[ { "title": "Targeted disruption of otog results in deafness and severe imbalance.", "journal": "Nature genetics", "date": "2000", "authors": "Simmler MC, Cohen-Salmon M, El-Amraoui A, Guillaud L, Benichou JC, Petit C, Panthier JJ", "reference": { "type": "PubMed", "id": "10655058", "url": "https://pubmed.ncbi.nlm.nih.gov/10655058" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O55225-1", "protein_name": "Otogelin", "gene_name": "Otog", "tax_name": "Mouse" } ], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "O55225", "url": "https://www.uniprot.org/uniprotkb/O55225" } ], "common_name": "Mouse", "glygen_name": "Mouse", "reference_species": "Mus musculus [10090]" } ], "record_id": "pubmed.10655058", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Spatiotemporal expression of otogelin in the developing and adult mouse inner ear.", "journal": "Hear. Res.", "date": "2001", "authors": "El-Amraoui A, Cohen-Salmon M, Petit C, Simmler M C", "reference": { "type": "PubMed", "id": "11506947", "url": "https://pubmed.ncbi.nlm.nih.gov/11506947" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O55225-1", "protein_name": "Otogelin", "gene_name": "Otog", "tax_name": "Mouse" } ], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "O55225", "url": "https://www.uniprot.org/uniprotkb/O55225" } ], "common_name": "Mouse", "glygen_name": "Mouse", "reference_species": "Mus musculus [10090]" } ], "record_id": "pubmed.11506947", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Otogelin, otogelin-like, and stereocilin form links connecting outer hair cell stereocilia to each other and the tectorial membrane.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2019", "authors": "Avan P, Le Gal S, Michel V, Dupont T, Hardelin JP, Petit C, Verpy E", "reference": { "type": "PubMed", "id": "31776257", "url": "https://pubmed.ncbi.nlm.nih.gov/31776257" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O55225-1", "protein_name": "Otogelin", "gene_name": "Otog", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "Q8VIM6-1", "protein_name": "Stereocilin", "gene_name": "Strc", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "F7A4A7-1", "protein_name": "Otogelin-like protein", "gene_name": "Otogl", "tax_name": "Mouse" } ], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "O55225", "url": "https://www.uniprot.org/uniprotkb/O55225" } ], "common_name": "Mouse", "glygen_name": "Mouse", "reference_species": "Mus musculus [10090]" } ], "record_id": "pubmed.31776257", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Otogelin: a glycoprotein specific to the acellular membranes of the inner ear.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1997", "authors": "Cohen-Salmon M, El-Amraoui A, Leibovici M, Petit C", "reference": { "type": "PubMed", "id": "9405633", "url": "https://pubmed.ncbi.nlm.nih.gov/9405633" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O55225-1", "protein_name": "Otogelin", "gene_name": "Otog", "tax_name": "Mouse" } ], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "O55225", "url": "https://www.uniprot.org/uniprotkb/O55225" } ], "common_name": "Mouse", "glygen_name": "Mouse", "reference_species": "Mus musculus [10090]" } ], "record_id": "pubmed.9405633", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "EHD proteins associate with syndapin I and II and such interactions play a crucial role in endosomal recycling.", "journal": "Mol. Biol. Cell", "date": "2005", "authors": "Braun A, Pinyol R, Dahlhaus R, Koch D, Fonarev P, Grant BD, Kessels MM, Qualmann B", "reference": { "type": "PubMed", "id": "15930129", "url": "https://pubmed.ncbi.nlm.nih.gov/15930129" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q61644-1", "protein_name": "Protein kinase C and casein kinase substrate in neurons protein 1", "gene_name": "Pacsin1", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "Q641Z6-1", "protein_name": "EH domain-containing protein 1", "gene_name": "Ehd1", "tax_name": "Rat" }, { "uniprot_canonical_ac": "Q8R491-1", "protein_name": "EH domain-containing protein 3", "gene_name": "Ehd3", "tax_name": "Rat" }, { "uniprot_canonical_ac": "Q9Z0W5-1", "protein_name": "Protein kinase C and casein kinase substrate in neurons protein 1", "gene_name": "Pacsin1", "tax_name": "Rat" }, { "uniprot_canonical_ac": "Q9WVE8-1", "protein_name": "Protein kinase C and casein kinase substrate in neurons protein 2", "gene_name": "Pacsin2", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "Q9EQP2-1", "protein_name": "EH domain-containing protein 4", "gene_name": "Ehd4", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "Q9QXY6-1", "protein_name": "EH domain-containing protein 3", "gene_name": "Ehd3", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "Q9WVK4-1", "protein_name": "EH domain-containing protein 1", "gene_name": "Ehd1", "tax_name": "Mouse" } ], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "Q61644", "url": "https://www.uniprot.org/uniprotkb/Q61644" } ], "common_name": "Mouse", "glygen_name": "Mouse", "reference_species": "Mus musculus [10090]" } ], "mutagenesis": [ { "start_pos": 485, "end_pos": 485, "sequence_org": "W", "sequence_mut": "A", "comment": "Abolishes interaction with PACSIN2.", "evidence": [ { "database": "UniProtKB", "id": "Q9WVK4", "url": "https://www.uniprot.org/uniprotkb/Q9WVK4" }, { "database": "PubMed", "id": "15930129", "url": "https://pubmed.ncbi.nlm.nih.gov/15930129" } ], "uniprot_canonical_ac": "Q9WVK4-1" }, { "start_pos": 65, "end_pos": 65, "sequence_org": "G", "sequence_mut": "R", "comment": "Abolishes interaction with PACSIN2.", "evidence": [ { "database": "UniProtKB", "id": "Q9WVK4", "url": "https://www.uniprot.org/uniprotkb/Q9WVK4" }, { "database": "PubMed", "id": "15930129", "url": "https://pubmed.ncbi.nlm.nih.gov/15930129" } ], "uniprot_canonical_ac": "Q9WVK4-1" } ], "record_id": "pubmed.15930129", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 8 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Molecular basis for SH3 domain regulation of F-BAR-mediated membrane deformation.