PubMed", "id": "34208541", "url": "https://pubmed.ncbi.nlm.nih.gov/34208541" }, { "database": "PubMed", "id": "35482324", "url": "https://pubmed.ncbi.nlm.nih.gov/35482324" } ], "site_lbl": "Ser23", "uniprot_canonical_ac": "P23693-1" }, { "start_pos": 24, "end_pos": 24, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by PKA and PKD/PRKD1", "evidence": [ { "database": "UniProtKB", "id": "P23693", "url": "https://www.uniprot.org/uniprotkb/P23693" }, { "database": "iPTMnet", "id": "P23693", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P23693" }, { "database": "PubMed", "id": "15855227", "url": "https://pubmed.ncbi.nlm.nih.gov/15855227" }, { "database": "PubMed", "id": "17446435", "url": "https://pubmed.ncbi.nlm.nih.gov/17446435" }, { "database": "PubMed", "id": "19507043", "url": "https://pubmed.ncbi.nlm.nih.gov/19507043" }, { "database": "PubMed", "id": "20925105", "url": "https://pubmed.ncbi.nlm.nih.gov/20925105" }, { "database": "PubMed", "id": "22684024", "url": "https://pubmed.ncbi.nlm.nih.gov/22684024" }, { "database": "PubMed", "id": "26391394", "url": "https://pubmed.ncbi.nlm.nih.gov/26391394" }, { "database": "PubMed", "id": "26406887", "url": "https://pubmed.ncbi.nlm.nih.gov/26406887" }, { "database": "PubMed", "id": "30467191", "url": "https://pubmed.ncbi.nlm.nih.gov/30467191" }, { "database": "PubMed", "id": "34208541", "url": "https://pubmed.ncbi.nlm.nih.gov/34208541" }, { "database": "PubMed", "id": "35482324", "url": "https://pubmed.ncbi.nlm.nih.gov/35482324" } ], "site_lbl": "Ser24", "uniprot_canonical_ac": "P23693-1" } ], "record_id": "pubmed.22684024", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Troponin I Mutations R146G and R21C Alter Cardiac Troponin Function, Contractile Properties, and Modulation by Protein Kinase A (PKA)-mediated Phosphorylation.", "journal": "The Journal of biological chemistry", "date": "2015", "authors": "Cheng Y, Rao V, Tu AY, Lindert S, Wang D, Oxenford L, McCulloch AD, McCammon JA, Regnier M", "reference": { "type": "PubMed", "id": "26391394", "url": "https://pubmed.ncbi.nlm.nih.gov/26391394" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P23693-1", "protein_name": "Troponin I, cardiac muscle", "gene_name": "Tnni3", "tax_name": "Rat" }, { "uniprot_canonical_ac": "P13413-1", "protein_name": "Troponin I, slow skeletal muscle", "gene_name": "Tnni1", "tax_name": "Rat" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "P23693", "url": "https://www.uniprot.org/uniprotkb/P23693" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "phosphorylation": [ { "start_pos": 23, "end_pos": 23, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by PKA and PKD/PRKD1", "evidence": [ { "database": "UniProtKB", "id": "P23693", "url": "https://www.uniprot.org/uniprotkb/P23693" }, { "database": "iPTMnet", "id": "P23693", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P23693" }, { "database": "PubMed", "id": "15855227", "url": "https://pubmed.ncbi.nlm.nih.gov/15855227" }, { "database": "PubMed", "id": "17446435", "url": "https://pubmed.ncbi.nlm.nih.gov/17446435" }, { "database": "PubMed", "id": "19507043", "url": "https://pubmed.ncbi.nlm.nih.gov/19507043" }, { "database": "PubMed", "id": "20925105", "url": "https://pubmed.ncbi.nlm.nih.gov/20925105" }, { "database": "PubMed", "id": "22684024", "url": "https://pubmed.ncbi.nlm.nih.gov/22684024" }, { "database": "PubMed", "id": "26391394", "url": "https://pubmed.ncbi.nlm.nih.gov/26391394" }, { "database": "PubMed", "id": "26406887", "url": "https://pubmed.ncbi.nlm.nih.gov/26406887" }, { "database": "PubMed", "id": "30467191", "url": "https://pubmed.ncbi.nlm.nih.gov/30467191" }, { "database": "PubMed", "id": "34208541", "url": "https://pubmed.ncbi.nlm.nih.gov/34208541" }, { "database": "PubMed", "id": "35482324", "url": "https://pubmed.ncbi.nlm.nih.gov/35482324" } ], "site_lbl": "Ser23", "uniprot_canonical_ac": "P23693-1" }, { "start_pos": 24, "end_pos": 24, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by PKA and PKD/PRKD1", "evidence": [ { "database": "UniProtKB", "id": "P23693", "url": "https://www.uniprot.org/uniprotkb/P23693" }, { "database": "iPTMnet", "id": "P23693", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P23693" }, { "database": "PubMed", "id": "15855227", "url": "https://pubmed.ncbi.nlm.nih.gov/15855227" }, { "database": "PubMed", "id": "17446435", "url": "https://pubmed.ncbi.nlm.nih.gov/17446435" }, { "database": "PubMed", "id": "19507043", "url": "https://pubmed.ncbi.nlm.nih.gov/19507043" }, { "database": "PubMed", "id": "20925105", "url": "https://pubmed.ncbi.nlm.nih.gov/20925105" }, { "database": "PubMed", "id": "22684024", "url": "https://pubmed.ncbi.nlm.nih.gov/22684024" }, { "database": "PubMed", "id": "26391394", "url": "https://pubmed.ncbi.nlm.nih.gov/26391394" }, { "database": "PubMed", "id": "26406887", "url": "https://pubmed.ncbi.nlm.nih.gov/26406887" }, { "database": "PubMed", "id": "30467191", "url": "https://pubmed.ncbi.nlm.nih.gov/30467191" }, { "database": "PubMed", "id": "34208541", "url": "https://pubmed.ncbi.nlm.nih.gov/34208541" }, { "database": "PubMed", "id": "35482324", "url": "https://pubmed.ncbi.nlm.nih.gov/35482324" } ], "site_lbl": "Ser24", "uniprot_canonical_ac": "P23693-1" } ], "record_id": "pubmed.26391394", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Maternal Nutrient Restriction Alters Ca2+ Handling Properties and Contractile Function of Isolated Left Ventricle Bundles in Male But Not Female Juvenile Rats.", "journal": "PloS one", "date": "2015", "authors": "Harvey TJ, Murphy RM, Morrison JL, Posterino GS", "reference": { "type": "PubMed", "id": "26406887", "url": "https://pubmed.ncbi.nlm.nih.gov/26406887" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P23693-1", "protein_name": "Troponin I, cardiac muscle", "gene_name": "Tnni3", "tax_name": "Rat" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "P23693", "url": "https://www.uniprot.org/uniprotkb/P23693" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "phosphorylation": [ { "start_pos": 23, "end_pos": 23, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by PKA and PKD/PRKD1", "evidence": [ { "database": "UniProtKB", "id": "P23693", "url": "https://www.uniprot.org/uniprotkb/P23693" }, { "database": "iPTMnet", "id": "P23693", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P23693" }, { "database": "PubMed", "id": "15855227", "url": "https://pubmed.ncbi.nlm.nih.gov/15855227" }, { "database": "PubMed", "id": "17446435", "url": "https://pubmed.ncbi.nlm.nih.gov/17446435" }, { "database": "PubMed", "id": "19507043", "url": "https://pubmed.ncbi.nlm.nih.gov/19507043" }, { "database": "PubMed", "id": "20925105", "url": "https://pubmed.ncbi.nlm.nih.gov/20925105" }, { "database": "PubMed", "id": "22684024", "url": "https://pubmed.ncbi.nlm.nih.gov/22684024" }, { "database": "PubMed", "id": "26391394", "url": "https://pubmed.ncbi.nlm.nih.gov/26391394" }, { "database": "PubMed", "id": "26406887", "url": "https://pubmed.ncbi.nlm.nih.gov/26406887" }, { "database": "PubMed", "id": "30467191", "url": "https://pubmed.ncbi.nlm.nih.gov/30467191" }, { "database": "PubMed", "id": "34208541", "url": "https://pubmed.ncbi.nlm.nih.gov/34208541" }, { "database": "PubMed", "id": "35482324", "url": "https://pubmed.ncbi.nlm.nih.gov/35482324" } ], "site_lbl": "Ser23", "uniprot_canonical_ac": "P23693-1" }, { "start_pos": 24, "end_pos": 24, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by PKA and PKD/PRKD1", "evidence": [ { "database": "UniProtKB", "id": "P23693", "url": "https://www.uniprot.org/uniprotkb/P23693" }, { "database": "iPTMnet", "id": "P23693", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P23693" }, { "database": "PubMed", "id": "15855227", "url": "https://pubmed.ncbi.nlm.nih.gov/15855227" }, { "database": "PubMed", "id": "17446435", "url": "https://pubmed.ncbi.nlm.nih.gov/17446435" }, { "database": "PubMed", "id": "19507043", "url": "https://pubmed.ncbi.nlm.nih.gov/19507043" }, { "database": "PubMed", "id": "20925105", "url": "https://pubmed.ncbi.nlm.nih.gov/20925105" }, { "database": "PubMed", "id": "22684024", "url": "https://pubmed.ncbi.nlm.nih.gov/22684024" }, { "database": "PubMed", "id": "26391394", "url": "https://pubmed.ncbi.nlm.nih.gov/26391394" }, { "database": "PubMed", "id": "26406887", "url": "https://pubmed.ncbi.nlm.nih.gov/26406887" }, { "database": "PubMed", "id": "30467191", "url": "https://pubmed.ncbi.nlm.nih.gov/30467191" }, { "database": "PubMed", "id": "34208541", "url": "https://pubmed.ncbi.nlm.nih.gov/34208541" }, { "database": "PubMed", "id": "35482324", "url": "https://pubmed.ncbi.nlm.nih.gov/35482324" } ], "site_lbl": "Ser24", "uniprot_canonical_ac": "P23693-1" } ], "record_id": "pubmed.26406887", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Functional cardiac orexin receptors: role of orexin-B/orexin 2 receptor in myocardial protection.", "journal": "Clinical science (London, England : 1979)", "date": "2018", "authors": "Patel VH, Karteris E, Chen J, Kyrou I, Mattu HS, Dimitriadis GK, Rodrigo G, Antoniades C, Antonopoulos A, Tan BK, Hillhouse EW, Ng A, Randeva HS", "reference": { "type": "PubMed", "id": "30467191", "url": "https://pubmed.ncbi.nlm.nih.gov/30467191" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P23693-1", "protein_name": "Troponin I, cardiac muscle", "gene_name": "Tnni3", "tax_name": "Rat" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "P23693", "url": "https://www.uniprot.org/uniprotkb/P23693" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "phosphorylation": [ { "start_pos": 23, "end_pos": 23, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by PKA and PKD/PRKD1", "evidence": [ { "database": "UniProtKB", "id": "P23693", "url": "https://www.uniprot.org/uniprotkb/P23693" }, { "database": "iPTMnet", "id": "P23693", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P23693" }, { "database": "PubMed", "id": "15855227", "url": "https://pubmed.ncbi.nlm.nih.gov/15855227" }, { "database": "PubMed", "id": "17446435", "url": "https://pubmed.ncbi.nlm.nih.gov/17446435" }, { "database": "PubMed", "id": "19507043", "url": "https://pubmed.ncbi.nlm.nih.gov/19507043" }, { "database": "PubMed", "id": "20925105", "url": "https://pubmed.ncbi.nlm.nih.gov/20925105" }, { "database": "PubMed", "id": "22684024", "url": "https://pubmed.ncbi.nlm.nih.gov/22684024" }, { "database": "PubMed", "id": "26391394", "url": "https://pubmed.ncbi.nlm.nih.gov/26391394" }, { "database": "PubMed", "id": "26406887", "url": "https://pubmed.ncbi.nlm.nih.gov/26406887" }, { "database": "PubMed", "id": "30467191", "url": "https://pubmed.ncbi.nlm.nih.gov/30467191" }, { "database": "PubMed", "id": "34208541", "url": "https://pubmed.ncbi.nlm.nih.gov/34208541" }, { "database": "PubMed", "id": "35482324", "url": "https://pubmed.ncbi.nlm.nih.gov/35482324" } ], "site_lbl": "Ser23", "uniprot_canonical_ac": "P23693-1" }, { "start_pos": 24, "end_pos": 24, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by PKA and PKD/PRKD1", "evidence": [ { "database": "UniProtKB", "id": "P23693", "url": "https://www.uniprot.org/uniprotkb/P23693" }, { "database": "iPTMnet", "id": "P23693", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P23693" }, { "database": "PubMed", "id": "15855227", "url": "https://pubmed.ncbi.nlm.nih.gov/15855227" }, { "database": "PubMed", "id": "17446435", "url": "https://pubmed.ncbi.nlm.nih.gov/17446435" }, { "database": "PubMed", "id": "19507043", "url": "https://pubmed.ncbi.nlm.nih.gov/19507043" }, { "database": "PubMed", "id": "20925105", "url": "https://pubmed.ncbi.nlm.nih.gov/20925105" }, { "database": "PubMed", "id": "22684024", "url": "https://pubmed.ncbi.nlm.nih.gov/22684024" }, { "database": "PubMed", "id": "26391394", "url": "https://pubmed.ncbi.nlm.nih.gov/26391394" }, { "database": "PubMed", "id": "26406887", "url": "https://pubmed.ncbi.nlm.nih.gov/26406887" }, { "database": "PubMed", "id": "30467191", "url": "https://pubmed.ncbi.nlm.nih.gov/30467191" }, { "database": "PubMed", "id": "34208541", "url": "https://pubmed.ncbi.nlm.nih.gov/34208541" }, { "database": "PubMed", "id": "35482324", "url": "https://pubmed.ncbi.nlm.nih.gov/35482324" } ], "site_lbl": "Ser24", "uniprot_canonical_ac": "P23693-1" } ], "record_id": "pubmed.30467191", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Altered expression levels of autophagy-associated proteins during exercise preconditioning indicate the involvement of autophagy in cardioprotection against exercise-induced myocardial injury.", "journal": "The journal of physiological sciences : JPS", "date": "2020", "authors": "Yuan JQ, Yuan Y, Pan SS, Cai K", "reference": { "type": "PubMed", "id": "32066368", "url": "https://pubmed.ncbi.nlm.nih.gov/32066368" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P23693-1", "protein_name": "Troponin I, cardiac muscle", "gene_name": "Tnni3", "tax_name": "Rat" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "P23693", "url": "https://www.uniprot.org/uniprotkb/P23693" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "record_id": "pubmed.32066368", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Phosphorylation of Troponin I finely controls the positioning of Troponin for the optimal regulation of cardiac muscle contraction.", "journal": "Journal of molecular and cellular cardiology", "date": "2021", "authors": "Kachooei E, Cordina NM, Potluri PR, Guse JA, McCamey D, Brown LJ", "reference": { "type": "PubMed", "id": "33080242", "url": "https://pubmed.ncbi.nlm.nih.gov/33080242" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P23693-1", "protein_name": "Troponin I, cardiac muscle", "gene_name": "Tnni3", "tax_name": "Rat" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "P23693", "url": "https://www.uniprot.org/uniprotkb/P23693" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "record_id": "pubmed.33080242", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "MiR-449 improves cardiac function by regulating HDAC1 and cTnI.", "journal": "European review for medical and pharmacological sciences", "date": "2020", "authors": "Yang B, Zhao H, Dong R", "reference": { "type": "PubMed", "id": "33378032", "url": "https://pubmed.ncbi.nlm.nih.gov/33378032" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P23693-1", "protein_name": "Troponin I, cardiac muscle", "gene_name": "Tnni3", "tax_name": "Rat" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "P23693", "url": "https://www.uniprot.org/uniprotkb/P23693" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "record_id": "pubmed.33378032", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Interventricular Differences of Signaling Pathways-Mediated Regulation of Cardiomyocyte Function in Response to High Oxidative Stress in the Post-Ischemic Failing Rat Heart.", "journal": "Antioxidants (Basel, Switzerland)", "date": "2021-06-16", "authors": "Kov\u00e1cs \u00c1rp\u00e1d, Herwig Melissa, Budde Heidi, Delalat Simin, Kolijn Detmar, B\u00f3di Be\u00e1ta, Hassoun Roua, Tangos Melina, Zhazykbayeva Saltanat, Balogh \u00c1gnes, Czuriga D\u00e1niel, Van Linthout Sophie, Tsch\u00f6pe Carsten, Dhalla Naranjan S, M\u00fcgge Andreas, T\u00f3th Attila, Papp Zolt\u00e1n, Barta Judit, Hamdani Nazha", "reference": { "type": "PubMed", "id": "34208541", "url": "https://pubmed.ncbi.nlm.nih.gov/34208541" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P23693-1", "protein_name": "Troponin I, cardiac muscle", "gene_name": "Tnni3", "tax_name": "Rat" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "P23693", "url": "https://www.uniprot.org/uniprotkb/P23693" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "phosphorylation": [ { "start_pos": 23, "end_pos": 23, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by PKA and PKD/PRKD1", "evidence": [ { "database": "UniProtKB", "id": "P23693", "url": "https://www.uniprot.org/uniprotkb/P23693" }, { "database": "iPTMnet", "id": "P23693", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P23693" }, { "database": "PubMed", "id": "15855227", "url": "https://pubmed.ncbi.nlm.nih.gov/15855227" }, { "database": "PubMed", "id": "17446435", "url": "https://pubmed.ncbi.nlm.nih.gov/17446435" }, { "database": "PubMed", "id": "19507043", "url": "https://pubmed.ncbi.nlm.nih.gov/19507043" }, { "database": "PubMed", "id": "20925105", "url": "https://pubmed.ncbi.nlm.nih.gov/20925105" }, { "database": "PubMed", "id": "22684024", "url": "https://pubmed.ncbi.nlm.nih.gov/22684024" }, { "database": "PubMed", "id": "26391394", "url": "https://pubmed.ncbi.nlm.nih.gov/26391394" }, { "database": "PubMed", "id": "26406887", "url": "https://pubmed.ncbi.nlm.nih.gov/26406887" }, { "database": "PubMed", "id": "30467191", "url": "https://pubmed.ncbi.nlm.nih.gov/30467191" }, { "database": "PubMed", "id": "34208541", "url": "https://pubmed.ncbi.nlm.nih.gov/34208541" }, { "database": "PubMed", "id": "35482324", "url": "https://pubmed.ncbi.nlm.nih.gov/35482324" } ], "site_lbl": "Ser23", "uniprot_canonical_ac": "P23693-1" }, { "start_pos": 24, "end_pos": 24, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by PKA and PKD/PRKD1", "evidence": [ { "database": "UniProtKB", "id": "P23693", "url": "https://www.uniprot.org/uniprotkb/P23693" }, { "database": "iPTMnet", "id": "P23693", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P23693" }, { "database": "PubMed", "id": "15855227", "url": "https://pubmed.ncbi.nlm.nih.gov/15855227" }, { "database": "PubMed", "id": "17446435", "url": "https://pubmed.ncbi.nlm.nih.gov/17446435" }, { "database": "PubMed", "id": "19507043", "url": "https://pubmed.ncbi.nlm.nih.gov/19507043" }, { "database": "PubMed", "id": "20925105", "url": "https://pubmed.ncbi.nlm.nih.gov/20925105" }, { "database": "PubMed", "id": "22684024", "url": "https://pubmed.ncbi.nlm.nih.gov/22684024" }, { "database": "PubMed", "id": "26391394", "url": "https://pubmed.ncbi.nlm.nih.gov/26391394" }, { "database": "PubMed", "id": "26406887", "url": "https://pubmed.ncbi.nlm.nih.gov/26406887" }, { "database": "PubMed", "id": "30467191", "url": "https://pubmed.ncbi.nlm.nih.gov/30467191" }, { "database": "PubMed", "id": "34208541", "url": "https://pubmed.ncbi.nlm.nih.gov/34208541" }, { "database": "PubMed", "id": "35482324", "url": "https://pubmed.ncbi.nlm.nih.gov/35482324" } ], "site_lbl": "Ser24", "uniprot_canonical_ac": "P23693-1" } ], "record_id": "pubmed.34208541", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Exercise-induced alterations of myocardial sarcomere dynamics are associated with hypophosphorylation of cardiac troponin I.", "journal": "Reviews in cardiovascular medicine", "date": "2021", "authors": "Bodi B, Olah A, Martha L, Toth A, Radovits T, Merkely B, Papp Z", "reference": { "type": "PubMed", "id": "34957754", "url": "https://pubmed.ncbi.nlm.nih.gov/34957754" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P23693-1", "protein_name": "Troponin I, cardiac muscle", "gene_name": "Tnni3", "tax_name": "Rat" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "P23693", "url": "https://www.uniprot.org/uniprotkb/P23693" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "record_id": "pubmed.34957754", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Treadmill running increases the calcium sensitivity of myofilaments in diabetic rats.", "journal": "Journal of applied physiology (Bethesda, Md. : 1985)", "date": "2022-06-01", "authors": "Greenman Angela C, Diffee Gary M, Power Amelia S, Wilkins Gerard T, Gold Olivia M S, Erickson Jeffrey R, Baldi James C", "reference": { "type": "PubMed", "id": "35482324", "url": "https://pubmed.ncbi.nlm.nih.gov/35482324" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P23693-1", "protein_name": "Troponin I, cardiac muscle", "gene_name": "Tnni3", "tax_name": "Rat" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "P23693", "url": "https://www.uniprot.org/uniprotkb/P23693" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "phosphorylation": [ { "start_pos": 23, "end_pos": 23, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by PKA and PKD/PRKD1", "evidence": [ { "database": "UniProtKB", "id": "P23693", "url": "https://www.uniprot.org/uniprotkb/P23693" }, { "database": "iPTMnet", "id": "P23693", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P23693" }, { "database": "PubMed", "id": "15855227", "url": "https://pubmed.ncbi.nlm.nih.gov/15855227" }, { "database": "PubMed", "id": "17446435", "url": "https://pubmed.ncbi.nlm.nih.gov/17446435" }, { "database": "PubMed", "id": "19507043", "url": "https://pubmed.ncbi.nlm.nih.gov/19507043" }, { "database": "PubMed", "id": "20925105", "url": "https://pubmed.ncbi.nlm.nih.gov/20925105" }, { "database": "PubMed", "id": "22684024", "url": "https://pubmed.ncbi.nlm.nih.gov/22684024" }, { "database": "PubMed", "id": "26391394", "url": "https://pubmed.ncbi.nlm.nih.gov/26391394" }, { "database": "PubMed", "id": "26406887", "url": "https://pubmed.ncbi.nlm.nih.gov/26406887" }, { "database": "PubMed", "id": "30467191", "url": "https://pubmed.ncbi.nlm.nih.gov/30467191" }, { "database": "PubMed", "id": "34208541", "url": "https://pubmed.ncbi.nlm.nih.gov/34208541" }, { "database": "PubMed", "id": "35482324", "url": "https://pubmed.ncbi.nlm.nih.gov/35482324" } ], "site_lbl": "Ser23", "uniprot_canonical_ac": "P23693-1" }, { "start_pos": 24, "end_pos": 24, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by PKA and PKD/PRKD1", "evidence": [ { "database": "UniProtKB", "id": "P23693", "url": "https://www.uniprot.org/uniprotkb/P23693" }, { "database": "iPTMnet", "id": "P23693", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P23693" }, { "database": "PubMed", "id": "15855227", "url": "https://pubmed.ncbi.nlm.nih.gov/15855227" }, { "database": "PubMed", "id": "17446435", "url": "https://pubmed.ncbi.nlm.nih.gov/17446435" }, { "database": "PubMed", "id": "19507043", "url": "https://pubmed.ncbi.nlm.nih.gov/19507043" }, { "database": "PubMed", "id": "20925105", "url": "https://pubmed.ncbi.nlm.nih.gov/20925105" }, { "database": "PubMed", "id": "22684024", "url": "https://pubmed.ncbi.nlm.nih.gov/22684024" }, { "database": "PubMed", "id": "26391394", "url": "https://pubmed.ncbi.nlm.nih.gov/26391394" }, { "database": "PubMed", "id": "26406887", "url": "https://pubmed.ncbi.nlm.nih.gov/26406887" }, { "database": "PubMed", "id": "30467191", "url": "https://pubmed.ncbi.nlm.nih.gov/30467191" }, { "database": "PubMed", "id": "34208541", "url": "https://pubmed.ncbi.nlm.nih.gov/34208541" }, { "database": "PubMed", "id": "35482324", "url": "https://pubmed.ncbi.nlm.nih.gov/35482324" } ], "site_lbl": "Ser24", "uniprot_canonical_ac": "P23693-1" } ], "record_id": "pubmed.35482324", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Regulation