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2010", "authors": "Rao Y, Ma Q, Vahedi-Faridi A, Sundborger A, Pechstein A, Puchkov D, Luo L, Shupliakov O, Saenger W, Haucke V", "reference": { "type": "PubMed", "id": "20404169", "url": "https://pubmed.ncbi.nlm.nih.gov/20404169" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q61644-1", "protein_name": "Protein kinase C and casein kinase substrate in neurons protein 1", "gene_name": "Pacsin1", "tax_name": "Mouse" } ], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "Q61644", "url": "https://www.uniprot.org/uniprotkb/Q61644" } ], "common_name": "Mouse", "glygen_name": "Mouse", "reference_species": "Mus musculus [10090]" } ], "mutagenesis": [ { "start_pos": 122, "end_pos": 123, "sequence_org": "IM", "sequence_mut": "FF", "comment": "Increases membrane tubulation.", "evidence": [ { "database": "UniProtKB", "id": "Q61644", "url": "https://www.uniprot.org/uniprotkb/Q61644" }, { "database": "PubMed", "id": "20404169", "url": "https://pubmed.ncbi.nlm.nih.gov/20404169" } ], "uniprot_canonical_ac": "Q61644-1" }, { "start_pos": 122, "end_pos": 123, "sequence_org": "IM", "sequence_mut": "QQ", "comment": "Abolishes membrane tubulation. No effect on phospholipid binding.", "evidence": [ { "database": "UniProtKB", "id": "Q61644", "url": "https://www.uniprot.org/uniprotkb/Q61644" }, { "database": "PubMed", "id": "20404169", "url": "https://pubmed.ncbi.nlm.nih.gov/20404169" } ], "uniprot_canonical_ac": "Q61644-1" }, { "start_pos": 127, "end_pos": 127, "sequence_org": "K", "sequence_mut": "E", "comment": "Abolishes membrane tubulation; when associated with E-130.", "evidence": [ { "database": "UniProtKB", "id": "Q61644", "url": "https://www.uniprot.org/uniprotkb/Q61644" }, { "database": "PubMed", "id": "20404169", "url": "https://pubmed.ncbi.nlm.nih.gov/20404169" } ], "uniprot_canonical_ac": "Q61644-1" }, { "start_pos": 130, "end_pos": 130, "sequence_org": "K", "sequence_mut": "E", "comment": "Abolishes membrane tubulation; when associated with E-127.", "evidence": [ { "database": "UniProtKB", "id": "Q61644", "url": "https://www.uniprot.org/uniprotkb/Q61644" }, { "database": "PubMed", "id": "20404169", "url": "https://pubmed.ncbi.nlm.nih.gov/20404169" } ], "uniprot_canonical_ac": "Q61644-1" }, { "start_pos": 145, "end_pos": 148, "sequence_org": "KKMK", "sequence_mut": "EEME", "comment": "Abolishes membrane tubulation.", "evidence": [ { "database": "UniProtKB", "id": "Q61644", "url": "https://www.uniprot.org/uniprotkb/Q61644" }, { "database": "PubMed", "id": "20404169", "url": "https://pubmed.ncbi.nlm.nih.gov/20404169" } ], "uniprot_canonical_ac": "Q61644-1" }, { "start_pos": 434, "end_pos": 434, "sequence_org": "P", "sequence_mut": "L", "comment": "Abolishes interaction with DNM1, MAPT, SYNJ1 and WASL.", "evidence": [ { "database": "UniProtKB", "id": "Q61644", "url": "https://www.uniprot.org/uniprotkb/Q61644" }, { "database": "PubMed", "id": "20404169", "url": "https://pubmed.ncbi.nlm.nih.gov/20404169" }, { "database": "PubMed", "id": "23035120", "url": "https://pubmed.ncbi.nlm.nih.gov/23035120" }, { "database": "PubMed", "id": "11082044", "url": "https://pubmed.ncbi.nlm.nih.gov/11082044" } ], "uniprot_canonical_ac": "Q61644-1" } ], "record_id": "pubmed.20404169", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Proper synaptic vesicle formation and neuronal network activity critically rely on syndapin I.", "journal": "The EMBO journal", "date": "2011-09-16", "authors": "Koch Dennis, Spiwoks-Becker Isabella, Sabanov Victor, Sinning Anne, Dugladze Tamar, Stellmacher Anne, Ahuja Rashmi, Grimm Julia, Sch\u00fcler Susann, M\u00fcller Anke, Angenstein Frank, Ahmed Tariq, Diesler Alexander, Moser Markus, Tom Dieck Susanne, Spessert Rainer, Boeckers Tobias Maria, F\u00e4ssler Reinhard, H\u00fcbner Christian Andreas, Balschun Detlef, Gloveli Tengis, Kessels Michael Manfred, Qualmann Britta", "reference": { "type": "PubMed", "id": "21926968", "url": "https://pubmed.ncbi.nlm.nih.gov/21926968" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q61644-1", "protein_name": "Protein kinase C and casein kinase substrate in neurons protein 1", "gene_name": "Pacsin1", "tax_name": "Mouse" } ], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "Q61644", "url": "https://www.uniprot.org/uniprotkb/Q61644" } ], "common_name": "Mouse", "glygen_name": "Mouse", "reference_species": "Mus musculus [10090]" } ], "record_id": "pubmed.21926968", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "PACSIN1, a Tau-interacting protein, regulates axonal elongation and branching by facilitating microtubule instability.", "journal": "The Journal of biological chemistry", "date": "2012", "authors": "Liu Y, Lv K, Li Z, Yu AC, Chen J, Teng J", "reference": { "type": "PubMed", "id": "23035120", "url": "https://pubmed.ncbi.nlm.nih.gov/23035120" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q61644-1", "protein_name": "Protein kinase C and casein kinase substrate in neurons protein 1", "gene_name": "Pacsin1", "tax_name": "Mouse" } ], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "Q61644", "url": "https://www.uniprot.org/uniprotkb/Q61644" } ], "common_name": "Mouse", "glygen_name": "Mouse", "reference_species": "Mus musculus [10090]" } ], "mutagenesis": [ { "start_pos": 434, "end_pos": 434, "sequence_org": "P", "sequence_mut": "L", "comment": "Abolishes interaction with DNM1, MAPT, SYNJ1 and WASL.", "evidence": [ { "database": "UniProtKB", "id": "Q61644", "url": "https://www.uniprot.org/uniprotkb/Q61644" }, { "database": "PubMed", "id": "20404169", "url": "https://pubmed.ncbi.nlm.nih.gov/20404169" }, { "database": "PubMed", "id": "23035120", "url": "https://pubmed.ncbi.nlm.nih.gov/23035120" }, { "database": "PubMed", "id": "11082044", "url": "https://pubmed.ncbi.nlm.nih.gov/11082044" } ], "uniprot_canonical_ac": "Q61644-1" } ], "record_id": "pubmed.23035120", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Substrate and inhibitor specificity of the type II p21-activated kinase, PAK6.", "journal": "PloS one", "date": "2013", "authors": "Gao J, Ha BH, Lou HJ, Morse EM, Zhang R, Calderwood DA, Turk BE, Boggon TJ", "reference": { "type": "PubMed", "id": "24204982", "url": "https://pubmed.ncbi.nlm.nih.gov/24204982" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q61644-1", "protein_name": "Protein kinase C and casein kinase substrate in neurons protein 1", "gene_name": "Pacsin1", "tax_name": "Mouse" } ], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "Q61644", "url": "https://www.uniprot.org/uniprotkb/Q61644" } ], "common_name": "Mouse", "glygen_name": "Mouse", "reference_species": "Mus musculus [10090]" } ], "phosphorylation": [ { "start_pos": 343, "end_pos": 343, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "Q61644", "url": "https://www.uniprot.org/uniprotkb/Q61644" }, { "database": "PubMed", "id": "21183079", "url": "https://pubmed.ncbi.nlm.nih.gov/21183079" }, { "database": "iPTMnet", "id": "Q61644", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q61644" }, { "database": "PubMed", "id": "24204982", "url": "https://pubmed.ncbi.nlm.nih.gov/24204982" } ], "site_lbl": "Ser343", "uniprot_canonical_ac": "Q61644-1" } ], "record_id": "pubmed.24204982", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "A de novo PACSIN1 gene variant found in childhood lupus reveals a role for PACSIN1-TRAF4 complex in TLR7 activation.", "journal": "Arthritis & rheumatology (Hoboken, N.J.)", "date": "2023-01-09", "authors": "Xie Chengmei, Zhou Haibo, Athanasopoulos Vicki, Shen Qian, Zhang Yaoyuan, Meng Xiangpeng, Burgio Gaetan, Arsov Todor, Lungu Adrian C, Zhang Pingjing, Qin Yuting, Ma Jiangyang, Wu Xiaoqian, Jiang Xiaoyue, Ding Huihua, Meng Yao, Shen Nan, He Yuke, Vinuesa Carola G", "reference": { "type": "PubMed", "id": "36622335", "url": "https://pubmed.ncbi.nlm.nih.gov/36622335" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q61644-1", "protein_name": "Protein kinase C and casein kinase substrate in neurons protein 1", "gene_name": "Pacsin1", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "Q61382-1", "protein_name": "TNF receptor-associated factor 4", "gene_name": "Traf4", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "Q9BY11-1", "protein_name": "Protein kinase C and casein kinase substrate in neurons protein 1", "gene_name": "PACSIN1", "tax_name": "Human" } ], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "Q61644", "url": "https://www.uniprot.org/uniprotkb/Q61644" } ], "common_name": "Mouse", "glygen_name": "Mouse", "reference_species": "Mus musculus [10090]" } ], "record_id": "pubmed.36622335", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "PACSIN, a brain protein that is upregulated upon differentiation into neuronal cells.", "journal": "Eur. J. Biochem.", "date": "1998", "authors": "Plomann M, Lange R, Vopper G, Cremer H, Heinlein UA, Scheff S, Baldwin SA, Leitges M, Cramer M, Paulsson M, Barthels D", "reference": { "type": "PubMed", "id": "9746365", "url": "https://pubmed.ncbi.nlm.nih.gov/9746365" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q61644-1", "protein_name": "Protein kinase C and casein kinase substrate in neurons protein 1", "gene_name": "Pacsin1", "tax_name": "Mouse" } ], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "Q61644", "url": "https://www.uniprot.org/uniprotkb/Q61644" } ], "common_name": "Mouse", "glygen_name": "Mouse", "reference_species": "Mus musculus [10090]" } ], "record_id": "pubmed.9746365", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "A new serine/threonine protein kinase, Omphk1, essential to ventral body wall formation.", "journal": "Dev. Dyn.", "date": "2006", "authors": "Hirano M, Kiyonari H, Inoue A, Furushima K, Murata T, Suda Y, Aizawa S", "reference": { "type": "PubMed", "id": "16715502", "url": "https://pubmed.ncbi.nlm.nih.gov/16715502" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q8BZN4-1", "protein_name": "NUAK family SNF1-like kinase 2", "gene_name": "Nuak2", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "Q641K5-1", "protein_name": "NUAK family SNF1-like kinase 1", "gene_name": "Nuak1", "tax_name": "Mouse" } ], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "Q8BZN4", "url": "https://www.uniprot.org/uniprotkb/Q8BZN4" } ], "common_name": "Mouse", "glygen_name": "Mouse", "reference_species": "Mus musculus [10090]" } ], "record_id": "pubmed.16715502", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Susceptibility of Snark-deficient mice to azoxymethane-induced colorectal tumorigenesis and the formation of aberrant crypt foci.", "journal": "Cancer science", "date": "2008", "authors": "Tsuchihara K, Ogura T, Fujioka R, Fujii S, Kuga W, Saito M, Ochiya T, Ochiai A, Esumi H", "reference": { "type": "PubMed", "id": "18307533", "url": "https://pubmed.ncbi.nlm.nih.gov/18307533" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q8BZN4-1", "protein_name": "NUAK family SNF1-like kinase 2", "gene_name": "Nuak2", "tax_name": "Mouse" } ], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "Q8BZN4", "url": "https://www.uniprot.org/uniprotkb/Q8BZN4" } ], "common_name": "Mouse", "glygen_name": "Mouse", "reference_species": "Mus musculus [10090]" } ], "record_id": "pubmed.18307533", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Sucrose nonfermenting AMPK-related kinase (SNARK) mediates contraction-stimulated glucose transport in mouse skeletal muscle.