of the rat cardiac troponin I gene by the transcription factor GATA-4.", "journal": "Biochem. J.", "date": "1997", "authors": "Murphy AM, Thompson WR, Peng LF, Jones L 2nd", "reference": { "type": "PubMed", "id": "9065755", "url": "https://pubmed.ncbi.nlm.nih.gov/9065755" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P23693-1", "protein_name": "Troponin I, cardiac muscle", "gene_name": "Tnni3", "tax_name": "Rat" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "P23693", "url": "https://www.uniprot.org/uniprotkb/P23693" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "record_id": "pubmed.9065755", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "cMaf inducing protein inhibits cofilin1 activity and alters podocyte cytoskeleton organization.", "journal": "Molecular medicine reports", "date": "2017", "authors": "Yu L, Ye J, Liu Q, Feng J, Gu X, Sun Q, Lu G", "reference": { "type": "PubMed", "id": "28791377", "url": "https://pubmed.ncbi.nlm.nih.gov/28791377" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P45592-1", "protein_name": "Cofilin-1", "gene_name": "Cfl1", "tax_name": "Rat" }, { "uniprot_canonical_ac": "A0A0G2JYB9-1", "protein_name": "C-Maf-inducing protein", "gene_name": "Cmip", "tax_name": "Rat" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "P45592", "url": "https://www.uniprot.org/uniprotkb/P45592" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "record_id": "pubmed.28791377", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Novel derivative of Paeonol, Paeononlsilatie sodium, alleviates behavioral damage and hippocampal dendritic injury in Alzheimer's disease concurrent with cofilin1/phosphorylated-cofilin1 and RAC1/CDC42 alterations in rats.", "journal": "PloS one", "date": "2017", "authors": "Han F, Zhuang TT, Chen JJ, Zhu XL, Cai YF, Lu YP", "reference": { "type": "PubMed", "id": "28934273", "url": "https://pubmed.ncbi.nlm.nih.gov/28934273" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P45592-1", "protein_name": "Cofilin-1", "gene_name": "Cfl1", "tax_name": "Rat" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "P45592", "url": "https://www.uniprot.org/uniprotkb/P45592" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "phosphorylation": [ { "start_pos": 3, "end_pos": 3, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P45592", "url": "https://www.uniprot.org/uniprotkb/P45592" }, { "database": "PubMed", "id": "9877327", "url": "https://pubmed.ncbi.nlm.nih.gov/9877327" }, { "database": "iPTMnet", "id": "P45592", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P45592" }, { "database": "PubMed", "id": "28934273", "url": "https://pubmed.ncbi.nlm.nih.gov/28934273" }, { "database": "PubMed", "id": "30949027", "url": "https://pubmed.ncbi.nlm.nih.gov/30949027" } ], "site_lbl": "Ser3", "uniprot_canonical_ac": "P45592-1" } ], "record_id": "pubmed.28934273", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Brain ischemic insult induces cofilin rod formation leading to synaptic dysfunction in neurons.", "journal": "Journal of cerebral blood flow and metabolism : official journal of the International Society of Cerebral Blood Flow and Metabolism", "date": "2019", "authors": "Shu L, Chen B, Chen B, Xu H, Wang G, Huang Y, Zhao Y, Gong H, Jiang M, Chen L, Liu X, Wang Y", "reference": { "type": "PubMed", "id": "29932353", "url": "https://pubmed.ncbi.nlm.nih.gov/29932353" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P45592-1", "protein_name": "Cofilin-1", "gene_name": "Cfl1", "tax_name": "Rat" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "P45592", "url": "https://www.uniprot.org/uniprotkb/P45592" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "record_id": "pubmed.29932353", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "BDNF Induced Translation of Limk1 in Developing Neurons Regulates Dendrite Growth by Fine-Tuning Cofilin1 Activity.", "journal": "Frontiers in molecular neuroscience", "date": "2019", "authors": "Ravindran S, Nalavadi VC, Muddashetty RS", "reference": { "type": "PubMed", "id": "30949027", "url": "https://pubmed.ncbi.nlm.nih.gov/30949027" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P45592-1", "protein_name": "Cofilin-1", "gene_name": "Cfl1", "tax_name": "Rat" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "P45592", "url": "https://www.uniprot.org/uniprotkb/P45592" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "phosphorylation": [ { "start_pos": 3, "end_pos": 3, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P45592", "url": "https://www.uniprot.org/uniprotkb/P45592" }, { "database": "PubMed", "id": "9877327", "url": "https://pubmed.ncbi.nlm.nih.gov/9877327" }, { "database": "iPTMnet", "id": "P45592", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P45592" }, { "database": "PubMed", "id": "28934273", "url": "https://pubmed.ncbi.nlm.nih.gov/28934273" }, { "database": "PubMed", "id": "30949027", "url": "https://pubmed.ncbi.nlm.nih.gov/30949027" } ], "site_lbl": "Ser3", "uniprot_canonical_ac": "P45592-1" } ], "record_id": "pubmed.30949027", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "ADF/Cofilin-Mediated Actin Turnover Promotes Axon Regeneration in the Adult CNS.", "journal": "Neuron", "date": "2019", "authors": "Tedeschi A, Dupraz S, Curcio M, Laskowski CJ, Schaffran B, Flynn KC, Santos TE, Stern S, Hilton BJ, Larson MJE, Gurniak CB, Witke W, Bradke F", "reference": { "type": "PubMed", "id": "31400829", "url": "https://pubmed.ncbi.nlm.nih.gov/31400829" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P45592-1", "protein_name": "Cofilin-1", "gene_name": "Cfl1", "tax_name": "Rat" }, { "uniprot_canonical_ac": "M0RC65-1", "protein_name": "Cofilin 2", "gene_name": "Cfl2", "tax_name": "Rat" }, { "uniprot_canonical_ac": "Q7M0E3-1", "protein_name": "Destrin", "gene_name": "Dstn", "tax_name": "Rat" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "P45592", "url": "https://www.uniprot.org/uniprotkb/P45592" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "record_id": "pubmed.31400829", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Global site-specific neddylation profiling reveals that NEDDylated cofilin regulates actin dynamics.", "journal": "Nature structural & molecular biology", "date": "2020", "authors": "Vogl AM, Phu L, Becerra R, Giusti SA, Verschueren E, Hinkle TB, Bordenave MD, Adrian M, Heidersbach A, Yankilevich P, Stefani FD, Wurst W, Hoogenraad CC, Kirkpatrick DS, Refojo D, Sheng M", "reference": { "type": "PubMed", "id": "32015554", "url": "https://pubmed.ncbi.nlm.nih.gov/32015554" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P45592-1", "protein_name": "Cofilin-1", "gene_name": "Cfl1", "tax_name": "Rat" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "P45592", "url": "https://www.uniprot.org/uniprotkb/P45592" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "record_id": "pubmed.32015554", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Complete amino acid sequences and phosphorylation sites, determined by Edman degradation and mass spectrometry, of rat parotid destrin- and cofilin-like proteins.", "journal": "Archives of oral biology", "date": "1998", "authors": "Kanamori T, Suzuki M, Titani K", "reference": { "type": "PubMed", "id": "9877327", "url": "https://pubmed.ncbi.nlm.nih.gov/9877327" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P45592-1", "protein_name": "Cofilin-1", "gene_name": "Cfl1", "tax_name": "Rat" }, { "uniprot_canonical_ac": "Q7M0E3-1", "protein_name": "Destrin", "gene_name": "Dstn", "tax_name": "Rat" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "P45592", "url": "https://www.uniprot.org/uniprotkb/P45592" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "phosphorylation": [ { "start_pos": 3, "end_pos": 3, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P45592", "url": "https://www.uniprot.org/uniprotkb/P45592" }, { "database": "PubMed", "id": "9877327", "url": "https://pubmed.ncbi.nlm.nih.gov/9877327" }, { "database": "iPTMnet", "id": "P45592", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P45592" }, { "database": "PubMed", "id": "28934273", "url": "https://pubmed.ncbi.nlm.nih.gov/28934273" }, { "database": "PubMed", "id": "30949027", "url": "https://pubmed.ncbi.nlm.nih.gov/30949027" } ], "site_lbl": "Ser3", "uniprot_canonical_ac": "P45592-1" }, { "start_pos": 3, "end_pos": 3, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "Q7M0E3", "url": "https://www.uniprot.org/uniprotkb/Q7M0E3" }, { "database": "PubMed", "id": "22673903", "url": "https://pubmed.ncbi.nlm.nih.gov/22673903" }, { "database": "PubMed", "id": "9877327", "url": "https://pubmed.ncbi.nlm.nih.gov/9877327" }, { "database": "iPTMnet", "id": "Q7M0E3", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q7M0E3" }, { "database": "PubMed", "id": "18171679", "url": "https://pubmed.ncbi.nlm.nih.gov/18171679" } ], "site_lbl": "Ser3", "uniprot_canonical_ac": "Q7M0E3-1" } ], "record_id": "pubmed.9877327", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Expression, characterization, and localization of Rab26, a low molecular weight GTP-binding protein, in the rat parotid gland.", "journal": "Histochemistry and cell biology", "date": "2000-04", "authors": "Yoshie S, Imai A, Nashida T, Shimomura H", "reference": { "type": "PubMed", "id": "10857477", "url": "https://pubmed.ncbi.nlm.nih.gov/10857477" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P51156-1", "protein_name": "Ras-related protein Rab-26", "gene_name": "Rab26", "tax_name": "Rat" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "P51156", "url": "https://www.uniprot.org/uniprotkb/P51156" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "record_id": "pubmed.10857477", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Relation of Rab26 to the amylase release from rat parotid acinar cells.", "journal": "Archives of oral biology", "date": "2006-02", "authors": "Nashida Tomoko, Imai Akane, Shimomura Hiromi", "reference": { "type": "PubMed", "id": "16076461", "url": "https://pubmed.ncbi.nlm.nih.gov/16076461" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P51156-1", "protein_name": "Ras-related protein Rab-26", "gene_name": "Rab26", "tax_name": "Rat" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "P51156", "url": "https://www.uniprot.org/uniprotkb/P51156" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "record_id": "pubmed.16076461", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The GTPase Rab26 links synaptic vesicles to the autophagy pathway.", "journal": "eLife", "date": "2015", "authors": "Binotti B, Pavlos NJ, Riedel D, Wenzel D, Vorbruggen G, Schalk AM, Kuhnel K, Boyken J, Erck C, Martens H, Chua JJ, Jahn R", "reference": { "type": "PubMed", "id": "25643395", "url": "https://pubmed.ncbi.nlm.nih.gov/25643395" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P51156-1", "protein_name": "Ras-related protein Rab-26", "gene_name": "Rab26", "tax_name": "Rat" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "P51156", "url": "https://www.uniprot.org/uniprotkb/P51156" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "record_id": "pubmed.25643395", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Molecular cloning of a new member of the Rab protein family, Rab 26, from rat pancreas.", "journal": "Biochem. Biophys. Res. Commun.", "date": "1995", "authors": "Wagner AC, Strowski MZ, Goke B, Williams JA", "reference": { "type": "PubMed", "id": "7864900", "url": "https://pubmed.ncbi.nlm.nih.gov/7864900" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P51156-1", "protein_name": "Ras-related protein Rab-26", "gene_name": "Rab26", "tax_name": "Rat" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "P51156", "url": "https://www.uniprot.org/uniprotkb/P51156" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "record_id": "pubmed.7864900", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Amisyn, a novel syntaxin-binding protein that may regulate SNARE complex assembly.", "journal": "J. Biol. Chem.", "date": "2002", "authors": "Scales SJ, Hesser BA, Masuda ES, Scheller RH", "reference": { "type": "PubMed", "id": "12145319", "url": "https://pubmed.ncbi.nlm.nih.gov/12145319" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q08850-1", "protein_name": "Syntaxin-4", "gene_name": "Stx4", "tax_name": "Rat" }, { "uniprot_canonical_ac": "P62494-1", "protein_name": "Ras-related protein Rab-11A", "gene_name": "Rab11a", "tax_name": "Rat" }, { "uniprot_canonical_ac": "P60881-1", "protein_name": "Synaptosomal-associated protein 25", "gene_name": "Snap25", "tax_name": "Rat" }, { "uniprot_canonical_ac": "P32851-1", "protein_name": "Syntaxin-1A", "gene_name": "Stx1a", "tax_name": "Rat" }, { "uniprot_canonical_ac": "Q8NFX7-1", "protein_name": "Syntaxin-binding protein 6", "gene_name": "STXBP6", "tax_name": "Human" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "Q08850", "url": "https://www.uniprot.org/uniprotkb/Q08850" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "record_id": "pubmed.12145319", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 5 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Murine CENPF interacts with syntaxin 4 in the regulation of vesicular transport.", "journal": "J. Cell Sci.", "date": "2008", "authors": "Pooley Ryan D, Moynihan Katherine L, Soukoulis Victor, Reddy Samyukta, Francis Richard, Lo Cecilia, Ma Li-Jun, Bader David M", "reference": { "type": "PubMed", "id": "18827011", "url": "https://pubmed.ncbi.nlm.nih.gov/18827011" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q08850-1", "protein_name": "Syntaxin-4", "gene_name": "Stx4", "tax_name": "Rat" }, { "uniprot_canonical_ac": "P70452-1", "protein_name": "Syntaxin-4", "gene_name": "Stx4a; Stx4", "tax_name": "Mouse" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "Q08850", "url": "https://www.uniprot.org/uniprotkb/Q08850" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "record_id": "pubmed.18827011", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "CRACM3 regulates the stability of non-excitable exocytotic vesicle fusion pores in a Ca(2+)-independent manner via molecular interaction with syntaxin4.", "journal": "Scientific reports", "date": "2016", "authors": "Liu S, Sahid MN, Takemasa E, Kiyoi T, Kuno M, Oshima Y, Maeyama K", "reference": { "type": "PubMed", "id": "27301714", "url": "https://pubmed.ncbi.nlm.nih.gov/27301714" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q08850-1", "protein_name": "Syntaxin-4", "gene_name": "Stx4", "tax_name": "Rat" }, { "uniprot_canonical_ac": "Q6AXR8-1", "protein_name": "Protein orai-3", "gene_name": "Orai3", "tax_name": "Rat" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "Q08850", "url": "https://www.uniprot.org/uniprotkb/Q08850" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "record_id": "pubmed.27301714", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Identification of the SNARE complex mediating the exocytosis of NMDA receptors.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2016", "authors": "Gu Y, Huganir RL", "reference": { "type": "PubMed", "id": "27791016", "url": "https://pubmed.ncbi.nlm.nih.gov/27791016" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q08850-1", "protein_name": "Syntaxin-4", "gene_name": "Stx4", "tax_name": "Rat" }, { "uniprot_canonical_ac": "Q63666-1", "protein_name": "Vesicle-associated membrane protein 1", "gene_name": "Vamp1", "tax_name": "Rat" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "Q08850", "url": "https://www.uniprot.org/uniprotkb/Q08850" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "record_id": "pubmed.27791016", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Syntaxin-4 and SNAP23 act as exocytic SNAREs to release NGF from cultured Schwann cells.", "journal": "Neuroscience letters", "date": "2017", "authors": "Lin M, Jiang M, Ding F, Cao Z", "reference": { "type": "PubMed", "id": "28119011", "url": "https://pubmed.ncbi.nlm.nih.gov/28119011" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q08850-1", "protein_name": "Syntaxin-4", "gene_name": "Stx4", "tax_name": "Rat" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "Q08850", "url": "https://www.uniprot.org/uniprotkb/Q08850" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "record_id": "pubmed.28119011", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "PLRP2 selectively localizes synaptic membrane proteins via acyl-chain remodeling of phospholipids.", "journal": "Journal of lipid research", "date": "2020", "authors": "Kuge H, Miyamoto I, Yagyu KI, Honke K", "reference": { "type": "PubMed", "id": "32963038", "url": "https://pubmed.ncbi.nlm.nih.gov/32963038" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q08850-1", "protein_name": "Syntaxin-4", "gene_name": "Stx4", "tax_name": "Rat" }, { "uniprot_canonical_ac": "P23977-1", "protein_name": "Sodium-dependent dopamine transporter", "gene_name": "Slc6a3", "tax_name": "Rat" }, { "uniprot_canonical_ac": "P54318-1", "protein_name": "Pancreatic lipase-related protein 2", "gene_name": "Pnliprp2", "tax_name": "Rat" }, { "uniprot_canonical_ac": "P17892-1", "protein_name": "Pancreatic lipase-related protein 2", "gene_name": "Pnliprp2", "tax_name": "Mouse" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "Q08850", "url": "https://www.uniprot.org/uniprotkb/Q08850" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "mutagenesis": [ { "start_pos": 290, "end_pos": 290, "sequence_org": "I", "sequence_mut": "F", "comment": "Mislocalization in neurons from neurite tips to perinuclear region.", "evidence": [ { "database": "UniProtKB", "id": "Q08850", "url": "https://www.uniprot.org/uniprotkb/Q08850" }, { "database": "PubMed", "id": "32963038", "url": "https://pubmed.ncbi.nlm.nih.gov/32963038" } ], "uniprot_canonical_ac": "Q08850-1" }, { "start_pos": 170, "end_pos": 170, "sequence_org": "S", "sequence_mut": "G", "comment": "Abolishes rescue of lipase-deficient activity in Pnliprp2 knockout neurons.", "evidence": [ { "database": "UniProtKB", "id": "P54318", "url": "https://www.uniprot.org/uniprotkb/P54318" }, { "database": "PubMed", "id": "32963038", "url": "https://pubmed.ncbi.nlm.nih.gov/32963038" } ], "uniprot_canonical_ac": "P54318-1" }, { "start_pos": 281, "end_pos": 281, "sequence_org": "H", "sequence_mut": "L", "comment": "Abolishes rescue of lipase-deficient activity in Pnliprp2 knockout neurons.", "evidence": [ { "database": "UniProtKB", "id": "P54318", "url": "https://www.uniprot.org/uniprotkb/P54318" }, { "database": "PubMed", "id": "32963038", "url": "https://pubmed.ncbi.nlm.nih.gov/32963038" } ], "uniprot_canonical_ac": "P54318-1" } ], "record_id": "pubmed.32963038", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 4 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The syntaxin family of vesicular transport receptors.", "journal": "Cell", "date": "1993", "authors": "Bennett MK, Garcia-Arraras JE, Elferink LA, Peterson K, Fleming AM, Hazuka CD, Scheller RH", "reference": { "type": "PubMed", "id": "7690687", "url": "https://pubmed.ncbi.nlm.nih.gov/7690687" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q08850-1", "protein_name": "Syntaxin-4", "gene_name": "Stx4", "tax_name": "Rat" }, { "uniprot_canonical_ac": "P50279-1", "protein_name": "Syntaxin-2", "gene_name": "Stx2", "tax_name": "Rat" }, { "uniprot_canonical_ac": "Q08849-1", "protein_name": "Syntaxin-3", "gene_name": "Stx3", "tax_name": "Rat" }, { "uniprot_canonical_ac": "P61265-1", "protein_name": "Syntaxin-1B", "gene_name": "Stx1b", "tax_name": "Rat" }, { "uniprot_canonical_ac": "Q08851-1", "protein_name": "Syntaxin-5", "gene_name": "Stx5", "tax_name": "Rat" }, { "uniprot_canonical_ac": "P32851-1", "protein_name": "Syntaxin-1A", "gene_name": "Stx1a", "tax_name": "Rat" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "Q08850", "url": "https://www.uniprot.org/uniprotkb/Q08850" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "record_id": "pubmed.7690687", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 6 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "RAE-1, a novel PHR binding protein, is required for axon termination and synapse formation in Caenorhabditis elegans.", "journal": "J. Neurosci.", "date": "2012", "authors": "Grill B, Chen L, Tulgren ED, Baker ST, Bienvenut W, Anderson M, Quadroni M, Jin Y, Garner CC", "reference": { "type": "PubMed", "id": "22357847", "url": "https://pubmed.ncbi.nlm.nih.gov/22357847" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q3SWS8-1", "protein_name": "mRNA export factor", "gene_name": "Rae1", "tax_name": "Rat" }, { "uniprot_canonical_ac": "O75592-1", "protein_name": "E3 ubiquitin-protein ligase MYCBP2", "gene_name": "MYCBP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P78406-1", "protein_name": "mRNA export factor RAE1", "gene_name": "RAE1", "tax_name": "Human" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "Q3SWS8", "url": "https://www.uniprot.org/uniprotkb/Q3SWS8" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "record_id": "pubmed.22357847", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Accumulation of beta (m), a structural member of X,K-ATPase beta-subunit family, in nuclear envelopes of perinatal myocytes.", "journal": "Am. J. Physiol.", "date": "2004", "authors": "Zhao H, Pestov NB, Korneenko TV, Shakhparonov MI, Modyanov NN", "reference": { "type": "PubMed", "id": "14656723", "url": "https://pubmed.ncbi.nlm.nih.gov/14656723" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q5PQX1-1", "protein_name": "Torsin-1A-interacting protein 1", "gene_name": "Tor1aip1", "tax_name": "Rat" }, { "uniprot_canonical_ac": "Q9R193-1", "protein_name": "Protein ATP1B4", "gene_name": "Atp1b4", "tax_name": "Rat" }, { "uniprot_canonical_ac": "Q99ME6-1", "protein_name": "Protein ATP1B4", "gene_name": "Atp1b4", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "Q9UN42-1", "protein_name": "Protein ATP1B4", "gene_name": "ATP1B4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BDK6-1", "protein_name": "Protein ATP1B4", "gene_name": "ATP1B4", "tax_name": "Pig" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "Q5PQX1", "url": "https://www.uniprot.org/uniprotkb/Q5PQX1" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "record_id": "pubmed.14656723", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 5 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The nuclear envelope protein, LAP1B, is a novel protein phosphatase 1 substrate.", "journal": "PloS one", "date": "2013", "authors": "Santos M, Rebelo S, Van Kleeff PJ, Kim CE, Dauer WT, Fardilha M, da Cruz E Silva OA, da Cruz E Silva EF", "reference": { "type": "PubMed", "id": "24116158", "url": "https://pubmed.ncbi.nlm.nih.gov/24116158" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q5PQX1-1", "protein_name": "Torsin-1A-interacting protein 1", "gene_name": "Tor1aip1", "tax_name": "Rat" }, { "uniprot_canonical_ac": "P62138-1", "protein_name": "Serine/threonine-protein phosphatase PP1-alpha catalytic subunit", "gene_name": "Ppp1ca", "tax_name": "Rat" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "Q5PQX1", "url": "https://www.uniprot.org/uniprotkb/Q5PQX1" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "record_id": "pubmed.24116158", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "cDNA cloning and characterization of lamina-associated polypeptide 1C (LAP1C), an integral protein of the inner nuclear membrane.", "journal": "J. Biol. Chem.", "date": "1995", "authors": "Martin L, Crimaudo C, Gerace L", "reference": { "type": "PubMed", "id": "7721789", "url": "https://pubmed.ncbi.nlm.nih.gov/7721789" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q5PQX1-1", "protein_name": "Torsin-1A-interacting protein 1", "gene_name": "Tor1aip1", "tax_name": "Rat" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "Q5PQX1", "url": "https://www.uniprot.org/uniprotkb/Q5PQX1" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "record_id": "pubmed.7721789", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Cloning and expression of MP13 gene from rat hippocampus, a new factor related to guanosine triphosphate regulation.", "journal": "Neurosci. Lett.", "date": "2000", "authors": "Feng Z, Hong J, Qi Q, Han Y, Wilson B, Iadarola M, Tiao N, Bing G", "reference": { "type": "PubMed", "id": "11108998", "url": "https://pubmed.ncbi.nlm.nih.gov/11108998" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q62835-1", "protein_name": "Rab GTPase-binding effector protein 2", "gene_name": "Rabep2", "tax_name": "Rat" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "Q62835", "url": "https://www.uniprot.org/uniprotkb/Q62835" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "record_id": "pubmed.11108998", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Nuclear translocation of STAT5 and increased expression of Fos related antigens (FRAs) in hypothalamic dopaminergic neurons after prolactin administration.", "journal": "Brain research", "date": "2001", "authors": "Lerant A, Kanyicska B, Freeman ME", "reference": { "type": "PubMed", "id": "11406124", "url": "https://pubmed.ncbi.nlm.nih.gov/11406124" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q62835-1", "protein_name": "Rab GTPase-binding effector protein 2", "gene_name": "Rabep2", "tax_name": "Rat" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "Q62835", "url": "https://www.uniprot.org/uniprotkb/Q62835" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "record_id": "pubmed.11406124", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Decreased expression of fos-related antigens (FRAs) in the hypothalamic dopaminergic neurons after immunoneutralization of endogenous prolactin.", "journal": "Endocrine", "date": "2001", "authors": "Lerant AA, DeMaria JE, Freeman ME", "reference": { "type": "PubMed", "id": "11954661", "url": "https://pubmed.ncbi.nlm.nih.gov/11954661" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q62835-1", "protein_name": "Rab GTPase-binding effector protein 2", "gene_name": "Rabep2", "tax_name": "Rat" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "Q62835", "url": "https://www.uniprot.org/uniprotkb/Q62835" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "record_id": "pubmed.11954661", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Fos-related antigen 2 controls protein kinase A-induced CCAAT/enhancer-binding protein beta expression in osteoblasts.", "journal": "The Journal of biological chemistry", "date": "2004", "authors": "Chang W, Rewari A, Centrella M, McCarthy TL", "reference": { "type": "PubMed", "id": "15299028", "url": "https://pubmed.ncbi.nlm.nih.gov/15299028" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q62835-1", "protein_name": "Rab GTPase-binding effector protein 2", "gene_name": "Rabep2", "tax_name": "Rat" }, { "uniprot_canonical_ac": "P51145-1", "protein_name": "Fos-related antigen 2", "gene_name": "Fosl2", "tax_name": "Rat" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "Q62835", "url": "https://www.uniprot.org/uniprotkb/Q62835" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "record_id": "pubmed.15299028", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "p24A, a type I transmembrane protein, controls ARF1-dependent resensitization of protease-activated receptor-2 by influence on receptor trafficking.", "journal": "J. Biol. Chem.", "date": "2007", "authors": "Luo W, Wang Y, Reiser G", "reference": { "type": "PubMed", "id": "17693410", "url": "https://pubmed.ncbi.nlm.nih.gov/17693410" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q63524-1", "protein_name": "Transmembrane emp24 domain-containing protein 2", "gene_name": "Tmed2", "tax_name": "Rat" }, { "uniprot_canonical_ac": "Q63645-1", "protein_name": "Proteinase-activated receptor 2", "gene_name": "F2rl1", "tax_name": "Rat" }, { "uniprot_canonical_ac": "P55085-1", "protein_name": "Proteinase-activated receptor 2", "gene_name": "F2RL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15363-1", "protein_name": "Transmembrane emp24 domain-containing protein 2", "gene_name": "TMED2", "tax_name": "Human" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "Q63524", "url": "https://www.uniprot.org/uniprotkb/Q63524" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "record_id": "pubmed.17693410", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 4 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The characterisation of novel secreted Ly-6 proteins from rat urine by the combined use of two-dimensional gel electrophoresis, microbore high performance liquid chromatography and expressed sequence tag data.", "journal": "Proteomics", "date": "2002", "authors": "Southan C, Cutler P, Birrell H, Connell J, Fantom KG, Sims M, Shaikh N, Schneider K", "reference": { "type": "PubMed", "id": "11840564", "url": "https://pubmed.ncbi.nlm.nih.gov/11840564" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9QXN2-1", "protein_name": "Prostate and testis expressed protein 14", "gene_name": "Pate14", "tax_name": "Rat" }, { "uniprot_canonical_ac": "P81827-1", "protein_name": "Urinary protein 1", "gene_name": "Rup2l1", "tax_name": "Rat" }, { "uniprot_canonical_ac": "P83121-1", "protein_name": "Urinary protein 3", "gene_name": "", "tax_name": "Rat" }, { "uniprot_canonical_ac": "P83106-1", "protein_name": "Protein PIP-1", "gene_name": "", "tax_name": "Pig" }, { "uniprot_canonical_ac": "P83107-1", "protein_name": "Secreted protein of Ly-6 domain 1", "gene_name": "SOLD1; SSLP1", "tax_name": "Bovine" }, { "uniprot_canonical_ac": "P81828-1", "protein_name": "Urinary protein 2", "gene_name": "", "tax_name": "Rat" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "Q9QXN2", "url": "https://www.uniprot.org/uniprotkb/Q9QXN2" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "record_id": "pubmed.11840564", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 6 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "SNIP, a novel SNAP-25-interacting protein implicated in regulated exocytosis.", "journal": "The Journal of biological chemistry", "date": "2000", "authors": "Chin LS, Nugent RD, Raynor MC, Vavalle JP, Li L", "reference": { "type": "PubMed", "id": "10625663", "url": "https://pubmed.ncbi.nlm.nih.gov/10625663" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9QXY2-1", "protein_name": "SRC kinase signaling inhibitor 1", "gene_name": "Srcin1", "tax_name": "Rat" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "Q9QXY2", "url": "https://www.uniprot.org/uniprotkb/Q9QXY2" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "record_id": "pubmed.10625663", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Characterization of a multidomain adaptor protein, p140Cap, as part of a pre-synaptic complex.", "journal": "J. Neurochem.", "date": "2008", "authors": "Ito Hidenori, Atsuzawa Kimie, Sudo Kaori, Di Stefano Paola, Iwamoto Ikuko, Morishita Rika, Takei Shiro, Semba Reiji, Defilippi Paola, Asano Tomiko, Usuda Nobuteru, Nagata Koh-Ichi", "reference": { "type": "PubMed", "id": "18662323", "url": "https://pubmed.ncbi.nlm.nih.gov/18662323" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9QXY2-1", "protein_name": "SRC kinase signaling inhibitor 1", "gene_name": "Srcin1", "tax_name": "Rat" }, { "uniprot_canonical_ac": "Q9C0H9-5", "protein_name": "SRC kinase signaling inhibitor 1", "gene_name": "SRCIN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60504-1", "protein_name": "Vinexin", "gene_name": "SORBS3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P08247-1", "protein_name": "Synaptophysin", "gene_name": "SYP", "tax_name": "Human" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "Q9QXY2", "url": "https://www.uniprot.org/uniprotkb/Q9QXY2" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "record_id": "pubmed.18662323", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 4 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "p140Cap regulates memory and synaptic plasticity through Src-mediated and citron-N-mediated actin reorganization.", "journal": "The Journal of neuroscience : the official journal of the Society for Neuroscience", "date": "2014", "authors": "Repetto D, Camera P, Melani R, Morello N, Russo I, Calcagno E, Tomasoni R, Bianchi F, Berto G, Giustetto M, Berardi N, Pizzorusso T, Matteoli M, Di Stefano P, Missler M, Turco E, Di Cunto F, Defilippi P", "reference": { "type": "PubMed", "id": "24453341", "url": "https://pubmed.ncbi.nlm.nih.gov/24453341" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9QXY2-1", "protein_name": "SRC kinase signaling inhibitor 1", "gene_name": "Srcin1", "tax_name": "Rat" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "Q9QXY2", "url": "https://www.uniprot.org/uniprotkb/Q9QXY2" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "record_id": "pubmed.24453341", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "A Critical Role of Presynaptic Cadherin/Catenin/p140Cap Complexes in Stabilizing Spines and Functional Synapses in the Neocortex.", "journal": "Neuron", "date": "2017", "authors": "Li MY, Miao WY, Wu QZ, He SJ, Yan G, Yang Y, Liu JJ, Taketo MM, Yu X", "reference": { "type": "PubMed", "id": "28641114", "url": "https://pubmed.ncbi.nlm.nih.gov/28641114" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9QXY2-1", "protein_name": "SRC kinase signaling inhibitor 1", "gene_name": "Srcin1", "tax_name": "Rat" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "Q9QXY2", "url": "https://www.uniprot.org/uniprotkb/Q9QXY2" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "record_id": "pubmed.28641114", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "MiR-150 promotes angiogensis and proliferation of endothelial progenitor cells in deep venous thrombosis by targeting SRCIN1.", "journal": "Microvascular research", "date": "2019", "authors": "Wang W, Zhu X, Du X, Xu A, Yuan X, Zhan Y, Liu M, Wang S", "reference": { "type": "PubMed", "id": "30315850", "url": "https://pubmed.ncbi.nlm.nih.gov/30315850" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9QXY2-1", "protein_name": "SRC kinase signaling inhibitor 1", "gene_name": "Srcin1", "tax_name": "Rat" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "Q9QXY2", "url": "https://www.uniprot.org/uniprotkb/Q9QXY2" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "record_id": "pubmed.30315850", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Lamin A gene expression is specifically suppressed in v-src-transformed cells.", "journal": "FEBS Lett.", "date": "1992", "authors": "Ozaki T, Sakiyama S", "reference": { "type": "PubMed", "id": "1426247", "url": "https://pubmed.ncbi.nlm.nih.gov/1426247" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P48679-1", "protein_name": "Prelamin-A/C", "gene_name": "Lmna", "tax_name": "Rat" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "P48679", "url": "https://www.uniprot.org/uniprotkb/P48679" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "record_id": "pubmed.1426247", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Immunolocalization of detergent-susceptible nucleoplasmic lamin A/C foci by a novel monoclonal antibody.", "journal": "Journal of cellular biochemistry", "date": "2004-03-01", "authors": "Muralikrishna Bh, Thanumalayan S, Jagatheesan G, Rangaraj Nandini, Karande Anjali A, Parnaik Veena K", "reference": { "type": "PubMed", "id": "14991764", "url": "https://pubmed.ncbi.nlm.nih.gov/14991764" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P48679-1", "protein_name": "Prelamin-A/C", "gene_name": "Lmna", "tax_name": "Rat" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "P48679", "url": "https://www.uniprot.org/uniprotkb/P48679" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "record_id": "pubmed.14991764", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Green Alga Enteromorpha prolifera Oligosaccharide Exerts Antiaging Effects through Targeted Modulation of Protein O-GlcNAcylation.", "journal": "Journal of agricultural and food chemistry", "date": "2026-01-19", "authors": "Shan Shuo, Chen Weichao, Wu Weihao, Zhang Wenbo, Liu Jingyi, Liao Wei, Wen Yuxi, Zhao Chao", "reference": { "type": "PubMed", "id": "41549750", "url": "https://pubmed.ncbi.nlm.nih.gov/41549750" }, "referenced_glycans": [ { "glytoucan_ac": "G49108TO" } ], "referenced_proteins": [ { "uniprot_canonical_ac": "P48679-1", "protein_name": "Prelamin-A/C", "gene_name": "Lmna", "tax_name": "Rat" }, { "uniprot_canonical_ac": "Q6XLI7-1", "protein_name": "RNA-binding protein 12", "gene_name": "Rbm12", "tax_name": "Rat" }, { "uniprot_canonical_ac": "P63039-1", "protein_name": "60 kDa heat shock protein, mitochondrial", "gene_name": "Hspd1", "tax_name": "Rat" }, { "uniprot_canonical_ac": "D3ZN95-1", "protein_name": "Host cell factor 1", "gene_name": "Hcfc1", "tax_name": "Rat" }, { "uniprot_canonical_ac": "P62804-1", "protein_name": "Histone H4", "gene_name": "H4c16; H4c2; Hist1h4m", "tax_name": "Rat" }, { "uniprot_canonical_ac": "P38983-1", "protein_name": "Small ribosomal subunit protein uS2", "gene_name": "Rpsa", "tax_name": "Rat" }, { "uniprot_canonical_ac": "O88943-1", "protein_name": "Potassium voltage-gated channel subfamily KQT member 2", "gene_name": "Eef1a1l1; Eef1a2; Kcnq2", "tax_name": "Rat" }, { "uniprot_canonical_ac": "P05197-1", "protein_name": "Elongation factor 2", "gene_name": "Eef2", "tax_name": "Rat" }, { "uniprot_canonical_ac": "Q5XI07-1", "protein_name": "Lipoma-preferred partner homolog", "gene_name": "Lpp", "tax_name": "Rat" }, { "uniprot_canonical_ac": "P63018-1", "protein_name": "Heat shock cognate 71 kDa protein", "gene_name": "Hspa8", "tax_name": "Rat" }, { "uniprot_canonical_ac": "P06685-1", "protein_name": "Sodium/potassium-transporting ATPase subunit alpha-1", "gene_name": "Atp1a1", "tax_name": "Rat" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "P48679", "url": "https://www.uniprot.org/uniprotkb/P48679" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "glycosylation": [ { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "evidence": [ { "id": "41549750", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/41549750" }, { "id": "P48679", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P48679" }, { "id": "34502162", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34502162" } ], "filter_code": "000000000000000000000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "P48679-1" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "evidence": [ { "id": "18683930", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/18683930" }, { "id": "Q6XLI7", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=Q6XLI7" }, { "id": "41549750", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/41549750" } ], "filter_code": "000000000000000000000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "Q6XLI7-1" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 398, "start_aa": "Ser", "end_pos": 398, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser398", "evidence": [ { "id": "18683930", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/18683930" }, { "id": "P63039", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P63039" }, { "id": "16579988", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/16579988" }, { "id": "34502162", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34502162" }, { "id": "27213235", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/27213235" }, { "id": "41549750", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/41549750" }, { "id": "18047804", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/18047804" }, { "id": "26446791", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/26446791" }, { "id": "P63039", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P63039" } ], "filter_code": "000000000000000100000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "P63039-1" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 67, "start_aa": "Ser", "end_pos": 67, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser67", "evidence": [ { "id": "18683930", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/18683930" }, { "id": "P63039", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P63039" }, { "id": "16579988", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/16579988" }, { "id": "34502162", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34502162" }, { "id": "27213235", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/27213235" }, { "id": "41549750", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/41549750" }, { "id": "18047804", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/18047804" }, { "id": "26446791", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/26446791" }, { "id": "P63039", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P63039" } ], "filter_code": "000000000000000100000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01010", "uniprot_canonical_ac": "P63039-1" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "T", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 1148, "start_aa": "Thr", "end_pos": 1148, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr1148", "evidence": [ { "id": "15340146", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/15340146" }, { "id": "D3ZN95", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=D3ZN95" }, { "id": "19692427", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19692427" }, { "id": "18683930", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/18683930" }, { "id": "38843836", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/38843836" }, { "id": "41549750", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/41549750" }, { "id": "17496889", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/17496889" }, { "id": "19322778", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19322778" }, { "id": "D3ZN95", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/D3ZN95" } ], "filter_code": "000000000000000010000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "D3ZN95-1" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "evidence": [ { "id": "38843836", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/38843836" }, { "id": "P62804", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P62804" }, { "id": "41549750", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/41549750" }, { "id": "34502162", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34502162" } ], "filter_code": "000000000000000000000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "P62804-1" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "evidence": [ { "id": "18047804", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/18047804" }, { "id": "P38983", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P38983" }, { "id": "41549750", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/41549750" }, { "id": "34502162", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34502162" } ], "filter_code": "000000000000000000000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "P38983-1" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "evidence": [ { "id": "38843836", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/38843836" }, { "id": "O88943", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O88943" }, { "id": "41549750", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/41549750" }, { "id": "34502162", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34502162" } ], "filter_code": "000000000000000000000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "O88943-1" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "evidence": [ { "id": "18047804", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/18047804" }, { "id": "P05197", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P05197" }, { "id": "41549750", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/41549750" }, { "id": "34502162", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34502162" } ], "filter_code": "000000000000000000000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "P05197-1" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "evidence": [ { "id": "41549750", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/41549750" }, { "id": "Q5XI07", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=Q5XI07" }, { "id": "34502162", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34502162" } ], "filter_code": "000000000000000000000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "Q5XI07-1" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "evidence": [ { "id": "38843836", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/38843836" }, { "id": "P63018", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P63018" }, { "id": "41549750", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/41549750" }, { "id": "11696006", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/11696006" }, { "id": "34502162", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34502162" } ], "filter_code": "000000000000000000000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "P63018-1" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "evidence": [ { "id": "38843836", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/38843836" }, { "id": "P06685", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P06685" }, { "id": "41549750", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/41549750" }, { "id": "34502162", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34502162" } ], "filter_code": "000000000000000000000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "P06685-1" } ], "record_id": "pubmed.41549750", "abstract": "", "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 11 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "glytoucan_ac" ] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 12 }, { "field": "total_sites", "count": 4 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 4 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 4 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "exact_sites", "count": 3 }, { "field": "exact_o_linked_sites", "count": 3 }, { "field": "exact_o_linked_glycan_sites", "count": 3 }, { "field": "exact_o_linked_glycans", "count": 1 }, { "field": "fuzzy_sites", "count": 1 }, { "field": "fuzzy_o_linked_sites", "count": 1 }, { "field": "fuzzy_o_linked_glycan_sites", "count": 1 }, { "field": "fuzzy_o_linked_glycans", "count": 1 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "filter_code", "uniprot_canonical_ac", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 12 }, { "field": "total_sites", "count": 4 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 4 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 4 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "exact_sites", "count": 3 }, { "field": "exact_o_linked_sites", "count": 3 }, { "field": "exact_o_linked_glycan_sites", "count": 3 }, { "field": "exact_o_linked_glycans", "count": 1 }, { "field": "fuzzy_sites", "count": 1 }, { "field": "fuzzy_o_linked_sites", "count": 1 }, { "field": "fuzzy_o_linked_glycan_sites", "count": 1 }, { "field": "fuzzy_o_linked_glycans", "count": 1 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "filter_code", "uniprot_canonical_ac", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Basigin (CD147) is the target for organomercurial inhibition of monocarboxylate transporter isoforms 1 and 4: the ancillary protein for the insensitive MCT2 is EMBIGIN (gp70).", "journal": "J. Biol. Chem.", "date": "2005", "authors": "Wilson MC, Meredith D, Fox JE, Manoharan C, Davies AJ, Halestrap AP", "reference": { "type": "PubMed", "id": "15917240", "url": "https://pubmed.ncbi.nlm.nih.gov/15917240" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O88775-1", "protein_name": "Embigin", "gene_name": "Emb", "tax_name": "Rat" }, { "uniprot_canonical_ac": "O60669-1", "protein_name": "Monocarboxylate transporter 2", "gene_name": "SLC16A7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35613-1", "protein_name": "Basigin", "gene_name": "BSG", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15427-1", "protein_name": "Monocarboxylate transporter 4", "gene_name": "SLC16A3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P53985-1", "protein_name": "Monocarboxylate transporter 1", "gene_name": "SLC16A1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95907-1", "protein_name": "Monocarboxylate transporter 3", "gene_name": "SLC16A8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6PCB8-1", "protein_name": "Embigin", "gene_name": "EMB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q63344-1", "protein_name": "Monocarboxylate transporter 2", "gene_name": "Slc16a7", "tax_name": "Rat" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "O88775", "url": "https://www.uniprot.org/uniprotkb/O88775" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "record_id": "pubmed.15917240", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 8 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Studies on the DIDS-binding site of monocarboxylate transporter 1 suggest a homology model of the open conformation and a plausible translocation cycle.", "journal": "The Journal of biological chemistry", "date": "2009", "authors": "Wilson MC, Meredith D, Bunnun C, Sessions RB, Halestrap AP", "reference": { "type": "PubMed", "id": "19473976", "url": "https://pubmed.ncbi.nlm.nih.gov/19473976" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O88775-1", "protein_name": "Embigin", "gene_name": "Emb", "tax_name": "Rat" }, { "uniprot_canonical_ac": "P53987-1", "protein_name": "Monocarboxylate transporter 1", "gene_name": "Slc16a1", "tax_name": "Rat" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "O88775", "url": "https://www.uniprot.org/uniprotkb/O88775" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "mutagenesis": [ { "start_pos": 282, "end_pos": 282, "sequence_org": "K", "sequence_mut": "Q", "comment": "No effect on expression at the cell membrane. No effect on lactate transport across the cell membrane.", "evidence": [ { "database": "UniProtKB", "id": "P53987", "url": "https://www.uniprot.org/uniprotkb/P53987" }, { "database": "PubMed", "id": "19473976", "url": "https://pubmed.ncbi.nlm.nih.gov/19473976" } ], "uniprot_canonical_ac": "P53987-1" }, { "start_pos": 282, "end_pos": 282, "sequence_org": "K", "sequence_mut": "R", "comment": "No effect on expression at the cell membrane. No effect on lactate transport across the cell membrane.", "evidence": [ { "database": "UniProtKB", "id": "P53987", "url": "https://www.uniprot.org/uniprotkb/P53987" }, { "database": "PubMed", "id": "19473976", "url": "https://pubmed.ncbi.nlm.nih.gov/19473976" } ], "uniprot_canonical_ac": "P53987-1" }, { "start_pos": 284, "end_pos": 284, "sequence_org": "K", "sequence_mut": "Q", "comment": "No effect on expression at the cell membrane. No effect on lactate transport across the cell membrane.", "evidence": [ { "database": "UniProtKB", "id": "P53987", "url": "https://www.uniprot.org/uniprotkb/P53987" }, { "database": "PubMed", "id": "19473976", "url": "https://pubmed.ncbi.nlm.nih.gov/19473976" } ], "uniprot_canonical_ac": "P53987-1" }, { "start_pos": 284, "end_pos": 284, "sequence_org": "K", "sequence_mut": "R", "comment": "No effect on expression at the cell membrane. No effect on lactate transport across the cell membrane.", "evidence": [ { "database": "UniProtKB", "id": "P53987", "url": "https://www.uniprot.org/uniprotkb/P53987" }, { "database": "PubMed", "id": "19473976", "url": "https://pubmed.ncbi.nlm.nih.gov/19473976" } ], "uniprot_canonical_ac": "P53987-1" }, { "start_pos": 290, "end_pos": 290, "sequence_org": "K", "sequence_mut": "Q", "comment": "No effect on expression at the cell membrane. No effect on lactate transport across the cell membrane.", "evidence": [ { "database": "UniProtKB", "id": "P53987", "url": "https://www.uniprot.org/uniprotkb/P53987" }, { "database": "PubMed", "id": "19473976", "url": "https://pubmed.ncbi.nlm.nih.gov/19473976" } ], "uniprot_canonical_ac": "P53987-1" }, { "start_pos": 290, "end_pos": 290, "sequence_org": "K", "sequence_mut": "R", "comment": "No effect on expression at the cell membrane. No effect on lactate transport across the cell membrane.", "evidence": [ { "database": "UniProtKB", "id": "P53987", "url": "https://www.uniprot.org/uniprotkb/P53987" }, { "database": "PubMed", "id": "19473976", "url": "https://pubmed.ncbi.nlm.nih.gov/19473976" } ], "uniprot_canonical_ac": "P53987-1" }, { "start_pos": 38, "end_pos": 38, "sequence_org": "K", "sequence_mut": "Q", "comment": "No effect on expression at the cell membrane, but abolishes lactate transport across the cell membrane.", "evidence": [ { "database": "UniProtKB", "id": "P53987", "url": "https://www.uniprot.org/uniprotkb/P53987" }, { "database": "PubMed", "id": "19473976", "url": "https://pubmed.ncbi.nlm.nih.gov/19473976" } ], "uniprot_canonical_ac": "P53987-1" }, { "start_pos": 38, "end_pos": 38, "sequence_org": "K", "sequence_mut": "R", "comment": "No effect on expression at the cell membrane, but abolishes lactate transport across the cell membrane.", "evidence": [ { "database": "UniProtKB", "id": "P53987", "url": "https://www.uniprot.org/uniprotkb/P53987" }, { "database": "PubMed", "id": "19473976", "url": "https://pubmed.ncbi.nlm.nih.gov/19473976" } ], "uniprot_canonical_ac": "P53987-1" }, { "start_pos": 413, "end_pos": 413, "sequence_org": "K", "sequence_mut": "Q", "comment": "No effect on expression at the cell membrane. No effect on lactate transport across the cell membrane.", "evidence": [ { "database": "UniProtKB", "id": "P53987", "url": "https://www.uniprot.org/uniprotkb/P53987" }, { "database": "PubMed", "id": "19473976", "url": "https://pubmed.ncbi.nlm.nih.gov/19473976" } ], "uniprot_canonical_ac": "P53987-1" }, { "start_pos": 413, "end_pos": 413, "sequence_org": "K", "sequence_mut": "R", "comment": "No effect on expression at the cell membrane. No effect on lactate transport across the cell membrane.", "evidence": [ { "database": "UniProtKB", "id": "P53987", "url": "https://www.uniprot.org/uniprotkb/P53987" }, { "database": "PubMed", "id": "19473976", "url": "https://pubmed.ncbi.nlm.nih.gov/19473976" } ], "uniprot_canonical_ac": "P53987-1" }, { "start_pos": 45, "end_pos": 45, "sequence_org": "K", "sequence_mut": "Q", "comment": "No effect on expression at the cell membrane. No effect on lactate transport across the cell membrane.", "evidence": [ { "database": "UniProtKB", "id": "P53987", "url": "https://www.uniprot.org/uniprotkb/P53987" }, { "database": "PubMed", "id": "19473976", "url": "https://pubmed.ncbi.nlm.nih.gov/19473976" } ], "uniprot_canonical_ac": "P53987-1" }, { "start_pos": 45, "end_pos": 45, "sequence_org": "K", "sequence_mut": "R", "comment": "No effect on expression at the cell membrane. No effect on lactate transport across the cell membrane.", "evidence": [ { "database": "UniProtKB", "id": "P53987", "url": "https://www.uniprot.org/uniprotkb/P53987" }, { "database": "PubMed", "id": "19473976", "url": "https://pubmed.ncbi.nlm.nih.gov/19473976" } ], "uniprot_canonical_ac": "P53987-1" } ], "record_id": "pubmed.19473976", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The inhibition of monocarboxylate transporter 2 (MCT2) by AR-C155858 is modulated by the associated ancillary protein.", "journal": "The Biochemical journal", "date": "2010", "authors": "Ovens MJ, Manoharan C, Wilson MC, Murray CM, Halestrap AP", "reference": { "type": "PubMed", "id": "20695846", "url": "https://pubmed.ncbi.nlm.nih.gov/20695846" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O88775-1", "protein_name": "Embigin", "gene_name": "Emb", "tax_name": "Rat" }, { "uniprot_canonical_ac": "Q63344-1", "protein_name": "Monocarboxylate transporter 2", "gene_name": "Slc16a7", "tax_name": "Rat" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "O88775", "url": "https://www.uniprot.org/uniprotkb/O88775" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "record_id": "pubmed.20695846", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Membrane-anchored carbonic anhydrase IV interacts with monocarboxylate transporters via their chaperones CD147 and GP70.", "journal": "The Journal of biological chemistry", "date": "2019", "authors": "Forero-Quintero LS, Ames S, Schneider HP, Thyssen A, Boone CD, Andring JT, McKenna R, Casey JR, Deitmer JW, Becker HM", "reference": { "type": "PubMed", "id": "30446621", "url": "https://pubmed.ncbi.nlm.nih.gov/30446621" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O88775-1", "protein_name": "Embigin", "gene_name": "Emb", "tax_name": "Rat" }, { "uniprot_canonical_ac": "P26453-1", "protein_name": "Basigin", "gene_name": "Bsg", "tax_name": "Rat" }, { "uniprot_canonical_ac": "Q6PCB8-1", "protein_name": "Embigin", "gene_name": "EMB", "tax_name": "Human" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "O88775", "url": "https://www.uniprot.org/uniprotkb/O88775" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "record_id": "pubmed.30446621", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Mammalian monocarboxylate transporter 7 (MCT7/Slc16a6) is a novel facilitative taurine transporter.", "journal": "The Journal of biological chemistry", "date": "2022", "authors": "Higuchi K, Sugiyama K, Tomabechi R, Kishimoto H, Inoue K", "reference": { "type": "PubMed", "id": "35257743", "url": "https://pubmed.ncbi.nlm.nih.gov/35257743" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O88775-1", "protein_name": "Embigin", "gene_name": "Emb", "tax_name": "Rat" }, { "uniprot_canonical_ac": "O15403-1", "protein_name": "Monocarboxylate transporter 7", "gene_name": "SLC16A6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P26453-1", "protein_name": "Basigin", "gene_name": "Bsg", "tax_name": "Rat" }, { "uniprot_canonical_ac": "Q7TMR7-1", "protein_name": "Monocarboxylate transporter 7", "gene_name": "Slc16a6", "tax_name": "Rat" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "O88775", "url": "https://www.uniprot.org/uniprotkb/O88775" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "record_id": "pubmed.35257743", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 4 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Interaction of the erythrocyte lactate transporter (monocarboxylate transporter 1) with an integral 70-kDa membrane glycoprotein of the immunoglobulin superfamily.", "journal": "The Journal of biological chemistry", "date": "1997", "authors": "Poole RC, Halestrap AP", "reference": { "type": "PubMed", "id": "9169423", "url": "https://pubmed.ncbi.nlm.nih.gov/9169423" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O88775-1", "protein_name": "Embigin", "gene_name": "Emb", "tax_name": "Rat" }, { "uniprot_canonical_ac": "P53987-1", "protein_name": "Monocarboxylate transporter 1", "gene_name": "Slc16a1", "tax_name": "Rat" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "O88775", "url": "https://www.uniprot.org/uniprotkb/O88775" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "record_id": "pubmed.9169423", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Embigin, a developmentally expressed member of the immunoglobulin super family, is also expressed during regression of prostate and mammary gland.", "journal": "Dev. Genet.", "date": "1997", "authors": "Guenette RS, Sridhar S, Herley M, Mooibroek M, Wong P, Tenniswood M", "reference": { "type": "PubMed", "id": "9438341", "url": "https://pubmed.ncbi.nlm.nih.gov/9438341" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O88775-1", "protein_name": "Embigin", "gene_name": "Emb", "tax_name": "Rat" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "O88775", "url": "https://www.uniprot.org/uniprotkb/O88775" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "record_id": "pubmed.9438341", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The rat P450 IID subfamily: complete sequences of four closely linked genes and evidence that gene conversions maintained sequence homogeneity at the heme-binding region of the cytochrome P450 active site.", "journal": "J. Mol. Evol.", "date": "1990", "authors": "Matsunaga E, Umeno M, Gonzalez F J", "reference": { "type": "PubMed", "id": "2107330", "url": "https://pubmed.ncbi.nlm.nih.gov/2107330" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P10634-1", "protein_name": "Cytochrome P450 2D26", "gene_name": "Cyp2d26; Cyp2d2", "tax_name": "Rat" }, { "uniprot_canonical_ac": "P12938-1", "protein_name": "Cytochrome P450 2D3", "gene_name": "Cyp2d3", "tax_name": "Rat" }, { "uniprot_canonical_ac": "P12939-1", "protein_name": "Cytochrome P450 2D10", "gene_name": "Cyp2d10", "tax_name": "Rat" }, { "uniprot_canonical_ac": "Q64680-1", "protein_name": "Cytochrome P450 2D4", "gene_name": "Cyp2d4", "tax_name": "Rat" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "P10634", "url": "https://www.uniprot.org/uniprotkb/P10634" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "record_id": "pubmed.2107330", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 4 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Effects of Panax notoginseng saponins on the activities of CYP1A2, CYP2C9, CYP2D6 and CYP3A4 in rats in vivo.", "journal": "Phytotherapy research : PTR", "date": "2012", "authors": "Liu R, Qin M, Hang P, Liu Y, Zhang Z, Liu G", "reference": { "type": "PubMed", "id": "22162298", "url": "https://pubmed.ncbi.nlm.nih.gov/22162298" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P10634-1", "protein_name": "Cytochrome P450 2D26", "gene_name": "Cyp2d26; Cyp2d2", "tax_name": "Rat" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "P10634", "url": "https://www.uniprot.org/uniprotkb/P10634" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "record_id": "pubmed.22162298", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The CYP2D gene subfamily: analysis of the molecular basis of the debrisoquine 4-hydroxylase deficiency in DA rats.", "journal": "Biochemistry", "date": "1989", "authors": "Matsunaga E, Zanger UM, Hardwick JP, Gelboin HV, Meyer UA, Gonzalez FJ", "reference": { "type": "PubMed", "id": "2819073", "url": "https://pubmed.ncbi.nlm.nih.gov/2819073" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P10634-1", "protein_name": "Cytochrome P450 2D26", "gene_name": "Cyp2d26; Cyp2d2", "tax_name": "Rat" }, { "uniprot_canonical_ac": "P10633-1", "protein_name": "Cytochrome P450 2D1", "gene_name": "Cyp2d1; Cyp2d3; Cyp2d5", "tax_name": "Rat" }, { "uniprot_canonical_ac": "P12938-1", "protein_name": "Cytochrome P450 2D3", "gene_name": "Cyp2d3", "tax_name": "Rat" }, { "uniprot_canonical_ac": "P12939-1", "protein_name": "Cytochrome P450 2D10", "gene_name": "Cyp2d10", "tax_name": "Rat" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "P10634", "url": "https://www.uniprot.org/uniprotkb/P10634" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "record_id": "pubmed.2819073", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 4 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Relative contribution of rat CYP isoforms responsible for stereoselective metabolism of carvedilol.", "journal": "The Journal of toxicological sciences", "date": "2018", "authors": "Iwaki M, Niwa T, Nakamura Y, Kawase A, Komura H", "reference": { "type": "PubMed", "id": "29415952", "url": "https://pubmed.ncbi.nlm.nih.gov/29415952" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P10634-1", "protein_name": "Cytochrome P450 2D26", "gene_name": "Cyp2d26; Cyp2d2", "tax_name": "Rat" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "P10634", "url": "https://www.uniprot.org/uniprotkb/P10634" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "record_id": "pubmed.29415952", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Four species of cDNAs for cytochrome P450 isozymes immunorelated to P450C-M/F encode for members of P450IID subfamily, increasing the number of members within the subfamily.", "journal": "Biochem. Biophys. Res. Commun.", "date": "1988", "authors": "Ishida N, Tawaragi Y, Inuzuka C, Sugita O, Kubota I, Nakazato H, Noguchi T, Sassa S", "reference": { "type": "PubMed", "id": "3190674", "url": "https://pubmed.ncbi.nlm.nih.gov/3190674" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P10634-1", "protein_name": "Cytochrome P450 2D26", "gene_name": "Cyp2d26; Cyp2d2", "tax_name": "Rat" }, { "uniprot_canonical_ac": "P10633-1", "protein_name": "Cytochrome P450 2D1", "gene_name": "Cyp2d1; Cyp2d3; Cyp2d5", "tax_name": "Rat" }, { "uniprot_canonical_ac": "P12939-1", "protein_name": "Cytochrome P450 2D10", "gene_name": "Cyp2d10", "tax_name": "Rat" }, { "uniprot_canonical_ac": "Q64680-1", "protein_name": "Cytochrome P450 2D4", "gene_name": "Cyp2d4", "tax_name": "Rat" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "P10634", "url": "https://www.uniprot.org/uniprotkb/P10634" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "record_id": "pubmed.3190674", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 4 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Debrisoquine 4-hydroxylase: characterization of a new P450 gene subfamily, regulation, chromosomal mapping, and molecular analysis of the DA rat polymorphism.", "journal": "DNA", "date": "1987", "authors": "Gonzalez F J, Matsunaga T, Nagata K, Meyer U A, Nebert D W, Pastewka J, Kozak C A, Gillette J, Gelboin H V, Hardwick J P", "reference": { "type": "PubMed", "id": "3582092", "url": "https://pubmed.ncbi.nlm.nih.gov/3582092" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P10634-1", "protein_name": "Cytochrome P450 2D26", "gene_name": "Cyp2d26; Cyp2d2", "tax_name": "Rat" }, { "uniprot_canonical_ac": "P10633-1", "protein_name": "Cytochrome P450 2D1", "gene_name": "Cyp2d1; Cyp2d3; Cyp2d5", "tax_name": "Rat" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "P10634", "url": "https://www.uniprot.org/uniprotkb/P10634" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "record_id": "pubmed.3582092", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The Effect of Maternal High-Fat or High-Carbohydrate Diet during Pregnancy and Lactation on Cytochrome P450 2D (CYP2D) in the Liver and Brain of Rat Offspring.", "journal": "International journal of molecular sciences", "date": "2024-07-19", "authors": "Kuban Wojciech, Haduch Anna, Bromek Ewa, Basi\u0144ska-Ziobro\u0144 Agnieszka, Gawli\u0144ska Kinga, Gawli\u0144ski Dawid, Filip Ma\u0142gorzata, Daniel W\u0142adys\u0142awa A", "reference": { "type": "PubMed", "id": "39063146", "url": "https://pubmed.ncbi.nlm.nih.gov/39063146" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P10634-1", "protein_name": "Cytochrome P450 2D26", "gene_name": "Cyp2d26; Cyp2d2", "tax_name": "Rat" }, { "uniprot_canonical_ac": "P10633-1", "protein_name": "Cytochrome P450 2D1", "gene_name": "Cyp2d1; Cyp2d3; Cyp2d5", "tax_name": "Rat" }, { "uniprot_canonical_ac": "Q64680-1", "protein_name": "Cytochrome P450 2D4", "gene_name": "Cyp2d4", "tax_name": "Rat" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "P10634", "url": "https://www.uniprot.org/uniprotkb/P10634" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "record_id": "pubmed.39063146", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Anti-peptide antibodies to the P4502D subfamily in rat, dog and man.", "journal": "Xenobiotica; the fate of foreign compounds in biological systems", "date": "1995-11", "authors": "Nakamura A, Yamamoto Y, Tasaki T, Sugimoto C, Masuda M, Kazusaka A, Fujita S", "reference": { "type": "PubMed", "id": "8578766", "url": "https://pubmed.ncbi.nlm.nih.gov/8578766" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P10634-1", "protein_name": "Cytochrome P450 2D26", "gene_name": "Cyp2d26; Cyp2d2", "tax_name": "Rat" }, { "uniprot_canonical_ac": "P10635-1", "protein_name": "Cytochrome P450 2D6", "gene_name": "CYP2D6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q64680-1", "protein_name": "Cytochrome