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2010", "authors": "Koh HJ, Toyoda T, Fujii N, Jung MM, Rathod A, Middelbeek RJ, Lessard SJ, Treebak JT, Tsuchihara K, Esumi H, Richter EA, Wojtaszewski JF, Hirshman MF, Goodyear LJ", "reference": { "type": "PubMed", "id": "20713714", "url": "https://pubmed.ncbi.nlm.nih.gov/20713714" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q8BZN4-1", "protein_name": "NUAK family SNF1-like kinase 2", "gene_name": "Nuak2", "tax_name": "Mouse" } ], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "Q8BZN4", "url": "https://www.uniprot.org/uniprotkb/Q8BZN4" } ], "common_name": "Mouse", "glygen_name": "Mouse", "reference_species": "Mus musculus [10090]" } ], "record_id": "pubmed.20713714", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The MicroRNA miR-696 is regulated by SNARK and reduces mitochondrial activity in mouse skeletal muscle through Pgc1alpha inhibition.", "journal": "Molecular metabolism", "date": "2021", "authors": "Queiroz AL, Lessard SJ, Ouchida AT, Araujo HN, Goncalves DA, Simoes Froes Guimaraes DSP, Teodoro BG, So K, Espreafico EM, Hirshman MF, Alberici LC, Kettelhut IDC, Goodyear LJ, Silveira LR", "reference": { "type": "PubMed", "id": "33812060", "url": "https://pubmed.ncbi.nlm.nih.gov/33812060" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q8BZN4-1", "protein_name": "NUAK family SNF1-like kinase 2", "gene_name": "Nuak2", "tax_name": "Mouse" } ], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "Q8BZN4", "url": "https://www.uniprot.org/uniprotkb/Q8BZN4" } ], "common_name": "Mouse", "glygen_name": "Mouse", "reference_species": "Mus musculus [10090]" } ], "record_id": "pubmed.33812060", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "NUAK2 and RCan2 participate in the p53 mutant pro-tumorigenic network.", "journal": "Biology direct", "date": "2021", "authors": "Mammarella E, Zampieri C, Panatta E, Melino G, Amelio I", "reference": { "type": "PubMed", "id": "34348766", "url": "https://pubmed.ncbi.nlm.nih.gov/34348766" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q8BZN4-1", "protein_name": "NUAK family SNF1-like kinase 2", "gene_name": "Nuak2", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "Q9JHG2-1", "protein_name": "Calcipressin-2", "gene_name": "Rcan2", "tax_name": "Mouse" } ], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "Q8BZN4", "url": "https://www.uniprot.org/uniprotkb/Q8BZN4" } ], "common_name": "Mouse", "glygen_name": "Mouse", "reference_species": "Mus musculus [10090]" } ], "record_id": "pubmed.34348766", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "GPR65 promotes intestinal mucosal Th1 and Th17 cell differentiation and gut inflammation through downregulating NUAK2.", "journal": "Clinical and translational medicine", "date": "2022", "authors": "Lin R, Wu W, Chen H, Gao H, Wu X, Li G, He Q, Lu H, Sun M, Liu Z", "reference": { "type": "PubMed", "id": "35343079", "url": "https://pubmed.ncbi.nlm.nih.gov/35343079" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q8BZN4-1", "protein_name": "NUAK family SNF1-like kinase 2", "gene_name": "Nuak2", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "Q9H093-1", "protein_name": "NUAK family SNF1-like kinase 2", "gene_name": "NUAK2", "tax_name": "Human" } ], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "Q8BZN4", "url": "https://www.uniprot.org/uniprotkb/Q8BZN4" } ], "common_name": "Mouse", "glygen_name": "Mouse", "reference_species": "Mus musculus [10090]" } ], "record_id": "pubmed.35343079", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Mitochondrial and nucleocytoplasmic isoforms of O-linked GlcNAc transferase encoded by a single mammalian gene.", "journal": "Arch. Biochem. Biophys.", "date": "2003", "authors": "Hanover JA, Yu S, Lubas WB, Shin SH, Ragano-Caracciola M, Kochran J, Love DC", "reference": { "type": "PubMed", "id": "12504895", "url": "https://pubmed.ncbi.nlm.nih.gov/12504895" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q8CGY8-1", "protein_name": "UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit", "gene_name": "Ogt", "tax_name": "Mouse" } ], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "Q8CGY8", "url": "https://www.uniprot.org/uniprotkb/Q8CGY8" } ], "common_name": "Mouse", "glygen_name": "Mouse", "reference_species": "Mus musculus [10090]" } ], "record_id": "pubmed.12504895", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Ataxin-10 interacts with O-GlcNAc transferase OGT in pancreatic beta cells.", "journal": "Biochem. Biophys. Res. Commun.", "date": "2005", "authors": "Andrali SS, Marz P, Ozcan S", "reference": { "type": "PubMed", "id": "16182253", "url": "https://pubmed.ncbi.nlm.nih.gov/16182253" }, "referenced_glycans": [ { "glytoucan_ac": "G49108TO" } ], "referenced_proteins": [ { "uniprot_canonical_ac": "Q8CGY8-1", "protein_name": "UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit", "gene_name": "Ogt", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "P28658-1", "protein_name": "Ataxin-10", "gene_name": "Atxn10", "tax_name": "Mouse" } ], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "Q8CGY8", "url": "https://www.uniprot.org/uniprotkb/Q8CGY8" } ], "common_name": "Mouse", "glygen_name": "Mouse", "reference_species": "Mus musculus [10090]" } ], "glycosylation": [ { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "evidence": [ { "id": "37507081", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37507081" }, { "id": "P28658", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P28658" }, { "id": "16182253", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/16182253" } ], "filter_code": "000000000000000000000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "P28658-1" } ], "record_id": "pubmed.16182253", "abstract": "", "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "glytoucan_ac" ] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 1 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "exact_sites", "count": 0 }, { "field": "fuzzy_sites", "count": 1 }, { "field": "fuzzy_o_linked_sites", "count": 1 }, { "field": "fuzzy_o_linked_glycan_sites", "count": 1 }, { "field": "fuzzy_o_linked_glycans", "count": 1 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "filter_code", "uniprot_canonical_ac" ] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 1 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "exact_sites", "count": 0 }, { "field": "fuzzy_sites", "count": 1 }, { "field": "fuzzy_o_linked_sites", "count": 1 }, { "field": "fuzzy_o_linked_glycan_sites", "count": 1 }, { "field": "fuzzy_o_linked_glycans", "count": 1 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "filter_code", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "O-GlcNAcylation of BMAL1 regulates circadian rhythms in NIH3T3 fibroblasts.", "journal": "Biochemical and biophysical research communications", "date": "2013", "authors": "Ma YT, Luo H, Guan WJ, Zhang H, Chen C, Wang Z, Li