P450 2D4", "gene_name": "Cyp2d4", "tax_name": "Rat" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "P10634", "url": "https://www.uniprot.org/uniprotkb/P10634" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "record_id": "pubmed.8578766", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Expression of four rat CYP2D isoforms in Saccharomyces cerevisiae and their catalytic specificity.", "journal": "Arch. Biochem. Biophys.", "date": "1997", "authors": "Wan J, Imaoka S, Chow T, Hiroi T, Yabusaki Y, Funae Y", "reference": { "type": "PubMed", "id": "9434752", "url": "https://pubmed.ncbi.nlm.nih.gov/9434752" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P10634-1", "protein_name": "Cytochrome P450 2D26", "gene_name": "Cyp2d26; Cyp2d2", "tax_name": "Rat" }, { "uniprot_canonical_ac": "P10633-1", "protein_name": "Cytochrome P450 2D1", "gene_name": "Cyp2d1; Cyp2d3; Cyp2d5", "tax_name": "Rat" }, { "uniprot_canonical_ac": "P12938-1", "protein_name": "Cytochrome P450 2D3", "gene_name": "Cyp2d3", "tax_name": "Rat" }, { "uniprot_canonical_ac": "Q64680-1", "protein_name": "Cytochrome P450 2D4", "gene_name": "Cyp2d4", "tax_name": "Rat" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "P10634", "url": "https://www.uniprot.org/uniprotkb/P10634" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "record_id": "pubmed.9434752", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 4 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Cod106, a novel synaptic protein expressed in sensory hair cells of the inner ear and in CNS neurons.", "journal": "Mol. Cell. Neurosci.", "date": "2005", "authors": "Reisinger E, Zimmermann U, Knipper M, Ludwig J, Klocker N, Fakler B, Oliver D", "reference": { "type": "PubMed", "id": "15607946", "url": "https://pubmed.ncbi.nlm.nih.gov/15607946" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q69CM7-1", "protein_name": "MYCBP-associated protein", "gene_name": "Mycbpap", "tax_name": "Rat" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "Q69CM7", "url": "https://www.uniprot.org/uniprotkb/Q69CM7" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "record_id": "pubmed.15607946", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Leiomodin is an actin filament nucleator in muscle cells.", "journal": "Science (New York, N.Y.)", "date": "2008", "authors": "Chereau D, Boczkowska M, Skwarek-Maruszewska A, Fujiwara I, Hayes DB, Rebowski G, Lappalainen P, Pollard TD, Dominguez R", "reference": { "type": "PubMed", "id": "18403713", "url": "https://pubmed.ncbi.nlm.nih.gov/18403713" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "A1A5Q0-1", "protein_name": "Leiomodin-2", "gene_name": "Lmod2", "tax_name": "Rat" }, { "uniprot_canonical_ac": "Q6P5Q4-1", "protein_name": "Leiomodin-2", "gene_name": "LMOD2", "tax_name": "Human" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "A1A5Q0", "url": "https://www.uniprot.org/uniprotkb/A1A5Q0" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "record_id": "pubmed.18403713", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Different localizations and cellular behaviors of leiomodin and tropomodulin in mature cardiomyocyte sarcomeres.", "journal": "Mol. Biol. Cell", "date": "2010", "authors": "Skwarek-Maruszewska A, Boczkowska M, Zajac AL, Kremneva E, Svitkina T, Dominguez R, Lappalainen P", "reference": { "type": "PubMed", "id": "20685966", "url": "https://pubmed.ncbi.nlm.nih.gov/20685966" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "A1A5Q0-1", "protein_name": "Leiomodin-2", "gene_name": "Lmod2", "tax_name": "Rat" }, { "uniprot_canonical_ac": "Q6P5Q4-1", "protein_name": "Leiomodin-2", "gene_name": "LMOD2", "tax_name": "Human" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "A1A5Q0", "url": "https://www.uniprot.org/uniprotkb/A1A5Q0" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "record_id": "pubmed.20685966", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Regulation of a cytosolic and nuclear O-GlcNAc transferase. Role of the tetratricopeptide repeats.", "journal": "The Journal of biological chemistry", "date": "1999", "authors": "Kreppel LK, Hart GW", "reference": { "type": "PubMed", "id": "10542233", "url": "https://pubmed.ncbi.nlm.nih.gov/10542233" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P56558-1", "protein_name": "UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit", "gene_name": "Ogt", "tax_name": "Rat" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "P56558", "url": "https://www.uniprot.org/uniprotkb/P56558" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "mutagenesis": [ { "start_pos": 2, "end_pos": 173, "sequence_org": "ASSVGNVADSTGLAELAHREYQAGDFEAAERHCMQLWRQEPDNTGVLLLLSSIHFQCRRLDRSAHFSTLAIKQNPLLAEAYSNLGNVYKERGQLQEAIEHYRHALRLKPDFIDGYINLAAALVAAGDMEGAVQAYVSALQYNPDLYCVRSDLGNLLKALGRLEEAKACYLKA", "sequence_mut": "", "comment": "Wild-type O-GlcNAc transferase activity, forms trimers.", "evidence": [ { "database": "UniProtKB", "id": "P56558", "url": "https://www.uniprot.org/uniprotkb/P56558" }, { "database": "PubMed", "id": "10542233", "url": "https://pubmed.ncbi.nlm.nih.gov/10542233" } ], "uniprot_canonical_ac": "P56558-1" }, { "start_pos": 2, "end_pos": 274, "sequence_org": "ASSVGNVADSTGLAELAHREYQAGDFEAAERHCMQLWRQEPDNTGVLLLLSSIHFQCRRLDRSAHFSTLAIKQNPLLAEAYSNLGNVYKERGQLQEAIEHYRHALRLKPDFIDGYINLAAALVAAGDMEGAVQAYVSALQYNPDLYCVRSDLGNLLKALGRLEEAKACYLKAIETQPNFAVAWSNLGCVFNAQGEIWLAIHHFEKAVTLDPNFLDAYINLGNVLKEARIFDRAVAAYLRALSLSPNHAVVHGNLACVYYEQGLIDLAIDTYRR", "sequence_mut": "", "comment": "Wild-type O-GlcNAc transferase activity, does not form trimers.", "evidence": [ { "database": "UniProtKB", "id": "P56558", "url": "https://www.uniprot.org/uniprotkb/P56558" }, { "database": "PubMed", "id": "10542233", "url": "https://pubmed.ncbi.nlm.nih.gov/10542233" } ], "uniprot_canonical_ac": "P56558-1" } ], "record_id": "pubmed.10542233", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Localization of the O-linked N-acetylglucosamine transferase in rat pancreas.", "journal": "Diabetes", "date": "1999", "authors": "Akimoto Y, Kreppel LK, Hirano H, Hart GW", "reference": { "type": "PubMed", "id": "10580430", "url": "https://pubmed.ncbi.nlm.nih.gov/10580430" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P56558-1", "protein_name": "UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit", "gene_name": "Ogt", "tax_name": "Rat" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "P56558", "url": "https://www.uniprot.org/uniprotkb/P56558" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "record_id": "pubmed.10580430", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Purification of the O-glycosylated protein p135 and identification as O-GlcNAc transferase.", "journal": "Biochemical and biophysical research communications", "date": "2001", "authors": "Konrad RJ, Tolar JF, Hale JE, Knierman MD, Becker GW, Kudlow JE", "reference": { "type": "PubMed", "id": "11700029", "url": "https://pubmed.ncbi.nlm.nih.gov/11700029" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P56558-1", "protein_name": "UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit", "gene_name": "Ogt", "tax_name": "Rat" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "P56558", "url": "https://www.uniprot.org/uniprotkb/P56558" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "record_id": "pubmed.11700029", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Glycosylation of nuclear and cytoplasmic proteins. Purification and characterization of a uridine diphospho-N-acetylglucosamine:polypeptide beta-N-acetylglucosaminyltransferase.", "journal": "The Journal of biological chemistry", "date": "1992", "authors": "Haltiwanger RS, Blomberg MA, Hart GW", "reference": { "type": "PubMed", "id": "1533623", "url": "https://pubmed.ncbi.nlm.nih.gov/1533623" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P56558-1", "protein_name": "UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit", "gene_name": "Ogt", "tax_name": "Rat" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "P56558", "url": "https://www.uniprot.org/uniprotkb/P56558" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "record_id": "pubmed.1533623", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Ataxin-10 interacts with O-linked beta-N-acetylglucosamine transferase in the brain.", "journal": "J. Biol. Chem.", "date": "2006", "authors": "Marz P, Stetefeld J, Bendfeldt K, Nitsch C, Reinstein J, Shoeman RL, Dimitriades-Schmutz B, Schwager M, Leiser D, Ozcan S, Otten U, Ozbek S", "reference": { "type": "PubMed", "id": "16714295", "url": "https://pubmed.ncbi.nlm.nih.gov/16714295" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P56558-1", "protein_name": "UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit", "gene_name": "Ogt", "tax_name": "Rat" }, { "uniprot_canonical_ac": "Q9ER24-1", "protein_name": "Ataxin-10", "gene_name": "Atxn10", "tax_name": "Rat" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "P56558", "url": "https://www.uniprot.org/uniprotkb/P56558" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "record_id": "pubmed.16714295", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Phosphoinositide signalling links O-GlcNAc transferase to insulin resistance.", "journal": "Nature", "date": "2008", "authors": "Yang X, Ongusaha PP, Miles PD, Havstad JC, Zhang F, So WV, Kudlow JE, Michell RH, Olefsky JM, Field SJ, Evans RM", "reference": { "type": "PubMed", "id": "18288188", "url": "https://pubmed.ncbi.nlm.nih.gov/18288188" }, "referenced_glycans": [ { "glytoucan_ac": "G49108TO" } ], "referenced_proteins": [ { "uniprot_canonical_ac": "P56558-1", "protein_name": "UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit", "gene_name": "Ogt", "tax_name": "Rat" }, { "uniprot_canonical_ac": "P31750-1", "protein_name": "RAC-alpha serine/threonine-protein kinase", "gene_name": "Akt1", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "P35569-1", "protein_name": "Insulin receptor substrate 1", "gene_name": "Irs1", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "P15208-1", "protein_name": "Insulin receptor", "gene_name": "Insr", "tax_name": "Mouse" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "P56558", "url": "https://www.uniprot.org/uniprotkb/P56558" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "mutagenesis": [ { "start_pos": 1000, "end_pos": 1000, "sequence_org": "K", "sequence_mut": "A", "comment": "No effect on phosphatidylinisitol binding.", "evidence": [ { "database": "UniProtKB", "id": "P56558", "url": "https://www.uniprot.org/uniprotkb/P56558" }, { "database": "PubMed", "id": "18288188", "url": "https://pubmed.ncbi.nlm.nih.gov/18288188" } ], "uniprot_canonical_ac": "P56558-1" }, { "start_pos": 981, "end_pos": 982, "sequence_org": "KK", "sequence_mut": "AA", "comment": "Abolishes phosphatidylinisitol binding, no translocation to the cell membrane, and no effect on phosphorylation of AKT1 nor IRS1.", "evidence": [ { "database": "UniProtKB", "id": "P56558", "url": "https://www.uniprot.org/uniprotkb/P56558" }, { "database": "PubMed", "id": "18288188", "url": "https://pubmed.ncbi.nlm.nih.gov/18288188" } ], "uniprot_canonical_ac": "P56558-1" }, { "start_pos": 984, "end_pos": 984, "sequence_org": "R", "sequence_mut": "A", "comment": "No effect on phosphatidylinisitol binding.", "evidence": [ { "database": "UniProtKB", "id": "P56558", "url": "https://www.uniprot.org/uniprotkb/P56558" }, { "database": "PubMed", "id": "18288188", "url": "https://pubmed.ncbi.nlm.nih.gov/18288188" } ], "uniprot_canonical_ac": "P56558-1" }, { "start_pos": 986, "end_pos": 986, "sequence_org": "K", "sequence_mut": "A", "comment": "Reduced phosphatidylinisitol binding.", "evidence": [ { "database": "UniProtKB", "id": "P56558", "url": "https://www.uniprot.org/uniprotkb/P56558" }, { "database": "PubMed", "id": "18288188", "url": "https://pubmed.ncbi.nlm.nih.gov/18288188" } ], "uniprot_canonical_ac": "P56558-1" }, { "start_pos": 989, "end_pos": 989, "sequence_org": "K", "sequence_mut": "A", "comment": "Reduced phosphatidylinisitol binding.", "evidence": [ { "database": "UniProtKB", "id": "P56558", "url": "https://www.uniprot.org/uniprotkb/P56558" }, { "database": "PubMed", "id": "18288188", "url": "https://pubmed.ncbi.nlm.nih.gov/18288188" } ], "uniprot_canonical_ac": "P56558-1" }, { "start_pos": 991, "end_pos": 991, "sequence_org": "R", "sequence_mut": "A", "comment": "No effect on phosphatidylinisitol binding.", "evidence": [ { "database": "UniProtKB", "id": "P56558", "url": "https://www.uniprot.org/uniprotkb/P56558" }, { "database": "PubMed", "id": "18288188", "url": "https://pubmed.ncbi.nlm.nih.gov/18288188" } ], "uniprot_canonical_ac": "P56558-1" } ], "phosphorylation": [ { "start_pos": 308, "end_pos": 308, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine; by IKKE, PDPK1 and TBK1", "evidence": [ { "database": "UniProtKB", "id": "P31750", "url": "https://www.uniprot.org/uniprotkb/P31750" }, { "database": "PRO", "id": "P31750", "url": "https://proconsortium.org/cgi-bin/entry_pro?id=P31750" }, { "database": "iPTMnet", "id": "P31750", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P31750" }, { "database": "PubMed", "id": "31915252", "url": "https://pubmed.ncbi.nlm.nih.gov/31915252" }, { "database": "PubMed", "id": "10438924", "url": "https://pubmed.ncbi.nlm.nih.gov/10438924" }, { "database": "PubMed", "id": "11006271", "url": "https://pubmed.ncbi.nlm.nih.gov/11006271" }, { "database": "PubMed", "id": "11375936", "url": "https://pubmed.ncbi.nlm.nih.gov/11375936" }, { "database": "PubMed", "id": "11507090", "url": "https://pubmed.ncbi.nlm.nih.gov/11507090" }, { "database": "PubMed", "id": "11563975", "url": "https://pubmed.ncbi.nlm.nih.gov/11563975" }, { "database": "PubMed", "id": "11803463", "url": "https://pubmed.ncbi.nlm.nih.gov/11803463" }, { "database": "PubMed", "id": "12153489", "url": "https://pubmed.ncbi.nlm.nih.gov/12153489" }, { "database": "PubMed", "id": "12493740", "url": "https://pubmed.ncbi.nlm.nih.gov/12493740" }, { "database": "PubMed", "id": "12637511", "url": "https://pubmed.ncbi.nlm.nih.gov/12637511" }, { "database": "PubMed", "id": "12911789", "url": "https://pubmed.ncbi.nlm.nih.gov/12911789" }, { "database": "PubMed", "id": "12947100", "url": "https://pubmed.ncbi.nlm.nih.gov/12947100" }, { "database": "PubMed", "id": "14623889", "url": "https://pubmed.ncbi.nlm.nih.gov/14623889" }, { "database": "PubMed", "id": "15020199", "url": "https://pubmed.ncbi.nlm.nih.gov/15020199" }, { "database": "PubMed", "id": "15065872", "url": "https://pubmed.ncbi.nlm.nih.gov/15065872" }, { "database": "PubMed", "id": "15067018", "url": "https://pubmed.ncbi.nlm.nih.gov/15067018" }, { "database": "PubMed", "id": "15122342", "url": "https://pubmed.ncbi.nlm.nih.gov/15122342" }, { "database": "PubMed", "id": "15278907", "url": "https://pubmed.ncbi.nlm.nih.gov/15278907" }, { "database": "PubMed", "id": "15389876", "url": "https://pubmed.ncbi.nlm.nih.gov/15389876" }, { "database": "PubMed", "id": "15504738", "url": "https://pubmed.ncbi.nlm.nih.gov/15504738" }, { "database": "PubMed", "id": "15574782", "url": "https://pubmed.ncbi.nlm.nih.gov/15574782" }, { "database": "PubMed", "id": "15591229", "url": "https://pubmed.ncbi.nlm.nih.gov/15591229" }, { "database": "PubMed", "id": "15842198", "url": "https://pubmed.ncbi.nlm.nih.gov/15842198" }, { "database": "PubMed", "id": "16338957", "url": "https://pubmed.ncbi.nlm.nih.gov/16338957" }, { "database": "PubMed", "id": "16512910", "url": "https://pubmed.ncbi.nlm.nih.gov/16512910" }, { "database": "PubMed", "id": "16787946", "url": "https://pubmed.ncbi.nlm.nih.gov/16787946" }, { "database": "PubMed", "id": "16809629", "url": "https://pubmed.ncbi.nlm.nih.gov/16809629" }, { "database": "PubMed", "id": "16872509", "url": "https://pubmed.ncbi.nlm.nih.gov/16872509" }, { "database": "PubMed", "id": "17190838", "url": "https://pubmed.ncbi.nlm.nih.gov/17190838" }, { "database": "PubMed", "id": "17220321", "url": "https://pubmed.ncbi.nlm.nih.gov/17220321" }, { "database": "PubMed", "id": "17287469", "url": "https://pubmed.ncbi.nlm.nih.gov/17287469" }, { "database": "PubMed", "id": "17339838", "url": "https://pubmed.ncbi.nlm.nih.gov/17339838" }, { "database": "PubMed", "id": "17371830", "url": "https://pubmed.ncbi.nlm.nih.gov/17371830" }, { "database": "PubMed", "id": "17924178", "url": "https://pubmed.ncbi.nlm.nih.gov/17924178" }, { "database": "PubMed", "id": "17967879", "url": "https://pubmed.ncbi.nlm.nih.gov/17967879" }, { "database": "PubMed", "id": "17977562", "url": "https://pubmed.ncbi.nlm.nih.gov/17977562" }, { "database": "PubMed", "id": "18171481", "url": "https://pubmed.ncbi.nlm.nih.gov/18171481" }, { "database": "PubMed", "id": "18177853", "url": "https://pubmed.ncbi.nlm.nih.gov/18177853" }, { "database": "PubMed", "id": "18332223", "url": "https://pubmed.ncbi.nlm.nih.gov/18332223" }, { "database": "PubMed", "id": "18757368", "url": "https://pubmed.ncbi.nlm.nih.gov/18757368" }, { "database": "PubMed", "id": "18952837", "url": "https://pubmed.ncbi.nlm.nih.gov/18952837" }, { "database": "PubMed", "id": "19047061", "url": "https://pubmed.ncbi.nlm.nih.gov/19047061" }, { "database": "PubMed", "id": "19065678", "url": "https://pubmed.ncbi.nlm.nih.gov/19065678" }, { "database": "PubMed", "id": "19077278", "url": "https://pubmed.ncbi.nlm.nih.gov/19077278" }, { "database": "PubMed", "id": "19369943", "url": "https://pubmed.ncbi.nlm.nih.gov/19369943" }, { "database": "PubMed", "id": "19432987", "url": "https://pubmed.ncbi.nlm.nih.gov/19432987" }, { "database": "PubMed", "id": "19587782", "url": "https://pubmed.ncbi.nlm.nih.gov/19587782" }, { "database": "PubMed", "id": "19627269", "url": "https://pubmed.ncbi.nlm.nih.gov/19627269" }, { "database": "PubMed", "id": "19657063", "url": "https://pubmed.ncbi.nlm.nih.gov/19657063" }, { "database": "PubMed", "id": "19731018", "url": "https://pubmed.ncbi.nlm.nih.gov/19731018" }, { "database": "PubMed", "id": "19761823", "url": "https://pubmed.ncbi.nlm.nih.gov/19761823" }, { "database": "PubMed", "id": "19761830", "url": "https://pubmed.ncbi.nlm.nih.gov/19761830" }, { "database": "PubMed", "id": "19844585", "url": "https://pubmed.ncbi.nlm.nih.gov/19844585" }, { "database": "PubMed", "id": "20028942", "url": "https://pubmed.ncbi.nlm.nih.gov/20028942" }, { "database": "PubMed", "id": "20103705", "url": "https://pubmed.ncbi.nlm.nih.gov/20103705" }, { "database": "PubMed", "id": "20179753", "url": "https://pubmed.ncbi.nlm.nih.gov/20179753" }, { "database": "PubMed", "id": "20188786", "url": "https://pubmed.ncbi.nlm.nih.gov/20188786" }, { "database": "PubMed", "id": "20333297", "url": "https://pubmed.ncbi.nlm.nih.gov/20333297" }, { "database": "PubMed", "id": "20363892", "url": "https://pubmed.ncbi.nlm.nih.gov/20363892" }, { "database": "PubMed", "id": "20386333", "url": "https://pubmed.ncbi.nlm.nih.gov/20386333" }, { "database": "PubMed", "id": "20586915", "url": "https://pubmed.ncbi.nlm.nih.gov/20586915" }, { "database": "PubMed", "id": "20587420", "url": "https://pubmed.ncbi.nlm.nih.gov/20587420" }, { "database": "PubMed", "id": "20622167", "url": "https://pubmed.ncbi.nlm.nih.gov/20622167" }, { "database": "PubMed", "id": "20661274", "url": "https://pubmed.ncbi.nlm.nih.gov/20661274" }, { "database": "PubMed", "id": "20719961", "url": "https://pubmed.ncbi.nlm.nih.gov/20719961" }, { "database": "PubMed", "id": "20847051", "url": "https://pubmed.ncbi.nlm.nih.gov/20847051" }, { "database": "PubMed", "id": "20971978", "url": "https://pubmed.ncbi.nlm.nih.gov/20971978" }, { "database": "PubMed", "id": "20976192", "url": "https://pubmed.ncbi.nlm.nih.gov/20976192" }, { "database": "PubMed", "id": "21266327", "url": "https://pubmed.ncbi.nlm.nih.gov/21266327" }, { "database": "PubMed", "id": "21571071", "url": "https://pubmed.ncbi.nlm.nih.gov/21571071" }, { "database": "PubMed", "id": "21642988", "url": "https://pubmed.ncbi.nlm.nih.gov/21642988" }, { "database": "PubMed", "id": "21655268", "url": "https://pubmed.ncbi.nlm.nih.gov/21655268" }, { "database": "PubMed", "id": "21670491", "url": "https://pubmed.ncbi.nlm.nih.gov/21670491" }, { "database": "PubMed", "id": "21859896", "url": "https://pubmed.ncbi.nlm.nih.gov/21859896" }, { "database": "PubMed", "id": "21906027", "url": "https://pubmed.ncbi.nlm.nih.gov/21906027" }, { "database": "PubMed", "id": "21926268", "url": "https://pubmed.ncbi.nlm.nih.gov/21926268" }, { "database": "PubMed", "id": "21927580", "url": "https://pubmed.ncbi.nlm.nih.gov/21927580" }, { "database": "PubMed", "id": "22019461", "url": "https://pubmed.ncbi.nlm.nih.gov/22019461" }, { "database": "PubMed", "id": "22028912", "url": "https://pubmed.ncbi.nlm.nih.gov/22028912" }, { "database": "PubMed", "id": "22117619", "url": "https://pubmed.ncbi.nlm.nih.gov/22117619" }, { "database": "PubMed", "id": "22132131", "url": "https://pubmed.ncbi.nlm.nih.gov/22132131" }, { "database": "PubMed", "id": "22184110", "url": "https://pubmed.ncbi.nlm.nih.gov/22184110" }, { "database": "PubMed", "id": "22218715", "url": "https://pubmed.ncbi.nlm.nih.gov/22218715" }, { "database": "PubMed", "id": "22253608", "url": "https://pubmed.ncbi.nlm.nih.gov/22253608" }, { "database": "PubMed", "id": "22359505", "url": "https://pubmed.ncbi.nlm.nih.gov/22359505" }, { "database": "PubMed", "id": "22403300", "url": "https://pubmed.ncbi.nlm.nih.gov/22403300" }, { "database": "PubMed", "id": "22412835", "url": "https://pubmed.ncbi.nlm.nih.gov/22412835" }, { "database": "PubMed", "id": "22412912", "url": "https://pubmed.ncbi.nlm.nih.gov/22412912" }, { "database": "PubMed", "id": "22418434", "url": "https://pubmed.ncbi.nlm.nih.gov/22418434" }, { "database": "PubMed", "id": "22428049", "url": "https://pubmed.ncbi.nlm.nih.gov/22428049" }, { "database": "PubMed", "id": "22476915", "url": "https://pubmed.ncbi.nlm.nih.gov/22476915" }, { "database": "PubMed", "id": "22496778", "url": "https://pubmed.ncbi.nlm.nih.gov/22496778" }, { "database": "PubMed", "id": "22586587", "url": "https://pubmed.ncbi.nlm.nih.gov/22586587" }, { "database": "PubMed", "id": "22606274", "url": "https://pubmed.ncbi.nlm.nih.gov/22606274" }, { "database": "PubMed", "id": "22652602", "url": "https://pubmed.ncbi.nlm.nih.gov/22652602" }, { "database": "PubMed", "id": "22685300", "url": "https://pubmed.ncbi.nlm.nih.gov/22685300" }, { "database": "PubMed", "id": "22693641", "url": "https://pubmed.ncbi.nlm.nih.gov/22693641" }, { "database": "PubMed", "id": "22710723", "url": "https://pubmed.ncbi.nlm.nih.gov/22710723" }, { "database": "PubMed", "id": "22733590", "url": "https://pubmed.ncbi.nlm.nih.gov/22733590" }, { "database": "PubMed", "id": "22773877", "url": "https://pubmed.ncbi.nlm.nih.gov/22773877" }, { "database": "PubMed", "id": "22792172", "url": "https://pubmed.ncbi.nlm.nih.gov/22792172" }, { "database": "PubMed", "id": "22832498", "url": "https://pubmed.ncbi.nlm.nih.gov/22832498" }, { "database": "PubMed", "id": "22933110", "url": "https://pubmed.ncbi.nlm.nih.gov/22933110" }, { "database": "PubMed", "id": "22941977", "url": "https://pubmed.ncbi.nlm.nih.gov/22941977" }, { "database": "PubMed", "id": "23029230", "url": "https://pubmed.ncbi.nlm.nih.gov/23029230" }, { "database": "PubMed", "id": "23049865", "url": "https://pubmed.ncbi.nlm.nih.gov/23049865" }, { "database": "PubMed", "id": "23071621", "url": "https://pubmed.ncbi.nlm.nih.gov/23071621" }, { "database": "PubMed", "id": "23239877", "url": "https://pubmed.ncbi.nlm.nih.gov/23239877" }, { "database": "PubMed", "id": "23251389", "url": "https://pubmed.ncbi.nlm.nih.gov/23251389" }, { "database": "PubMed", "id": "23251519", "url": "https://pubmed.ncbi.nlm.nih.gov/23251519" }, { "database": "PubMed", "id": "23275438", "url": "https://pubmed.ncbi.nlm.nih.gov/23275438" }, { "database": "PubMed", "id": "23311350", "url": "https://pubmed.ncbi.nlm.nih.gov/23311350" }, { "database": "PubMed", "id": "23386984", "url": "https://pubmed.ncbi.nlm.nih.gov/23386984" }, { "database": "PubMed", "id": "23390495", "url": "https://pubmed.ncbi.nlm.nih.gov/23390495" }, { "database": "PubMed", "id": "23444402", "url": "https://pubmed.ncbi.nlm.nih.gov/23444402" }, { "database": "PubMed", "id": "23451056", "url": "https://pubmed.ncbi.nlm.nih.gov/23451056" }, { "database": "PubMed", "id": "23469174", "url": "https://pubmed.ncbi.nlm.nih.gov/23469174" }, { "database": "PubMed", "id": "23493568", "url": "https://pubmed.ncbi.nlm.nih.gov/23493568" }, { "database": "PubMed", "id": "23554947", "url": "https://pubmed.ncbi.nlm.nih.gov/23554947" }, { "database": "PubMed", "id": "23593332", "url": "https://pubmed.ncbi.nlm.nih.gov/23593332" }, { "database": "PubMed", "id": "23622715", "url": "https://pubmed.ncbi.nlm.nih.gov/23622715" }, { "database": "PubMed", "id": "23671593", "url": "https://pubmed.ncbi.nlm.nih.gov/23671593" }, { "database": "PubMed", "id": "23716717", "url": "https://pubmed.ncbi.nlm.nih.gov/23716717" }, { "database": "PubMed", "id": "23750258", "url": "https://pubmed.ncbi.nlm.nih.gov/23750258" }, { "database": "PubMed", "id": "23874604", "url": "https://pubmed.ncbi.nlm.nih.gov/23874604" }, { "database": "PubMed", "id": "23907468", "url": "https://pubmed.ncbi.nlm.nih.gov/23907468" }, { "database": "PubMed", "id": "23935891", "url": "https://pubmed.ncbi.nlm.nih.gov/23935891" }, { "database": "PubMed", "id": "23940776", "url": "https://pubmed.ncbi.nlm.nih.gov/23940776" }, { "database": "PubMed", "id": "23964069", "url": "https://pubmed.ncbi.nlm.nih.gov/23964069" }, { "database": "PubMed", "id": "24068327", "url": "https://pubmed.ncbi.nlm.nih.gov/24068327" }, { "database": "PubMed", "id": "24068707", "url": "https://pubmed.ncbi.nlm.nih.gov/24068707" }, { "database": "PubMed", "id": "24101676", "url": "https://pubmed.ncbi.nlm.nih.gov/24101676" }, { "database": "PubMed", "id": "24116102", "url": "https://pubmed.ncbi.nlm.nih.gov/24116102" }, { "database": "PubMed", "id": "24126057", "url": "https://pubmed.ncbi.nlm.nih.gov/24126057" }, { "database": "PubMed", "id": "24150605", "url": "https://pubmed.ncbi.nlm.nih.gov/24150605" }, { "database": "PubMed", "id": "24156551", "url": "https://pubmed.ncbi.nlm.nih.gov/24156551" }, { "database": "PubMed", "id": "24280377", "url": "https://pubmed.ncbi.nlm.nih.gov/24280377" }, { "database": "PubMed", "id": "24280772", "url": "https://pubmed.ncbi.nlm.nih.gov/24280772" }, { "database": "PubMed", "id": "24286194", "url": "https://pubmed.ncbi.nlm.nih.gov/24286194" }, { "database": "PubMed", "id": "24340073", "url": "https://pubmed.ncbi.nlm.nih.gov/24340073" }, { "database": "PubMed", "id": "24349514", "url": "https://pubmed.ncbi.nlm.nih.gov/24349514" }, { "database": "PubMed", "id": "24351823", "url": "https://pubmed.ncbi.nlm.nih.gov/24351823" }, { "database": "PubMed", "id": "24434432", "url": "https://pubmed.ncbi.nlm.nih.gov/24434432" }, { "database": "PubMed", "id": "24435134", "url": "https://pubmed.ncbi.nlm.nih.gov/24435134" }, { "database": "PubMed", "id": "24505362", "url": "https://pubmed.ncbi.nlm.nih.gov/24505362" }, { "database": "PubMed", "id": "24621388", "url": "https://pubmed.ncbi.nlm.nih.gov/24621388" }, { "database": "PubMed", "id": "24647338", "url": "https://pubmed.ncbi.nlm.nih.gov/24647338" }, { "database": "PubMed", "id": "24649407", "url": "https://pubmed.ncbi.nlm.nih.gov/24649407" }, { "database": "PubMed", "id": "24662050", "url": "https://pubmed.ncbi.nlm.nih.gov/24662050" }, { "database": "PubMed", "id": "24670364", "url": "https://pubmed.ncbi.nlm.nih.gov/24670364" }, { "database": "PubMed", "id": "24670654", "url": "https://pubmed.ncbi.nlm.nih.gov/24670654" }, { "database": "PubMed", "id": "24722238", "url": "https://pubmed.ncbi.nlm.nih.gov/24722238" }, { "database": "PubMed", "id": "24734904", "url": "https://pubmed.ncbi.nlm.nih.gov/24734904" }, { "database": "PubMed", "id": "24740015", "url": "https://pubmed.ncbi.nlm.nih.gov/24740015" }, { "database": "PubMed", "id": "24775271", "url": "https://pubmed.ncbi.nlm.nih.gov/24775271" }, { "database": "PubMed", "id": "24810050", "url": "https://pubmed.ncbi.nlm.nih.gov/24810050" }, { "database": "PubMed", "id": "24944899", "url": "https://pubmed.ncbi.nlm.nih.gov/24944899" }, { "database": "PubMed", "id": "24945938", "url": "https://pubmed.ncbi.nlm.nih.gov/24945938" }, { "database": "PubMed", "id": "24967341", "url": "https://pubmed.ncbi.nlm.nih.gov/24967341" }, { "database": "PubMed", "id": "24987368", "url": "https://pubmed.ncbi.nlm.nih.gov/24987368" }, { "database": "PubMed", "id": "25056877", "url": "https://pubmed.ncbi.nlm.nih.gov/25056877" }, { "database": "PubMed", "id": "25084011", "url": "https://pubmed.ncbi.nlm.nih.gov/25084011" }, { "database": "PubMed", "id": "25132272", "url": "https://pubmed.ncbi.nlm.nih.gov/25132272" }, { "database": "PubMed", "id": "25162417", "url": "https://pubmed.ncbi.nlm.nih.gov/25162417" }, { "database": "PubMed", "id": "25214523", "url": "https://pubmed.ncbi.nlm.nih.gov/25214523" }, { "database": "PubMed", "id": "25221930", "url": "https://pubmed.ncbi.nlm.nih.gov/25221930" }, { "database": "PubMed", "id": "25332884", "url": "https://pubmed.ncbi.nlm.nih.gov/25332884" }, { "database": "PubMed", "id": "25336920", "url": "https://pubmed.ncbi.nlm.nih.gov/25336920" }, { "database": "PubMed", "id": "25377878", "url": "https://pubmed.ncbi.nlm.nih.gov/25377878" }, { "database": "PubMed", "id": "25379771", "url": "https://pubmed.ncbi.nlm.nih.gov/25379771" }, { "database": "PubMed", "id": "25394413", "url": "https://pubmed.ncbi.nlm.nih.gov/25394413" }, { "database": "PubMed", "id": "25398386", "url": "https://pubmed.ncbi.nlm.nih.gov/25398386" }, { "database": "PubMed", "id": "25415296", "url": "https://pubmed.ncbi.nlm.nih.gov/25415296" }, { "database": "PubMed", "id": "25463972", "url": "https://pubmed.ncbi.nlm.nih.gov/25463972" }, { "database": "PubMed", "id": "25531328", "url": "https://pubmed.ncbi.nlm.nih.gov/25531328" }, { "database": "PubMed", "id": "25546475", "url": "https://pubmed.ncbi.nlm.nih.gov/25546475" }, { "database": "PubMed", "id": "25558238", "url": "https://pubmed.ncbi.nlm.nih.gov/25558238" }, { "database": "PubMed", "id": "25568666", "url": "https://pubmed.ncbi.nlm.nih.gov/25568666" }, { "database": "PubMed", "id": "25594415", "url": "https://pubmed.ncbi.nlm.nih.gov/25594415" }, { "database": "PubMed", "id": "25606824", "url": "https://pubmed.ncbi.nlm.nih.gov/25606824" }, { "database": "PubMed", "id": "25646773", "url": "https://pubmed.ncbi.nlm.nih.gov/25646773" }, { "database": "PubMed", "id": "25752217", "url": "https://pubmed.ncbi.nlm.nih.gov/25752217" }, { "database": "PubMed", "id": "25780086", "url": "https://pubmed.ncbi.nlm.nih.gov/25780086" }, { "database": "PubMed", "id": "25790465", "url": "https://pubmed.ncbi.nlm.nih.gov/25790465" }, { "database": "PubMed", "id": "25799367", "url": "https://pubmed.ncbi.nlm.nih.gov/25799367" }, { "database": "PubMed", "id": "25808491", "url": "https://pubmed.ncbi.nlm.nih.gov/25808491" }, { "database": "PubMed", "id": "25826077", "url": "https://pubmed.ncbi.nlm.nih.gov/25826077" }, { "database": "PubMed", "id": "25826083", "url": "https://pubmed.ncbi.nlm.nih.gov/25826083" }, { "database": "PubMed", "id": "25853295", "url": "https://pubmed.ncbi.nlm.nih.gov/25853295" }, { "database": "PubMed", "id": "25880554", "url": "https://pubmed.ncbi.nlm.nih.gov/25880554" }, { "database": "PubMed", "id": "25888638", "url": "https://pubmed.ncbi.nlm.nih.gov/25888638" }, { "database": "PubMed", "id": "26121028", "url": "https://pubmed.ncbi.nlm.nih.gov/26121028" }, { "database": "PubMed", "id": "26249804", "url": "https://pubmed.ncbi.nlm.nih.gov/26249804" }, { "database": "PubMed", "id": "26263164", "url": "https://pubmed.ncbi.nlm.nih.gov/26263164" }, { "database": "PubMed", "id": "26278110", "url": "https://pubmed.ncbi.nlm.nih.gov/26278110" }, { "database": "PubMed", "id": "26412745", "url": "https://pubmed.ncbi.nlm.nih.gov/26412745" }, { "database": "PubMed", "id": "26438830", "url": "https://pubmed.ncbi.nlm.nih.gov/26438830" }, { "database": "PubMed", "id": "26491103", "url": "https://pubmed.ncbi.nlm.nih.gov/26491103" }, { "database": "PubMed", "id": "26503303", "url": "https://pubmed.ncbi.nlm.nih.gov/26503303" }, { "database": "PubMed", "id": "26503641", "url": "https://pubmed.ncbi.nlm.nih.gov/26503641" }, { "database": "PubMed", "id": "26553931", "url": "https://pubmed.ncbi.nlm.nih.gov/26553931" }, { "database": "PubMed", "id": "26554359", "url": "https://pubmed.ncbi.nlm.nih.gov/26554359" }, { "database": "PubMed", "id": "26687764", "url": "https://pubmed.ncbi.nlm.nih.gov/26687764" }, { "database": "PubMed", "id": "26720454", "url": "https://pubmed.ncbi.nlm.nih.gov/26720454" }, { "database": "PubMed", "id": "26743335", "url": "https://pubmed.ncbi.nlm.nih.gov/26743335" }, { "database": "PubMed", "id": "26809587", "url": "https://pubmed.ncbi.nlm.nih.gov/26809587" }, { "database": "PubMed", "id": "26813160", "url": "https://pubmed.ncbi.nlm.nih.gov/26813160" }, { "database": "PubMed", "id": "26872208", "url": "https://pubmed.ncbi.nlm.nih.gov/26872208" }, { "database": "PubMed", "id": "26876212", "url": "https://pubmed.ncbi.nlm.nih.gov/26876212" }, { "database": "PubMed", "id": "26880110", "url": "https://pubmed.ncbi.nlm.nih.gov/26880110" }, { "database": "PubMed", "id": "26909311", "url": "https://pubmed.ncbi.nlm.nih.gov/26909311" }, { "database": "PubMed", "id": "26928911", "url": "https://pubmed.ncbi.nlm.nih.gov/26928911" }, { "database": "PubMed", "id": "26959121", "url": "https://pubmed.ncbi.nlm.nih.gov/26959121" }, { "database": "PubMed", "id": "27000529", "url": "https://pubmed.ncbi.nlm.nih.gov/27000529" }, { "database": "PubMed", "id": "27001940", "url": "https://pubmed.ncbi.nlm.nih.gov/27001940" }, { "database": "PubMed", "id": "27009084", "url": "https://pubmed.ncbi.nlm.nih.gov/27009084" }, { "database": "PubMed", "id": "27070899", "url": "https://pubmed.ncbi.nlm.nih.gov/27070899" }, { "database": "PubMed", "id": "27099352", "url": "https://pubmed.ncbi.nlm.nih.gov/27099352" }, { "database": "PubMed", "id": "27127181", "url": "https://pubmed.ncbi.nlm.nih.gov/27127181" }, { "database": "PubMed", "id": "27167344", "url": "https://pubmed.ncbi.nlm.nih.gov/27167344" }, { "database": "PubMed", "id": "27176481", "url": "https://pubmed.ncbi.nlm.nih.gov/27176481" }, { "database": "PubMed", "id": "27197158", "url": "https://pubmed.ncbi.nlm.nih.gov/27197158" }, { "database": "PubMed", "id": "27226588", "url": "https://pubmed.ncbi.nlm.nih.gov/27226588" }, { "database": "PubMed", "id": "27248324", "url": "https://pubmed.ncbi.nlm.nih.gov/27248324" }, { "database": "PubMed", "id": "27253992", "url": "https://pubmed.ncbi.nlm.nih.gov/27253992" }, { "database": "PubMed", "id": "27257474", "url": "https://pubmed.ncbi.nlm.nih.gov/27257474" }, { "database": "PubMed", "id": "27344443", "url": "https://pubmed.ncbi.nlm.nih.gov/27344443" }, { "database": "PubMed", "id": "27384491", "url": "https://pubmed.ncbi.nlm.nih.gov/27384491" }, { "database": "PubMed", "id": "27412013", "url": "https://pubmed.ncbi.nlm.nih.gov/27412013" }, { "database": "PubMed", "id": "27477105", "url": "https://pubmed.ncbi.nlm.nih.gov/27477105" }, { "database": "PubMed", "id": "27485212", "url": "https://pubmed.ncbi.nlm.nih.gov/27485212" }, { "database": "PubMed", "id": "27534430", "url": "https://pubmed.ncbi.nlm.nih.gov/27534430" }, { "database": "PubMed", "id": "27542970", "url": "https://pubmed.ncbi.nlm.nih.gov/27542970" }, { "database": "PubMed", "id": "27689988", "url": "https://pubmed.ncbi.nlm.nih.gov/27689988" }, { "database": "PubMed", "id": "27734117", "url": "https://pubmed.ncbi.nlm.nih.gov/27734117" }, { "database": "PubMed", "id": "27765055", "url": "https://pubmed.ncbi.nlm.nih.gov/27765055" }, { "database": "PubMed", "id": "27876711", "url": "https://pubmed.ncbi.nlm.nih.gov/27876711" }, { "database": "PubMed", "id": "27893783", "url": "https://pubmed.ncbi.nlm.nih.gov/27893783" }, { "database": "PubMed", "id": "28018219", "url": "https://pubmed.ncbi.nlm.nih.gov/28018219" }, { "database": "PubMed", "id": "28086800", "url": "https://pubmed.ncbi.nlm.nih.gov/28086800" }, { "database": "PubMed", "id": "28123341", "url": "https://pubmed.ncbi.nlm.nih.gov/28123341" }, { "database": "PubMed", "id": "28123943", "url": "https://pubmed.ncbi.nlm.nih.gov/28123943" }, { "database": "PubMed", "id": "28152035", "url": "https://pubmed.ncbi.nlm.nih.gov/28152035" }, { "database": "PubMed", "id": "28209968", "url": "https://pubmed.ncbi.nlm.nih.gov/28209968" }, { "database": "PubMed", "id": "28225038", "url": "https://pubmed.ncbi.nlm.nih.gov/28225038" }, { "database": "PubMed", "id": "28243164", "url": "https://pubmed.ncbi.nlm.nih.gov/28243164" }, { "database": "PubMed", "id": "28264587", "url": "https://pubmed.ncbi.nlm.nih.gov/28264587" }, { "database": "PubMed", "id": "28294959", "url": "https://pubmed.ncbi.nlm.nih.gov/28294959" }, { "database": "PubMed", "id": "28322786", "url": "https://pubmed.ncbi.nlm.nih.gov/28322786" }, { "database": "PubMed", "id": "28346493", "url": "https://pubmed.ncbi.nlm.nih.gov/28346493" }, { "database": "PubMed", "id": "28350865", "url": "https://pubmed.ncbi.nlm.nih.gov/28350865" }, { "database": "PubMed", "id": "28368423", "url": "https://pubmed.ncbi.nlm.nih.gov/28368423" }, { "database": "PubMed", "id": "28386126", "url": "https://pubmed.ncbi.nlm.nih.gov/28386126" }, { "database": "PubMed", "id": "28395173", "url": "https://pubmed.ncbi.nlm.nih.gov/28395173" }, { "database": "PubMed", "id": "28424421", "url": "https://pubmed.ncbi.nlm.nih.gov/28424421" }, { "database": "PubMed", "id": "28426713", "url": "https://pubmed.ncbi.nlm.nih.gov/28426713" }, { "database": "PubMed", "id": "28440748", "url": "https://pubmed.ncbi.nlm.nih.gov/28440748" }, { "database": "PubMed", "id": "28560349", "url": "https://pubmed.ncbi.nlm.nih.gov/28560349" }, { "database": "PubMed", "id": "28591208", "url": "https://pubmed.ncbi.nlm.nih.gov/28591208" }, { "database": "PubMed", "id": "28665395", "url": "https://pubmed.ncbi.nlm.nih.gov/28665395" }, { "database": "PubMed", "id": "28759639", "url": "https://pubmed.ncbi.nlm.nih.gov/28759639" }, { "database": "PubMed", "id": "28821740", "url": "https://pubmed.ncbi.nlm.nih.gov/28821740" }, { "database": "PubMed", "id": "28874678", "url": "https://pubmed.ncbi.nlm.nih.gov/28874678" }, { "database": "PubMed", "id": "28875936", "url": "https://pubmed.ncbi.nlm.nih.gov/28875936" }, { "database": "PubMed", "id": "28878342", "url": "https://pubmed.ncbi.nlm.nih.gov/28878342" }, { "database": "PubMed", "id": "28883758", "url": "https://pubmed.ncbi.nlm.nih.gov/28883758" }, { "database": "PubMed", "id": "28933316", "url": "https://pubmed.ncbi.nlm.nih.gov/28933316" }, { "database": "PubMed", "id": "28987868", "url": "https://pubmed.ncbi.nlm.nih.gov/28987868" }, { "database": "PubMed", "id": "29057818", "url": "https://pubmed.ncbi.nlm.nih.gov/29057818" }, { "database": "PubMed", "id": "29109428", "url": "https://pubmed.ncbi.nlm.nih.gov/29109428" }, { "database": "PubMed", "id": "29118722", "url": "https://pubmed.ncbi.nlm.nih.gov/29118722" }, { "database": "PubMed", "id": "29121094", "url": "https://pubmed.ncbi.nlm.nih.gov/29121094" }, { "database": "PubMed", "id": "29159980", "url": "https://pubmed.ncbi.nlm.nih.gov/29159980" }, { "database": "PubMed", "id": "29180704", "url": "https://pubmed.ncbi.nlm.nih.gov/29180704" }, { "database": "PubMed", "id": "29184057", "url": "https://pubmed.ncbi.nlm.nih.gov/29184057" }, { "database": "PubMed", "id": "29241457", "url": "https://pubmed.ncbi.nlm.nih.gov/29241457" }, { "database": "PubMed", "id": "29311937", "url": "https://pubmed.ncbi.nlm.nih.gov/29311937" }, { "database": "PubMed", "id": "29358916", "url": "https://pubmed.ncbi.nlm.nih.gov/29358916" }, { "database": "PubMed", "id": "29433422", "url": "https://pubmed.ncbi.nlm.nih.gov/29433422" }, { "database": "PubMed", "id": "29453154", "url": "https://pubmed.ncbi.nlm.nih.gov/29453154" }, { "database": "PubMed", "id": "29472543", "url": "https://pubmed.ncbi.nlm.nih.gov/29472543" }, { "database": "PubMed", "id": "29487597", "url": "https://pubmed.ncbi.nlm.nih.gov/29487597" }, { "database": "PubMed", "id": "29494346", "url": "https://pubmed.ncbi.nlm.nih.gov/29494346" }, { "database": "PubMed", "id": "29500670", "url": "https://pubmed.ncbi.nlm.nih.gov/29500670" }, { "database": "PubMed", "id": "29535623", "url": "https://pubmed.ncbi.nlm.nih.gov/29535623" }, { "database": "PubMed", "id": "29560100", "url": "https://pubmed.ncbi.nlm.nih.gov/29560100" }, { "database": "PubMed", "id": "29662189", "url": "https://pubmed.ncbi.nlm.nih.gov/29662189" }, { "database": "PubMed", "id": "29700562", "url": "https://pubmed.ncbi.nlm.nih.gov/29700562" }, { "database": "PubMed", "id": "29725001", "url": "https://pubmed.ncbi.nlm.nih.gov/29725001" }, { "database": "PubMed", "id": "29769144", "url": "https://pubmed.ncbi.nlm.nih.gov/29769144" }, { "database": "PubMed", "id": "29853881", "url": "https://pubmed.ncbi.nlm.nih.gov/29853881" }, { "database": "PubMed", "id": "29855474", "url": "https://pubmed.ncbi.nlm.nih.gov/29855474" }, { "database": "PubMed", "id": "29860106", "url": "https://pubmed.ncbi.nlm.nih.gov/29860106" }, { "database": "PubMed", "id": "29867489", "url": "https://pubmed.ncbi.nlm.nih.gov/29867489" }, { "database": "PubMed", "id": "29872253", "url": "https://pubmed.ncbi.nlm.nih.gov/29872253" }, { "database": "PubMed", "id": "29920520", "url": "https://pubmed.ncbi.nlm.nih.gov/29920520" }, { "database": "PubMed", "id": "29930536", "url": "https://pubmed.ncbi.nlm.nih.gov/29930536" }, { "database": "PubMed", "id": "29962852", "url": "https://pubmed.ncbi.nlm.nih.gov/29962852" }, { "database": "PubMed", "id": "30018139", "url": "https://pubmed.ncbi.nlm.nih.gov/30018139" }, { "database": "PubMed", "id": "30065170", "url": "https://pubmed.ncbi.nlm.nih.gov/30065170" }, { "database": "PubMed", "id": "30103648", "url": "https://pubmed.ncbi.nlm.nih.gov/30103648" }, { "database": "PubMed", "id": "30211334", "url": "https://pubmed.ncbi.nlm.nih.gov/30211334" }, { "database": "PubMed", "id": "30237867", "url": "https://pubmed.ncbi.nlm.nih.gov/30237867" }, { "database": "PubMed", "id": "30279732", "url": "https://pubmed.ncbi.nlm.nih.gov/30279732" }, { "database": "PubMed", "id": "30384400", "url": "https://pubmed.ncbi.nlm.nih.gov/30384400" }, { "database": "PubMed", "id": "30391964", "url": "https://pubmed.ncbi.nlm.nih.gov/30391964" }, { "database": "PubMed", "id": "30413815", "url": "https://pubmed.ncbi.nlm.nih.gov/30413815" }, { "database": "PubMed", "id": "30429249", "url": "https://pubmed.ncbi.nlm.nih.gov/30429249" }, { "database": "PubMed", "id": "30442153", "url": "https://pubmed.ncbi.nlm.nih.gov/30442153" }, { "database": "PubMed", "id": "30578122", "url": "https://pubmed.ncbi.nlm.nih.gov/30578122" }, { "database": "PubMed", "id": "30635036", "url": "https://pubmed.ncbi.nlm.nih.gov/30635036" }, { "database": "PubMed", "id": "30696333", "url": "https://pubmed.ncbi.nlm.nih.gov/30696333" }, { "database": "PubMed", "id": "30823934", "url": "https://pubmed.ncbi.nlm.nih.gov/30823934" }, { "database": "PubMed", "id": "30988282", "url": "https://pubmed.ncbi.nlm.nih.gov/30988282" }, { "database": "PubMed", "id": "31112530", "url": "https://pubmed.ncbi.nlm.nih.gov/31112530" }, { "database": "PubMed", "id": "31141608", "url": "https://pubmed.ncbi.nlm.nih.gov/31141608" }, { "database": "PubMed", "id": "31182807", "url": "https://pubmed.ncbi.nlm.nih.gov/31182807" }, { "database": "PubMed", "id": "31246957", "url": "https://pubmed.ncbi.nlm.nih.gov/31246957" }, { "database": "PubMed", "id": "31307481", "url": "https://pubmed.ncbi.nlm.nih.gov/31307481" }, { "database": "PubMed", "id": "31337981", "url": "https://pubmed.ncbi.nlm.nih.gov/31337981" }, { "database": "PubMed", "id": "31398213", "url": "https://pubmed.ncbi.nlm.nih.gov/31398213" }, { "database": "PubMed", "id": "31399584", "url": "https://pubmed.ncbi.nlm.nih.gov/31399584" }, { "database": "PubMed", "id": "31420304", "url": "https://pubmed.ncbi.nlm.nih.gov/31420304" }, { "database": "PubMed", "id": "31470507", "url": "https://pubmed.ncbi.nlm.nih.gov/31470507" }, { "database": "PubMed", "id": "31474552", "url": "https://pubmed.ncbi.nlm.nih.gov/31474552" }, { "database": "PubMed", "id": "31534518", "url": "https://pubmed.ncbi.nlm.nih.gov/31534518" }, { "database": "PubMed", "id": "31570855", "url": "https://pubmed.ncbi.nlm.nih.gov/31570855" }, { "database": "PubMed", "id": "31614949", "url": "https://pubmed.ncbi.nlm.nih.gov/31614949" }, { "database": "PubMed", "id": "31652791", "url": "https://pubmed.ncbi.nlm.nih.gov/31652791" }, { "database": "PubMed", "id": "31767175", "url": "https://pubmed.ncbi.nlm.nih.gov/31767175" }, { "database": "PubMed", "id": "31767180", "url": "https://pubmed.ncbi.nlm.nih.gov/31767180" }, { "database": "PubMed", "id": "31918924", "url": "https://pubmed.ncbi.nlm.nih.gov/31918924" }, { "database": "PubMed", "id": "31924750", "url": "https://pubmed.ncbi.nlm.nih.gov/31924750" }, { "database": "PubMed", "id": "31949275", "url": "https://pubmed.ncbi.nlm.nih.gov/31949275" }, { "database": "PubMed", "id": "32046324", "url": "https://pubmed.ncbi.nlm.nih.gov/32046324" }, { "database": "PubMed", "id": "32075060", "url": "https://pubmed.ncbi.nlm.nih.gov/32075060" }, { "database": "PubMed", "id": "32101748", "url": "https://pubmed.ncbi.nlm.nih.gov/32101748" }