JD", "reference": { "type": "PubMed", "id": "23337503", "url": "https://pubmed.ncbi.nlm.nih.gov/23337503" }, "referenced_glycans": [ { "glytoucan_ac": "G49108TO" } ], "referenced_proteins": [ { "uniprot_canonical_ac": "Q8CGY8-1", "protein_name": "UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit", "gene_name": "Ogt", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "Q9EPW1-1", "protein_name": "Basic helix-loop-helix ARNT-like protein 1", "gene_name": "Bmal1", "tax_name": "Rat" }, { "uniprot_canonical_ac": "Q9WTL8-1", "protein_name": "Basic helix-loop-helix ARNT-like protein 1", "gene_name": "Bmal1", "tax_name": "Mouse" } ], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "Q8CGY8", "url": "https://www.uniprot.org/uniprotkb/Q8CGY8" } ], "common_name": "Mouse", "glygen_name": "Mouse", "reference_species": "Mus musculus [10090]" } ], "glycosylation": [ { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "evidence": [ { "id": "23337503", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23337503" }, { "id": "Q9EPW1", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=Q9EPW1" } ], "filter_code": "000000000000000000000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "Q9EPW1-1" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "evidence": [ { "id": "22069332", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/22069332" }, { "id": "Q9WTL8", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=Q9WTL8" }, { "id": "23337503", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23337503" } ], "filter_code": "000000000000000000000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "Q9WTL8-1" } ], "record_id": "pubmed.23337503", "abstract": "", "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "glytoucan_ac" ] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 1 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "exact_sites", "count": 0 }, { "field": "fuzzy_sites", "count": 1 }, { "field": "fuzzy_o_linked_sites", "count": 1 }, { "field": "fuzzy_o_linked_glycan_sites", "count": 1 }, { "field": "fuzzy_o_linked_glycans", "count": 1 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "filter_code", "uniprot_canonical_ac" ] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 1 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "exact_sites", "count": 0 }, { "field": "fuzzy_sites", "count": 1 }, { "field": "fuzzy_o_linked_sites", "count": 1 }, { "field": "fuzzy_o_linked_glycan_sites", "count": 1 }, { "field": "fuzzy_o_linked_glycans", "count": 1 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "filter_code", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Tet proteins connect the O-linked N-acetylglucosamine transferase Ogt to chromatin in embryonic stem cells.", "journal": "Mol. Cell", "date": "2013", "authors": "Vella P, Scelfo A, Jammula S, Chiacchiera F, Williams K, Cuomo A, Roberto A, Christensen J, Bonaldi T, Helin K, Pasini D", "reference": { "type": "PubMed", "id": "23352454", "url": "https://pubmed.ncbi.nlm.nih.gov/23352454" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q8CGY8-1", "protein_name": "UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit", "gene_name": "Ogt", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "Q4JK59-1", "protein_name": "Methylcytosine dioxygenase TET2", "gene_name": "Tet2", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "Q3URK3-1", "protein_name": "Methylcytosine dioxygenase TET1", "gene_name": "Tet1", "tax_name": "Mouse" } ], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "Q8CGY8", "url": "https://www.uniprot.org/uniprotkb/Q8CGY8" } ], "common_name": "Mouse", "glygen_name": "Mouse", "reference_species": "Mus musculus [10090]" } ], "record_id": "pubmed.23352454", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "O-GlcNAc signaling entrains the circadian clock by inhibiting BMAL1/CLOCK ubiquitination.", "journal": "Cell metabolism", "date": "2013", "authors": "Li MD, Ruan HB, Hughes ME, Lee JS, Singh JP, Jones SP, Nitabach MN, Yang X", "reference": { "type": "PubMed", "id": "23395176", "url": "https://pubmed.ncbi.nlm.nih.gov/23395176" }, "referenced_glycans": [ { "glytoucan_ac": "G49108TO" } ], "referenced_proteins": [ { "uniprot_canonical_ac": "Q8CGY8-1", "protein_name": "UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit", "gene_name": "Ogt", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "O08785-1", "protein_name": "Circadian locomoter output cycles protein kaput", "gene_name": "Clock", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "P47856-1", "protein_name": "Glutamine--fructose-6-phosphate aminotransferase [isomerizing] 1", "gene_name": "Gfpt1", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "O00327-2", "protein_name": "Basic helix-loop-helix ARNT-like protein 1", "gene_name": "BMAL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15516-1", "protein_name": "Circadian locomoter output cycles protein kaput", "gene_name": "CLOCK", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9WTL8-1", "protein_name": "Basic helix-loop-helix ARNT-like protein 1", "gene_name": "Bmal1", "tax_name": "Mouse" } ], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "Q8CGY8", "url": "https://www.uniprot.org/uniprotkb/Q8CGY8" } ], "common_name": "Mouse", "glygen_name": "Mouse", "reference_species": "Mus musculus [10090]" } ], "glycosylation": [ { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 418, "start_aa": "Ser", "end_pos": 418, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser418", "evidence": [ { "id": "23395176", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23395176" }, { "id": "O00327", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O00327" }, { "id": "40596516", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/40596516" }, { "id": "O00327", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/O00327" } ], "filter_code": "000000000000000100000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "O00327-2" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "T", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 711, "start_aa": "Thr", "end_pos": 711, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr711", "evidence": [ { "id": "23395176", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23395176" }, { "id": "O15516", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O15516" }, { "id": "28657654", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/28657654" }, { "id": "34019948", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34019948" }, { "id": "40596516", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/40596516" }, { "id": "35254053", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/35254053" }, { "id": "38665916", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/38665916" }, { "id": "O15516", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/O15516" } ], "filter_code": "000000000000000010000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "O15516-1" } ], "mutagenesis": [ { "start_pos": 418, "end_pos": 418, "sequence_org": "S", "sequence_mut": "A", "comment": "Decreases without abolishing O-GlcNAcylation.", "evidence": [ { "database": "UniProtKB", "id": "Q9WTL8", "url": "https://www.uniprot.org/uniprotkb/Q9WTL8" }, { "database": "PubMed", "id": "23395176", "url": "https://pubmed.ncbi.nlm.nih.gov/23395176" } ], "uniprot_canonical_ac": "Q9WTL8-1" } ], "record_id": "pubmed.23395176", "abstract": "", "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 6 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "glytoucan_ac" ] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 2 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 2 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "exact_sites", "count": 2 }, { "field": "exact_o_linked_sites", "count": 2 }, { "field": "exact_o_linked_glycan_sites", "count": 2 }, { "field": "exact_o_linked_glycans", "count": 1 }, { "field": "fuzzy_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl", "filter_code", "uniprot_canonical_ac" ] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 2 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 2 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "exact_sites", "count": 2 }, { "field": "exact_o_linked_sites", "count": 2 }, { "field": "exact_o_linked_glycan_sites", "count": 2 }, { "field": "exact_o_linked_glycans", "count": 1 }, { "field": "fuzzy_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl", "filter_code", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Cross-talk between two essential nutrient-sensitive enzymes: O-GlcNAc transferase (OGT) and AMP-activated protein kinase (AMPK).", "journal": "J. Biol. Chem.", "date": "2014", "authors": "Bullen JW, Balsbaugh JL, Chanda D, Shabanowitz J, Hunt DF, Neumann D, Hart GW", "reference": { "type": "PubMed", "id": "24563466", "url": "https://pubmed.ncbi.nlm.nih.gov/24563466" }, "referenced_glycans": [ { "glytoucan_ac": "G49108TO" } ], "referenced_proteins": [ { "uniprot_canonical_ac": "Q8CGY8-1", "protein_name": "UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit", "gene_name": "Ogt", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "Q9EQQ9-1", "protein_name": "Protein O-GlcNAcase", "gene_name": "Oga", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "Q9UGI9-1", "protein_name": "5'-AMP-activated protein kinase subunit gamma-3", "gene_name": "PRKAG3", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15294-1", "protein_name": "UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit", "gene_name": "OGT", "tax_name": "Human" }, { "uniprot_canonical_ac": "P54619-1", "protein_name": "5'-AMP-activated protein kinase subunit gamma-1", "gene_name": "PRKAG1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13131-1", "protein_name": "5'-AMP-activated protein kinase catalytic subunit alpha-1", "gene_name": "PRKAA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P54646-1", "protein_name": "5'-AMP-activated protein kinase catalytic subunit alpha-2", "gene_name": "PRKAA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UGJ0-1", "protein_name": "5'-AMP-activated protein kinase subunit gamma-2", "gene_name": "PRKAG2", "tax_name": "Human" } ], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "Q8CGY8", "url": "https://www.uniprot.org/uniprotkb/Q8CGY8" } ], "common_name": "Mouse", "glygen_name": "Mouse", "reference_species": "Mus musculus [10090]" } ], "glycosylation": [ { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "evidence": [ { "id": "24563466", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24563466" }, { "id": "Q9UGI9", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=Q9UGI9" } ], "filter_code": "000000000000000000000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "Q9UGI9-1" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "evidence": [ { "id": "24563466", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24563466" }, { "id": "P54619", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P54619" }, { "id": "40914422", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/40914422" }, { "id": "38665916", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/38665916" } ], "filter_code": "000000000000000000000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "P54619-1" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "evidence": [ { "id": "23301498", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23301498" }, { "id": "P54646", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P54646" }, { "id": "31489252", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/31489252" }, { "id": "24692660", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24692660" }, { "id": "24563466", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24563466" }, { "id": "28973823", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/28973823" }, { "id": "30637162", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30637162" }, { "id": "32174982", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32174982" } ], "filter_code": "000000000000000000000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "P54646-1" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "T", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 156, "start_aa": "Thr", "end_pos": 156, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr156", "evidence": [ { "id": "24563466", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24563466" }, { "id": "Q9UGJ0", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=Q9UGJ0" }, { "id": "30379171", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30379171" }, { "id": "38253038", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/38253038" } ], "filter_code": "000000000000000010000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "Q9UGJ0-1" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "T", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 165, "start_aa": "Thr", "end_pos": 165, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr165", "evidence": [ { "id": "24563466", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24563466" }, { "id": "Q9UGJ0", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=Q9UGJ0" }, { "id": "30379171", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30379171" }, { "id": "38253038", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/38253038" } ], "filter_code": "000000000000000010000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01011", "uniprot_canonical_ac": "Q9UGJ0-1" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "T", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 167, "start_aa": "Thr", "end_pos": 167, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr167", "evidence": [ { "id": "24563466", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24563466" }, { "id": "Q9UGJ0", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=Q9UGJ0" }, { "id": "30379171", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30379171" }, { "id": "38253038", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/38253038" } ], "filter_code": "000000000000000010000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01011", "uniprot_canonical_ac": "Q9UGJ0-1" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 16, "start_aa": "Ser", "end_pos": 16, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser16", "evidence": [ { "id": "24563466", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24563466" }, { "id": "Q9UGJ0", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=Q9UGJ0" }, { "id": "30379171", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30379171" }, { "id": "38253038", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/38253038" }, { "id": "Q9UGJ0", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/Q9UGJ0" } ], "filter_code": "000000000000000100000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "Q9UGJ0-1" } ], "mutagenesis": [ { "start_pos": 454, "end_pos": 454, "sequence_org": "T", "sequence_mut": "A", "comment": "Abolished phosphorylation by AMPK. Does not affect ability to regulate mTORC1.", "evidence": [ { "database": "UniProtKB", "id": "O15294", "url": "https://www.uniprot.org/uniprotkb/O15294" }, { "database": "PubMed", "id": "37541260", "url": "https://pubmed.ncbi.nlm.nih.gov/37541260" }, { "database": "PubMed", "id": "24563466", "url": "https://pubmed.ncbi.nlm.nih.gov/24563466" } ], "uniprot_canonical_ac": "O15294-1" }, { "start_pos": 454, "end_pos": 454, "sequence_org": "T", "sequence_mut": "E", "comment": "Affects substrate selectivity. Mimics phosphorylation; does not affect ability to regulate mTORC1.", "evidence": [ { "database": "UniProtKB", "id": "O15294", "url": "https://www.uniprot.org/uniprotkb/O15294" }, { "database": "PubMed", "id": "37541260", "url": "https://pubmed.ncbi.nlm.nih.gov/37541260" }, { "database": "PubMed", "id": "24563466", "url": "https://pubmed.ncbi.nlm.nih.gov/24563466" } ], "uniprot_canonical_ac": "O15294-1" } ], "phosphorylation": [ { "start_pos": 454, "end_pos": 454, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine; by AMPK", "evidence": [ { "database": "UniProtKB", "id": "O15294", "url": "https://www.uniprot.org/uniprotkb/O15294" }, { "database": "iPTMnet", "id": "O15294", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O15294" }, { "database": "PubMed", "id": "37541260", "url": "https://pubmed.ncbi.nlm.nih.gov/37541260" }, { "database": "PubMed", "id": "24563466", "url": "https://pubmed.ncbi.nlm.nih.gov/24563466" } ], "site_lbl": "Thr454", "uniprot_canonical_ac": "O15294-1" } ], "record_id": "pubmed.24563466", "abstract": "", "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 8 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "glytoucan_ac" ] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 7 }, { "field": "total_sites", "count": 5 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 5 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 5 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "exact_sites", "count": 4 }, { "field": "exact_o_linked_sites", "count": 4 }, { "field": "exact_o_linked_glycan_sites", "count": 4 }, { "field": "exact_o_linked_glycans", "count": 1 }, { "field": "fuzzy_sites", "count": 1 }, { "field": "fuzzy_o_linked_sites", "count": 1 }, { "field": "fuzzy_o_linked_glycan_sites", "count": 1 }, { "field": "fuzzy_o_linked_glycans", "count": 1 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "filter_code", "uniprot_canonical_ac", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 7 }, { "field": "total_sites", "count": 5 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 5 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 5 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "exact_sites", "count": 4 }, { "field": "exact_o_linked_sites", "count": 4 }, { "field": "exact_o_linked_glycan_sites", "count": 4 }, { "field": "exact_o_linked_glycans", "count": 1 }, { "field": "fuzzy_sites", "count": 1 }, { "field": "fuzzy_o_linked_sites", "count": 1 }, { "field": "fuzzy_o_linked_glycan_sites", "count": 1 }, { "field": "fuzzy_o_linked_glycans", "count": 1 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "filter_code", "uniprot_canonical_ac", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The O-GlcNAc transferase OGT interacts with and post-translationally modifies the transcription factor HOXA1.", "journal": "FEBS letters", "date": "2018", "authors": "Draime A, Bridoux L, Belpaire M, Pringels T, Degand