, { "database": "PubMed", "id": "32153410", "url": "https://pubmed.ncbi.nlm.nih.gov/32153410" }, { "database": "PubMed", "id": "32163656", "url": "https://pubmed.ncbi.nlm.nih.gov/32163656" }, { "database": "PubMed", "id": "32194423", "url": "https://pubmed.ncbi.nlm.nih.gov/32194423" }, { "database": "PubMed", "id": "32312949", "url": "https://pubmed.ncbi.nlm.nih.gov/32312949" }, { "database": "PubMed", "id": "32366272", "url": "https://pubmed.ncbi.nlm.nih.gov/32366272" }, { "database": "PubMed", "id": "32373532", "url": "https://pubmed.ncbi.nlm.nih.gov/32373532" }, { "database": "PubMed", "id": "32422541", "url": "https://pubmed.ncbi.nlm.nih.gov/32422541" }, { "database": "PubMed", "id": "32483262", "url": "https://pubmed.ncbi.nlm.nih.gov/32483262" }, { "database": "PubMed", "id": "32493400", "url": "https://pubmed.ncbi.nlm.nih.gov/32493400" }, { "database": "PubMed", "id": "32518366", "url": "https://pubmed.ncbi.nlm.nih.gov/32518366" }, { "database": "PubMed", "id": "32566257", "url": "https://pubmed.ncbi.nlm.nih.gov/32566257" }, { "database": "PubMed", "id": "32641498", "url": "https://pubmed.ncbi.nlm.nih.gov/32641498" }, { "database": "PubMed", "id": "32728173", "url": "https://pubmed.ncbi.nlm.nih.gov/32728173" }, { "database": "PubMed", "id": "32783890", "url": "https://pubmed.ncbi.nlm.nih.gov/32783890" }, { "database": "PubMed", "id": "32796834", "url": "https://pubmed.ncbi.nlm.nih.gov/32796834" }, { "database": "PubMed", "id": "32859869", "url": "https://pubmed.ncbi.nlm.nih.gov/32859869" }, { "database": "PubMed", "id": "33012785", "url": "https://pubmed.ncbi.nlm.nih.gov/33012785" }, { "database": "PubMed", "id": "33038070", "url": "https://pubmed.ncbi.nlm.nih.gov/33038070" }, { "database": "PubMed", "id": "33071755", "url": "https://pubmed.ncbi.nlm.nih.gov/33071755" }, { "database": "PubMed", "id": "33177089", "url": "https://pubmed.ncbi.nlm.nih.gov/33177089" }, { "database": "PubMed", "id": "33184378", "url": "https://pubmed.ncbi.nlm.nih.gov/33184378" }, { "database": "PubMed", "id": "33184414", "url": "https://pubmed.ncbi.nlm.nih.gov/33184414" }, { "database": "PubMed", "id": "33210868", "url": "https://pubmed.ncbi.nlm.nih.gov/33210868" }, { "database": "PubMed", "id": "33214645", "url": "https://pubmed.ncbi.nlm.nih.gov/33214645" }, { "database": "PubMed", "id": "33226552", "url": "https://pubmed.ncbi.nlm.nih.gov/33226552" }, { "database": "PubMed", "id": "33275593", "url": "https://pubmed.ncbi.nlm.nih.gov/33275593" }, { "database": "PubMed", "id": "33348907", "url": "https://pubmed.ncbi.nlm.nih.gov/33348907" }, { "database": "PubMed", "id": "33413592", "url": "https://pubmed.ncbi.nlm.nih.gov/33413592" }, { "database": "PubMed", "id": "33414476", "url": "https://pubmed.ncbi.nlm.nih.gov/33414476" }, { "database": "PubMed", "id": "33435535", "url": "https://pubmed.ncbi.nlm.nih.gov/33435535" }, { "database": "PubMed", "id": "33486894", "url": "https://pubmed.ncbi.nlm.nih.gov/33486894" }, { "database": "PubMed", "id": "33500390", "url": "https://pubmed.ncbi.nlm.nih.gov/33500390" }, { "database": "PubMed", "id": "33595435", "url": "https://pubmed.ncbi.nlm.nih.gov/33595435" }, { "database": "PubMed", "id": "33629064", "url": "https://pubmed.ncbi.nlm.nih.gov/33629064" }, { "database": "PubMed", "id": "33633735", "url": "https://pubmed.ncbi.nlm.nih.gov/33633735" }, { "database": "PubMed", "id": "33649479", "url": "https://pubmed.ncbi.nlm.nih.gov/33649479" }, { "database": "PubMed", "id": "33669811", "url": "https://pubmed.ncbi.nlm.nih.gov/33669811" }, { "database": "PubMed", "id": "33869980", "url": "https://pubmed.ncbi.nlm.nih.gov/33869980" }, { "database": "PubMed", "id": "33897895", "url": "https://pubmed.ncbi.nlm.nih.gov/33897895" }, { "database": "PubMed", "id": "33931442", "url": "https://pubmed.ncbi.nlm.nih.gov/33931442" }, { "database": "PubMed", "id": "33941789", "url": "https://pubmed.ncbi.nlm.nih.gov/33941789" }, { "database": "PubMed", "id": "33993653", "url": "https://pubmed.ncbi.nlm.nih.gov/33993653" }, { "database": "PubMed", "id": "34366869", "url": "https://pubmed.ncbi.nlm.nih.gov/34366869" }, { "database": "PubMed", "id": "35122865", "url": "https://pubmed.ncbi.nlm.nih.gov/35122865" }, { "database": "PubMed", "id": "35224167", "url": "https://pubmed.ncbi.nlm.nih.gov/35224167" }, { "database": "PubMed", "id": "35477177", "url": "https://pubmed.ncbi.nlm.nih.gov/35477177" }, { "database": "PubMed", "id": "35748215", "url": "https://pubmed.ncbi.nlm.nih.gov/35748215" }, { "database": "PubMed", "id": "36148310", "url": "https://pubmed.ncbi.nlm.nih.gov/36148310" }, { "database": "PubMed", "id": "36198369", "url": "https://pubmed.ncbi.nlm.nih.gov/36198369" }, { "database": "PubMed", "id": "36297523", "url": "https://pubmed.ncbi.nlm.nih.gov/36297523" }, { "database": "PubMed", "id": "36405694", "url": "https://pubmed.ncbi.nlm.nih.gov/36405694" }, { "database": "PubMed", "id": "9927197", "url": "https://pubmed.ncbi.nlm.nih.gov/9927197" }, { "database": "PubMed", "id": "18288188", "url": "https://pubmed.ncbi.nlm.nih.gov/18288188" }, { "database": "PubMed", "id": "26359501", "url": "https://pubmed.ncbi.nlm.nih.gov/26359501" }, { "database": "PubMed", "id": "15753085", "url": "https://pubmed.ncbi.nlm.nih.gov/15753085" } ], "site_lbl": "Thr308", "uniprot_canonical_ac": "P31750-1" } ], "glycosylation": [ { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "evidence": [ { "id": "18288188", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/18288188" }, { "id": "P35569", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P35569" }, { "id": "11959983", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/11959983" }, { "id": "30031227", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30031227" }, { "id": "20018868", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/20018868" } ], "filter_code": "000000000000000000000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "P35569-1" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "evidence": [ { "id": "18288188", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/18288188" }, { "id": "P15208", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P15208" }, { "id": "33300544", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33300544" } ], "filter_code": "000000000000000000000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "P15208-1" } ], "record_id": "pubmed.18288188", "abstract": "", "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 4 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "glytoucan_ac" ] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 1 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "exact_sites", "count": 0 }, { "field": "fuzzy_sites", "count": 1 }, { "field": "fuzzy_o_linked_sites", "count": 1 }, { "field": "fuzzy_o_linked_glycan_sites", "count": 1 }, { "field": "fuzzy_o_linked_glycans", "count": 1 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "filter_code", "uniprot_canonical_ac" ] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 1 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "exact_sites", "count": 0 }, { "field": "fuzzy_sites", "count": 1 }, { "field": "fuzzy_o_linked_sites", "count": 1 }, { "field": "fuzzy_o_linked_glycan_sites", "count": 1 }, { "field": "fuzzy_o_linked_glycans", "count": 1 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "filter_code", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Glucose regulates mitochondrial motility via Milton modification by O-GlcNAc transferase.", "journal": "Cell", "date": "2014", "authors": "Pekkurnaz G, Trinidad JC, Wang X, Kong D, Schwarz TL", "reference": { "type": "PubMed", "id": "24995978", "url": "https://pubmed.ncbi.nlm.nih.gov/24995978" }, "referenced_glycans": [ { "glytoucan_ac": "G49108TO" } ], "referenced_proteins": [ { "uniprot_canonical_ac": "P56558-1", "protein_name": "UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit", "gene_name": "Ogt", "tax_name": "Rat" }, { "uniprot_canonical_ac": "Q7TSA0-1", "protein_name": "Mitochondrial Rho GTPase 2", "gene_name": "Rhot2", "tax_name": "Rat" }, { "uniprot_canonical_ac": "Q960V3-1", "protein_name": "Trafficking kinesin-binding protein milt", "gene_name": "milt", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q8IXI1-1", "protein_name": "Mitochondrial Rho GTPase 2", "gene_name": "RHOT2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8IXI2-1", "protein_name": "Mitochondrial Rho GTPase 1", "gene_name": "RHOT1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q07647-1", "protein_name": "Solute carrier family 2, facilitated glucose transporter member 3", "gene_name": "Slc2a3", "tax_name": "Rat" }, { "uniprot_canonical_ac": "Q2PQA9-1", "protein_name": "Kinesin-1 heavy chain", "gene_name": "Kif5b", "tax_name": "Rat" }, { "uniprot_canonical_ac": "Q6PD31-1", "protein_name": "Trafficking kinesin-binding protein 1", "gene_name": "Trak1", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "P33176-1", "protein_name": "Kinesin-1 heavy chain", "gene_name": "KIF5B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UPV9-1", "protein_name": "Trafficking kinesin-binding protein 1", "gene_name": "TRAK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15294-1", "protein_name": "UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit", "gene_name": "OGT", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q62277-1", "protein_name": "Synaptophysin", "gene_name": "Syp", "tax_name": "Mouse" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "P56558", "url": "https://www.uniprot.org/uniprotkb/P56558" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "mutagenesis": [ { "start_pos": 2, "end_pos": 129, "sequence_org": "ASSVGNVADSTGLAELAHREYQAGDFEAAERHCMQLWRQEPDNTGVLLLLSSIHFQCRRLDRSAHFSTLAIKQNPLLAEAYSNLGNVYKERGQLQEAIEHYRHALRLKPDFIDGYINLAAALVAAGDM", "sequence_mut": "", "comment": "Decreased ability to reduce neuronal mitochondrial motility in both anterograde and retrograde directions.", "evidence": [ { "database": "UniProtKB", "id": "P56558", "url": "https://www.uniprot.org/uniprotkb/P56558" }, { "database": "PubMed", "id": "24995978", "url": "https://pubmed.ncbi.nlm.nih.gov/24995978" } ], "uniprot_canonical_ac": "P56558-1" }, { "start_pos": 2, "end_pos": 248, "sequence_org": "ASSVGNVADSTGLAELAHREYQAGDFEAAERHCMQLWRQEPDNTGVLLLLSSIHFQCRRLDRSAHFSTLAIKQNPLLAEAYSNLGNVYKERGQLQEAIEHYRHALRLKPDFIDGYINLAAALVAAGDMEGAVQAYVSALQYNPDLYCVRSDLGNLLKALGRLEEAKACYLKAIETQPNFAVAWSNLGCVFNAQGEIWLAIHHFEKAVTLDPNFLDAYINLGNVLKEARIFDRAVAAYLRALSLSPNH", "sequence_mut": "", "comment": "Decreased TRAK1 O-glycosylation by this protein.", "evidence": [ { "database": "UniProtKB", "id": "P56558", "url": "https://www.uniprot.org/uniprotkb/P56558" }, { "database": "PubMed", "id": "24995978", "url": "https://pubmed.ncbi.nlm.nih.gov/24995978" } ], "uniprot_canonical_ac": "P56558-1" }, { "start_pos": 498, "end_pos": 498, "sequence_org": "H", "sequence_mut": "N", "comment": "Loss of glycosylation activity. Loss of ability to reduce mitochondrial motility.", "evidence": [ { "database": "UniProtKB", "id": "P56558", "url": "https://www.uniprot.org/uniprotkb/P56558" }, { "database": "PubMed", "id": "24995978", "url": "https://pubmed.ncbi.nlm.nih.gov/24995978" } ], "uniprot_canonical_ac": "P56558-1" }, { "start_pos": 447, "end_pos": 447, "sequence_org": "S", "sequence_mut": "A", "comment": "Reduced O-glycosylation of this protein.", "evidence": [ { "database": "UniProtKB", "id": "Q9UPV9", "url": "https://www.uniprot.org/uniprotkb/Q9UPV9" }, { "database": "PubMed", "id": "24995978", "url": "https://pubmed.ncbi.nlm.nih.gov/24995978" } ], "uniprot_canonical_ac": "Q9UPV9-1" }, { "start_pos": 658, "end_pos": 672, "sequence_org": "PGKCMSQTNSTFTFT", "sequence_mut": "", "comment": "Loss of interaction with OGT, but interacts with KIF5B and RHOT1/2 and is able to localize to mitochondria. Increased O-glycosylation of this protein by OGT.", "evidence": [ { "database": "UniProtKB", "id": "Q9UPV9", "url": "https://www.uniprot.org/uniprotkb/Q9UPV9" }, { "database": "PubMed", "id": "24995978", "url": "https://pubmed.ncbi.nlm.nih.gov/24995978" } ], "uniprot_canonical_ac": "Q9UPV9-1" }, { "start_pos": 829, "end_pos": 829, "sequence_org": "S", "sequence_mut": "A", "comment": "Reduced O-glycosylation of this protein; when associated with A-830.", "evidence": [ { "database": "UniProtKB", "id": "Q9UPV9", "url": "https://www.uniprot.org/uniprotkb/Q9UPV9" }, { "database": "PubMed", "id": "24995978", "url": "https://pubmed.ncbi.nlm.nih.gov/24995978" } ], "uniprot_canonical_ac": "Q9UPV9-1" }, { "start_pos": 830, "end_pos": 830, "sequence_org": "S", "sequence_mut": "A", "comment": "Reduced O-glycosylation of this protein; when associated with A-829.", "evidence": [ { "database": "UniProtKB", "id": "Q9UPV9", "url": "https://www.uniprot.org/uniprotkb/Q9UPV9" }, { "database": "PubMed", "id": "24995978", "url": "https://pubmed.ncbi.nlm.nih.gov/24995978" } ], "uniprot_canonical_ac": "Q9UPV9-1" }, { "start_pos": 938, "end_pos": 938, "sequence_org": "S", "sequence_mut": "A", "comment": "Reduced O-glycosylation of this protein.", "evidence": [ { "database": "UniProtKB", "id": "Q9UPV9", "url": "https://www.uniprot.org/uniprotkb/Q9UPV9" }, { "database": "PubMed", "id": "24995978", "url": "https://pubmed.ncbi.nlm.nih.gov/24995978" } ], "uniprot_canonical_ac": "Q9UPV9-1" } ], "glycosylation": [ { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 447, "start_aa": "Ser", "end_pos": 447, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser447", "evidence": [ { "id": "24995978", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24995978" }, { "id": "Q9UPV9", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=Q9UPV9" }, { "id": "28657654", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/28657654" }, { "id": "34019948", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34019948" }, { "id": "39302247", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/39302247" }, { "id": "12724313", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/12724313" }, { "id": "30620550", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30620550" }, { "id": "40136647", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/40136647" } ], "filter_code": "000000000000000100000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01101", "uniprot_canonical_ac": "Q9UPV9-1" }, { "glytoucan_ac": "", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "S", "relation": "attached", "comment": "O-linked (GlcNAc) serine;O-GlcNAcylation", "icn3d_view": {}, "start_pos": 447, "start_aa": "Ser", "end_pos": 447, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser447", "evidence": [ { "id": "Q9UPV9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/Q9UPV9#ptm_processing" }, { "id": "24995978", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24995978" } ], "filter_code": "000000000000000100000.00000001000000.00.01101", "uniprot_canonical_ac": "Q9UPV9-1" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 448, "start_aa": "Ser", "end_pos": 448, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser448", "evidence": [ { "id": "24995978", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24995978" }, { "id": "Q9UPV9", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=Q9UPV9" }, { "id": "28657654", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/28657654" }, { "id": "34019948", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34019948" }, { "id": "39302247", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/39302247" }, { "id": "12724313", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/12724313" }, { "id": "30620550", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30620550" }, { "id": "40136647", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/40136647" } ], "filter_code": "000000000000000100000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "Q9UPV9-1" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 452, "start_aa": "Ser", "end_pos": 452, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser452", "evidence": [ { "id": "24995978", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24995978" }, { "id": "Q9UPV9", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=Q9UPV9" }, { "id": "28657654", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/28657654" }, { "id": "34019948", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34019948" }, { "id": "39302247", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/39302247" }, { "id": "12724313", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/12724313" }, { "id": "30620550", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30620550" }, { "id": "40136647", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/40136647" } ], "filter_code": "000000000000000100000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "Q9UPV9-1" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 560, "start_aa": "Ser", "end_pos": 560, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser560", "evidence": [ { "id": "24995978", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24995978" }, { "id": "Q9UPV9", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=Q9UPV9" }, { "id": "28657654", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/28657654" }, { "id": "34019948", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34019948" }, { "id": "39302247", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/39302247" }, { "id": "12724313", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/12724313" }, { "id": "30620550", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30620550" }, { "id": "40136647", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/40136647" } ], "filter_code": "000000000000000100000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "Q9UPV9-1" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 563, "start_aa": "Ser", "end_pos": 563, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser563", "evidence": [ { "id": "24995978", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24995978" }, { "id": "Q9UPV9", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=Q9UPV9" }, { "id": "28657654", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/28657654" }, { "id": "34019948", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34019948" }, { "id": "39302247", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/39302247" }, { "id": "12724313", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/12724313" }, { "id": "30620550", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30620550" }, { "id": "40136647", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/40136647" } ], "filter_code": "000000000000000100000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "Q9UPV9-1" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 565, "start_aa": "Ser", "end_pos": 565, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser565", "evidence": [ { "id": "24995978", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24995978" }, { "id": "Q9UPV9", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=Q9UPV9" }, { "id": "28657654", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/28657654" }, { "id": "34019948", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34019948" }, { "id": "39302247", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/39302247" }, { "id": "12724313", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/12724313" }, { "id": "30620550", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30620550" }, { "id": "40136647", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/40136647" } ], "filter_code": "000000000000000100000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "Q9UPV9-1" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 566, "start_aa": "Ser", "end_pos": 566, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser566", "evidence": [ { "id": "24995978", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24995978" }, { "id": "Q9UPV9", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=Q9UPV9" }, { "id": "28657654", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/28657654" }, { "id": "34019948", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34019948" }, { "id": "39302247", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/39302247" }, { "id": "12724313", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/12724313" }, { "id": "30620550", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30620550" }, { "id": "40136647", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/40136647" } ], "filter_code": "000000000000000100000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "Q9UPV9-1" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 680, "start_aa": "Ser", "end_pos": 680, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser680", "evidence": [ { "id": "24995978", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24995978" }, { "id": "Q9UPV9", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=Q9UPV9" }, { "id": "28657654", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/28657654" }, { "id": "34019948", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34019948" }, { "id": "39302247", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/39302247" }, { "id": "12724313", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/12724313" }, { "id": "30620550", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30620550" }, { "id": "40136647", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/40136647" } ], "filter_code": "000000000000000100000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "Q9UPV9-1" }, { "glytoucan_ac": "", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "S", "relation": "attached", "comment": "O-linked (GlcNAc) serine;O-GlcNAcylation", "icn3d_view": {}, "start_pos": 680, "start_aa": "Ser", "end_pos": 680, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser680", "evidence": [ { "id": "Q9UPV9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/Q9UPV9#ptm_processing" }, { "id": "24995978", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24995978" } ], "filter_code": "000000000000000100000.00000001000000.00.01001", "uniprot_canonical_ac": "Q9UPV9-1" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 719, "start_aa": "Ser", "end_pos": 719, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser719", "evidence": [ { "id": "24995978", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24995978" }, { "id": "Q9UPV9", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=Q9UPV9" }, { "id": "28657654", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/28657654" }, { "id": "34019948", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34019948" }, { "id": "39302247", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/39302247" }, { "id": "12724313", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/12724313" }, { "id": "30620550", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30620550" }, { "id": "40136647", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/40136647" } ], "filter_code": "000000000000000100000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01011", "uniprot_canonical_ac": "Q9UPV9-1" }, { "glytoucan_ac": "", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "S", "relation": "attached", "comment": "O-linked (GlcNAc) serine;O-GlcNAcylation", "icn3d_view": {}, "start_pos": 719, "start_aa": "Ser", "end_pos": 719, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser719", "evidence": [ { "id": "Q9UPV9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/Q9UPV9#ptm_processing" }, { "id": "24995978", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24995978" } ], "filter_code": "000000000000000100000.00000001000000.00.01011", "uniprot_canonical_ac": "Q9UPV9-1" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 829, "start_aa": "Ser", "end_pos": 829, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser829", "evidence": [ { "id": "24995978", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24995978" }, { "id": "Q9UPV9", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=Q9UPV9" }, { "id": "28657654", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/28657654" }, { "id": "34019948", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34019948" }, { "id": "39302247", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/39302247" }, { "id": "12724313", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/12724313" }, { "id": "30620550", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30620550" }, { "id": "40136647", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/40136647" } ], "filter_code": "000000000000000100000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01101", "uniprot_canonical_ac": "Q9UPV9-1" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 830, "start_aa": "Ser", "end_pos": 830, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser830", "evidence": [ { "id": "24995978", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24995978" }, { "id": "Q9UPV9", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=Q9UPV9" }, { "id": "28657654", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/28657654" }, { "id": "34019948", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34019948" }, { "id": "39302247", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/39302247" }, { "id": "12724313", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/12724313" }, { "id": "30620550", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30620550" }, { "id": "40136647", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/40136647" }, { "id": "Q9UPV9", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/Q9UPV9" } ], "filter_code": "000000000000000100000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01101", "uniprot_canonical_ac": "Q9UPV9-1" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 903, "start_aa": "Ser", "end_pos": 903, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser903", "evidence": [ { "id": "24995978", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24995978" }, { "id": "Q9UPV9", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=Q9UPV9" }, { "id": "28657654", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/28657654" }, { "id": "34019948", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34019948" }, { "id": "39302247", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/39302247" }, { "id": "12724313", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/12724313" }, { "id": "30620550", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30620550" }, { "id": "40136647", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/40136647" }, { "id": "Q9UPV9", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/Q9UPV9" } ], "filter_code": "000000000000000100000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "Q9UPV9-1" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "T", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 935, "start_aa": "Thr", "end_pos": 935, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr935", "evidence": [ { "id": "24995978", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24995978" }, { "id": "Q9UPV9", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=Q9UPV9" }, { "id": "28657654", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/28657654" }, { "id": "34019948", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34019948" }, { "id": "39302247", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/39302247" }, { "id": "12724313", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/12724313" }, { "id": "30620550", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30620550" }, { "id": "40136647", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/40136647" }, { "id": "Q9UPV9", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/Q9UPV9" }, { "id": "32938750", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32938750" } ], "filter_code": "000000000000000010000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "Q9UPV9-1" }, { "glytoucan_ac": "", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "T", "relation": "attached", "comment": "O-linked (GlcNAc) threonine;O-GlcNAcylation", "icn3d_view": {}, "start_pos": 935, "start_aa": "Thr", "end_pos": 935, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr935", "evidence": [ { "id": "Q9UPV9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/Q9UPV9#ptm_processing" }, { "id": "24995978", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24995978" } ], "filter_code": "000000000000000010000.00000001000000.00.01001", "uniprot_canonical_ac": "Q9UPV9-1" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 938, "start_aa": "Ser", "end_pos": 938, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser938", "evidence": [ { "id": "24995978", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24995978" }, { "id": "Q9UPV9", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=Q9UPV9" }, { "id": "28657654", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/28657654" }, { "id": "34019948", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34019948" }, { "id": "39302247", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/39302247" }, { "id": "12724313", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/12724313" }, { "id": "30620550", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30620550" }, { "id": "40136647", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/40136647" } ], "filter_code": "000000000000000100000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01101", "uniprot_canonical_ac": "Q9UPV9-1" } ], "record_id": "pubmed.24995978", "abstract": "", "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 12 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "glytoucan_ac" ] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 18 }, { "field": "total_sites", "count": 14 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 14 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 14 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "exact_sites", "count": 14 }, { "field": "exact_o_linked_sites", "count": 14 }, { "field": "exact_o_linked_glycan_sites", "count": 14 }, { "field": "exact_o_linked_glycans", "count": 1 }, { "field": "fuzzy_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl", "filter_code", "uniprot_canonical_ac" ] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 4 }, { "field": "total_sites", "count": 4 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 4 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "exact_sites", "count": 4 }, { "field": "exact_o_linked_sites", "count": 4 }, { "field": "fuzzy_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl", "filter_code", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 14 }, { "field": "total_sites", "count": 14 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 14 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 14 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "exact_sites", "count": 14 }, { "field": "exact_o_linked_sites", "count": 14 }, { "field": "exact_o_linked_glycan_sites", "count": 14 }, { "field": "exact_o_linked_glycans", "count": 1 }, { "field": "fuzzy_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl", "filter_code", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Dynamic glycosylation of nuclear and cytosolic proteins. Cloning and characterization of a unique O-GlcNAc transferase with multiple tetratricopeptide repeats.", "journal": "The Journal of biological chemistry", "date": "1997", "authors": "Kreppel LK, Blomberg MA, Hart GW", "reference": { "type": "PubMed", "id": "9083067", "url": "https://pubmed.ncbi.nlm.nih.gov/9083067" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P56558-1", "protein_name": "UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit", "gene_name": "Ogt", "tax_name": "Rat" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "P56558", "url": "https://www.uniprot.org/uniprotkb/P56558" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "phosphorylation": [ { "start_pos": 979, "end_pos": 979, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "Phosphotyrosine", "evidence": [ { "database": "UniProtKB", "id": "P56558", "url": "https://www.uniprot.org/uniprotkb/P56558" }, { "database": "PubMed", "id": "9083067", "url": "https://pubmed.ncbi.nlm.nih.gov/9083067" }, { "database": "iPTMnet", "id": "P56558", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P56558" } ], "site_lbl": "Tyr979", "uniprot_canonical_ac": "P56558-1" } ], "record_id": "pubmed.9083067", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Differential regulation of the renal sodium-phosphate cotransporters NaPi-IIa, NaPi-IIc, and PiT-2 in dietary potassium deficiency.", "journal": "American journal of physiology. Renal physiology", "date": "2009", "authors": "Breusegem SY, Takahashi H, Giral-Arnal H, Wang X, Jiang T, Verlander JW, Wilson P, Miyazaki-Anzai S, Sutherland E, Caldas Y, Blaine JT, Segawa H, Miyamoto K, Barry NP, Levi M", "reference": { "type": "PubMed", "id": "19493963", "url": "https://pubmed.ncbi.nlm.nih.gov/19493963" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q8K4R8-1", "protein_name": "Sodium-dependent phosphate transport protein 2C", "gene_name": "Slc34a3", "tax_name": "Rat" }, { "uniprot_canonical_ac": "Q63488-1", "protein_name": "Sodium-dependent phosphate transporter 2", "gene_name": "Slc20a2", "tax_name": "Rat" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "Q8K4R8", "url": "https://www.uniprot.org/uniprotkb/Q8K4R8" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "record_id": "pubmed.19493963", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Compensatory regulation of the sodium/phosphate cotransporters NaPi-IIc (SCL34A3) and Pit-2 (SLC20A2) during Pi deprivation and acidosis.", "journal": "Pflugers Archiv : European journal of physiology", "date": "2010", "authors": "Villa-Bellosta R, Sorribas V", "reference": { "type": "PubMed", "id": "19841935", "url": "https://pubmed.ncbi.nlm.nih.gov/19841935" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q8K4R8-1", "protein_name": "Sodium-dependent phosphate transport protein 2C", "gene_name": "Slc34a3", "tax_name": "Rat" }, { "uniprot_canonical_ac": "Q63488-1", "protein_name": "Sodium-dependent phosphate transporter 2", "gene_name": "Slc20a2", "tax_name": "Rat" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "Q8K4R8", "url": "https://www.uniprot.org/uniprotkb/Q8K4R8" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "record_id": "pubmed.19841935", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Acute parathyroid hormone differentially regulates renal brush border membrane phosphate cotransporters.", "journal": "Pflugers Archiv : European journal of physiology", "date": "2010", "authors": "Picard N, Capuano P, Stange G, Mihailova M, Kaissling B, Murer H, Biber J, Wagner CA", "reference": { "type": "PubMed", "id": "20526720", "url": "https://pubmed.ncbi.nlm.nih.gov/20526720" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q8K4R8-1", "protein_name": "Sodium-dependent phosphate transport protein 2C", "gene_name": "Slc34a3", "tax_name": "Rat" }, { "uniprot_canonical_ac": "Q63488-1", "protein_name": "Sodium-dependent phosphate transporter 2", "gene_name": "Slc20a2", "tax_name": "Rat" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "Q8K4R8", "url": "https://www.uniprot.org/uniprotkb/Q8K4R8" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "record_id": "pubmed.20526720", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Magnesium deficiency regulates vitamin D metabolizing enzymes and type II sodium-phosphate cotransporter mRNA expression in rats.", "journal": "Magnesium research", "date": "2013", "authors": "Matsuzaki H, Katsumata S, Kajita Y, Miwa M", "reference": { "type": "PubMed", "id": "23816829", "url": "https://pubmed.ncbi.nlm.nih.gov/23816829" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q8K4R8-1", "protein_name": "Sodium-dependent phosphate transport protein 2C", "gene_name": "Slc34a3", "tax_name": "Rat" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "Q8K4R8", "url": "https://www.uniprot.org/uniprotkb/Q8K4R8" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "record_id": "pubmed.23816829", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Differences in expression, actions and cocaine regulation of two isoforms for the brain transcriptional regulator NAC1.", "journal": "Neuroscience", "date": "2002", "authors": "Korutla L, Wang PJ, Lewis DM, Neustadter JH, Stromberg MF, Mackler SA", "reference": { "type": "PubMed", "id": "11906783", "url": "https://pubmed.ncbi.nlm.nih.gov/11906783" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O35260-1", "protein_name": "Nucleus accumbens-associated protein 1", "gene_name": "Nacc1", "tax_name": "Rat" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "O35260", "url": "https://www.uniprot.org/uniprotkb/O35260" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "record_id": "pubmed.11906783", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "NAC1, a POZ/BTB protein present in the adult mammalian brain, triggers apoptosis after adenovirus-mediated overexpression in PC-12 cells.", "journal": "Neuroscience research", "date": "2003", "authors": "Korutla L, Neustadter JH, Fournier KM, Mackler SA", "reference": { "type": "PubMed", "id": "12725910", "url": "https://pubmed.ncbi.nlm.nih.gov/12725910" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O35260-1", "protein_name": "Nucleus accumbens-associated protein 1", "gene_name": "Nacc1", "tax_name": "Rat" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "O35260", "url": "https://www.uniprot.org/uniprotkb/O35260" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "record_id": "pubmed.12725910", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The POZ/BTB protein NAC1 interacts with two different histone deacetylases in neuronal-like cultures.", "journal": "Journal of neurochemistry", "date": "2005-08", "authors": "Korutla L, Wang P J, Mackler S A", "reference": { "type": "PubMed", "id": "16033423", "url": "https://pubmed.ncbi.nlm.nih.gov/16033423" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O35260-1", "protein_name": "Nucleus accumbens-associated protein 1", "gene_name": "Nacc1", "tax_name": "Rat" }, { "uniprot_canonical_ac": "Q99P99-1", "protein_name": "Histone deacetylase 4", "gene_name": "Hdac4", "tax_name": "Rat" }, { "uniprot_canonical_ac": "Q6P6W3-1", "protein_name": "Histone deacetylase 3", "gene_name": "Hdac3", "tax_name": "Rat" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "O35260", "url": "https://www.uniprot.org/uniprotkb/O35260" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "record_id": "pubmed.16033423", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Activity-dependent subcellular localization of NAC1.", "journal": "The European journal of neuroscience", "date": "2005", "authors": "Korutla L, Champtiaux N, Shen HW, Klugmann M, Kalivas PW, Mackler SA", "reference": { "type": "PubMed", "id": "16045493", "url": "https://pubmed.ncbi.nlm.nih.gov/16045493" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O35260-1", "protein_name": "Nucleus accumbens-associated protein 1", "gene_name": "Nacc1", "tax_name": "Rat" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "O35260", "url": "https://www.uniprot.org/uniprotkb/O35260" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "phosphorylation": [ { "start_pos": 245, "end_pos": 245, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by PKC", "evidence": [ { "database": "UniProtKB", "id": "O35260", "url": "https://www.uniprot.org/uniprotkb/O35260" }, { "database": "iPTMnet", "id": "O35260", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O35260" }, { "database": "PubMed", "id": "16045493", "url": "https://pubmed.ncbi.nlm.nih.gov/16045493" } ], "site_lbl": "Ser245", "uniprot_canonical_ac": "O35260-1" } ], "record_id": "pubmed.16045493", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "NAC1, a cocaine-regulated POZ/BTB protein interacts with CoREST.", "journal": "Journal of neurochemistry", "date": "2007", "authors": "Korutla L, Degnan R, Wang P, Mackler SA", "reference": { "type": "PubMed", "id": "17254023", "url": "https://pubmed.ncbi.nlm.nih.gov/17254023" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O35260-1", "protein_name": "Nucleus accumbens-associated protein 1", "gene_name": "Nacc1", "tax_name": "Rat" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "O35260", "url": "https://www.uniprot.org/uniprotkb/O35260" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "mutagenesis": [ { "start_pos": 23, "end_pos": 23, "sequence_org": "Q", "sequence_mut": "L", "comment": "Abrogates transcriptional repression.", "evidence": [ { "database": "UniProtKB", "id": "O35260", "url": "https://www.uniprot.org/uniprotkb/O35260" }, { "database": "PubMed", "id": "17254023", "url": "https://pubmed.ncbi.nlm.nih.gov/17254023" } ], "uniprot_canonical_ac": "O35260-1" } ], "record_id": "pubmed.17254023", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "NAC1 regulates the recruitment of the proteasome complex into dendritic spines.", "journal": "The Journal of neuroscience : the official journal of the Society for Neuroscience", "date": "2007", "authors": "Shen H, Korutla L, Champtiaux N, Toda S, LaLumiere R, Vallone J, Klugmann M, Blendy JA, Mackler SA, Kalivas PW", "reference": { "type": "PubMed", "id": "17699672", "url": "https://pubmed.ncbi.nlm.nih.gov/17699672" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O35260-1", "protein_name": "Nucleus accumbens-associated protein 1", "gene_name": "Nacc1", "tax_name": "Rat" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "O35260", "url": "https://www.uniprot.org/uniprotkb/O35260" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "record_id": "pubmed.17699672", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "NAC-1, a rat brain mRNA, is increased in the nucleus accumbens three weeks after chronic cocaine self-administration.", "journal": "J. Neurosci.", "date": "1997", "authors": "Cha XY, Pierce RC, Kalivas PW, Mackler SA", "reference": { "type": "PubMed", "id": "9278521", "url": "https://pubmed.ncbi.nlm.nih.gov/9278521" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O35260-1", "protein_name": "Nucleus accumbens-associated protein 1", "gene_name": "Nacc1", "tax_name": "Rat" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "O35260", "url": "https://www.uniprot.org/uniprotkb/O35260" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "record_id": "pubmed.9278521", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Kinetic profile of the rat CYP4A isoforms: arachidonic acid metabolism and isoform-specific inhibitors.", "journal": "The American journal of physiology", "date": "1999", "authors": "Nguyen X, Wang MH, Reddy KM, Falck JR, Schwartzman ML", "reference": { "type": "PubMed", "id": "10362749", "url": "https://pubmed.ncbi.nlm.nih.gov/10362749" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P08516-1", "protein_name": "Cytochrome P450 4A10", "gene_name": "Cyp4a10", "tax_name": "Rat" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "P08516", "url": "https://www.uniprot.org/uniprotkb/P08516" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "record_id": "pubmed.10362749", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "A peroxisome proliferator-activated receptor-alpha activator induces renal CYP2C23 activity and protects from angiotensin II-induced renal injury.", "journal": "The American journal of pathology", "date": "2004-02", "authors": "Muller Dominik N, Theuer Juergen, Shagdarsuren Erdenechimeg, Kaergel Eva, Honeck Horst, Park Joon-Keun, Markovic Marija, Barbosa-Sicard Eduardo, Dechend Ralf, Wellner Maren, Kirsch Torsten, Fiebeler Anette, Rothe Michael, Haller Hermann, Luft Friedrich C, Schunck Wolf-Hagen", "reference": { "type": "PubMed", "id": "14742258", "url": "https://pubmed.ncbi.nlm.nih.gov/14742258" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P08516-1", "protein_name": "Cytochrome P450 4A10", "gene_name": "Cyp4a10", "tax_name": "Rat" }, { "uniprot_canonical_ac": "P24470-1", "protein_name": "Cytochrome P450 2C23", "gene_name": "Cyp2c23", "tax_name": "Rat" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "P08516", "url": "https://www.uniprot.org/uniprotkb/P08516" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "record_id": "pubmed.14742258", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Characterization of a cytochrome P450 from di(2-ethylhexyl) phthalate-treated rats which hydroxylates fatty acids.", "journal": "Arch. Biochem. Biophys.", "date": "1992", "authors": "Okita RT, Okita JR", "reference": { "type": "PubMed", "id": "1567203", "url": "https://pubmed.ncbi.nlm.nih.gov/1567203" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P08516-1", "protein_name": "Cytochrome P450 4A10", "gene_name": "Cyp4a10", "tax_name": "Rat" } ], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "P08516", "url": "https://www.uniprot.org/uniprotkb/P08516" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "record_id": "pubmed.1567203", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] } ]