H, Morsomme P, Rezsohazy R", "reference": { "type": "PubMed", "id": "29465778", "url": "https://pubmed.ncbi.nlm.nih.gov/29465778" }, "referenced_glycans": [ { "glytoucan_ac": "G49108TO" } ], "referenced_proteins": [ { "uniprot_canonical_ac": "Q8CGY8-1", "protein_name": "UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit", "gene_name": "Ogt", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "P09022-1", "protein_name": "Homeobox protein Hox-A1", "gene_name": "Hoxa1", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "O70477-1", "protein_name": "Homeobox protein PKNOX1", "gene_name": "Pknox1", "tax_name": "Mouse" } ], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "Q8CGY8", "url": "https://www.uniprot.org/uniprotkb/Q8CGY8" } ], "common_name": "Mouse", "glygen_name": "Mouse", "reference_species": "Mus musculus [10090]" } ], "mutagenesis": [ { "start_pos": 2, "end_pos": 473, "sequence_org": "ASSVGNVADSTEPTKRMLSFQGLAELAHREYQAGDFEAAERHCMQLWRQEPDNTGVLLLLSSIHFQCRRLDRSAHFSTLAIKQNPLLAEAYSNLGNVYKERGQLQEAIEHYRHALRLKPDFIDGYINLAAALVAAGDMEGAVQAYVSALQYNPDLYCVRSDLGNLLKALGRLEEAKACYLKAIETQPNFAVAWSNLGCVFNAQGEIWLAIHHFEKAVTLDPNFLDAYINLGNVLKEARIFDRAVAAYLRALSLSPNHAVVHGNLACVYYEQGLIDLAIDTYRRAIELQPHFPDAYCNLANALKEKGSVAEAEDCYNTALRLCPTHADSLNNLANIKREQGNIEEAVRLYRKALEVFPEFAAAHSNLASVLQQQGKLQEALMHYKEAIRISPTFADAYSNMGNTLKEMQDVQGALQCYTRAIQINPAFADAHSNLASIHKDSGNIPEAIASYRTALKLKPDFPDAYCNLAHCL", "sequence_mut": "", "comment": "Loss of interaction with HOXA1. Loss of glycosylation of HOXA1.", "evidence": [ { "database": "UniProtKB", "id": "Q8CGY8", "url": "https://www.uniprot.org/uniprotkb/Q8CGY8" }, { "database": "PubMed", "id": "29465778", "url": "https://pubmed.ncbi.nlm.nih.gov/29465778" } ], "uniprot_canonical_ac": "Q8CGY8-1" }, { "start_pos": 474, "end_pos": 1046, "sequence_org": "QIVCDWTDYDERMKKLVSIVAEQLEKNRLPSVHPHHSMLYPLSHGFRKAIAERHGNLCLDKINVLHKPPYEHPKDLKLSDGRLRVGYVSSDFGNHPTSHLMQSIPGMHNPDKFEVFCYALSPDDGTNFRVKVMAEANHFIDLSQIPCNGKAADRIHQDGIHILVNMNGYTKGARNELFALRPAPIQAMWLGYPGTSGALFMDYIITDQETSPAEVAEQYSEKLAYMPHTFFIGDHANMFPHLKKKAVIDFKSNGHIYDNRIVLNGIDLKAFLDSLPDVKIVKMKCPDGGDNPDSSNTALNMPVIPMNTIAEAVIEMINRGQIQITINGFSISNGLATTQINNKAATGEEVPRTIIVTTRSQYGLPEDAIVYCNFNQLYKIDPSTLQMWANILKRVPNSVLWLLRFPAVGEPNIQQYAQNMGLPQNRIIFSPVAPKEEHVRRGQLADVCLDTPLCNGHTTGMDVLWAGTPMVTMPGETLASRVAASQLTCLGCLELIAKSRQEYEDIAVKLGTDLEYLKKIRGKVWKQRISSPLFNTKQYTMELERLYLQMWEHYAAGNKPDHMIKPVEVTESA", "sequence_mut": "", "comment": "Interacts with HOXA1. Interaction is localized to the nucleus.", "evidence": [ { "database": "UniProtKB", "id": "Q8CGY8", "url": "https://www.uniprot.org/uniprotkb/Q8CGY8" }, { "database": "PubMed", "id": "29465778", "url": "https://pubmed.ncbi.nlm.nih.gov/29465778" } ], "uniprot_canonical_ac": "Q8CGY8-1" }, { "start_pos": 504, "end_pos": 1046, "sequence_org": "SVHPHHSMLYPLSHGFRKAIAERHGNLCLDKINVLHKPPYEHPKDLKLSDGRLRVGYVSSDFGNHPTSHLMQSIPGMHNPDKFEVFCYALSPDDGTNFRVKVMAEANHFIDLSQIPCNGKAADRIHQDGIHILVNMNGYTKGARNELFALRPAPIQAMWLGYPGTSGALFMDYIITDQETSPAEVAEQYSEKLAYMPHTFFIGDHANMFPHLKKKAVIDFKSNGHIYDNRIVLNGIDLKAFLDSLPDVKIVKMKCPDGGDNPDSSNTALNMPVIPMNTIAEAVIEMINRGQIQITINGFSISNGLATTQINNKAATGEEVPRTIIVTTRSQYGLPEDAIVYCNFNQLYKIDPSTLQMWANILKRVPNSVLWLLRFPAVGEPNIQQYAQNMGLPQNRIIFSPVAPKEEHVRRGQLADVCLDTPLCNGHTTGMDVLWAGTPMVTMPGETLASRVAASQLTCLGCLELIAKSRQEYEDIAVKLGTDLEYLKKIRGKVWKQRISSPLFNTKQYTMELERLYLQMWEHYAAGNKPDHMIKPVEVTESA", "sequence_mut": "", "comment": "Interacts with HOXA1. Interaction is localized to the nucleus.", "evidence": [ { "database": "UniProtKB", "id": "Q8CGY8", "url": "https://www.uniprot.org/uniprotkb/Q8CGY8" }, { "database": "PubMed", "id": "29465778", "url": "https://pubmed.ncbi.nlm.nih.gov/29465778" } ], "uniprot_canonical_ac": "Q8CGY8-1" }, { "start_pos": 991, "end_pos": 1046, "sequence_org": "KKIRGKVWKQRISSPLFNTKQYTMELERLYLQMWEHYAAGNKPDHMIKPVEVTESA", "sequence_mut": "", "comment": "Impaired interaction with HOXA1. Loss of glycosylation of HOXA1.", "evidence": [ { "database": "UniProtKB", "id": "Q8CGY8", "url": "https://www.uniprot.org/uniprotkb/Q8CGY8" }, { "database": "PubMed", "id": "29465778", "url": "https://pubmed.ncbi.nlm.nih.gov/29465778" } ], "uniprot_canonical_ac": "Q8CGY8-1" }, { "start_pos": 1, "end_pos": 224, "sequence_org": "MNSFLEYPILGSGDSGTCSARAYPSDHGITTFQSCAVSANSCGGDDRFLVGRGVQISSPHHHHHHHHHHHPQTATYQTSGNLGISYSHSSCGPSYGAQNFSAPYGPYGLNQEADVSGGYPPCAPAVYSGNLSTPMVQHHHHHQGYAGGTVGSPQYIHHSYGQEQQTLALATYNNSLSPLHASHQEACRSPASETSSPAQTFDWMKVKRNPPKTGKVGEYGYVGQ", "sequence_mut": "", "comment": "Loss of interaction with OGT.", "evidence": [ { "database": "UniProtKB", "id": "P09022", "url": "https://www.uniprot.org/uniprotkb/P09022" }, { "database": "PubMed", "id": "29465778", "url": "https://pubmed.ncbi.nlm.nih.gov/29465778" } ], "uniprot_canonical_ac": "P09022-1" }, { "start_pos": 1, "end_pos": 40, "sequence_org": "MNSFLEYPILGSGDSGTCSARAYPSDHGITTFQSCAVSAN", "sequence_mut": "", "comment": "Interacts with OGT.", "evidence": [ { "database": "UniProtKB", "id": "P09022", "url": "https://www.uniprot.org/uniprotkb/P09022" }, { "database": "PubMed", "id": "29465778", "url": "https://pubmed.ncbi.nlm.nih.gov/29465778" } ], "uniprot_canonical_ac": "P09022-1" }, { "start_pos": 203, "end_pos": 204, "sequence_org": "WM", "sequence_mut": "AA", "comment": "Interacts with OGT.", "evidence": [ { "database": "UniProtKB", "id": "P09022", "url": "https://www.uniprot.org/uniprotkb/P09022" }, { "database": "PubMed", "id": "29465778", "url": "https://pubmed.ncbi.nlm.nih.gov/29465778" } ], "uniprot_canonical_ac": "P09022-1" }, { "start_pos": 225, "end_pos": 284, "sequence_org": "PNAVRTNFTTKQLTELEKEFHFNKYLTRARRVEIAASLQLNETQVKIWFQNRRMKQKKRE", "sequence_mut": "", "comment": "Interacts with OGT.", "evidence": [ { "database": "UniProtKB", "id": "P09022", "url": "https://www.uniprot.org/uniprotkb/P09022" }, { "database": "PubMed", "id": "29465778", "url": "https://pubmed.ncbi.nlm.nih.gov/29465778" } ], "uniprot_canonical_ac": "P09022-1" }, { "start_pos": 272, "end_pos": 275, "sequence_org": "WFQN", "sequence_mut": "SVAA", "comment": "Interacts with OGT.", "evidence": [ { "database": "UniProtKB", "id": "P09022", "url": "https://www.uniprot.org/uniprotkb/P09022" }, { "database": "PubMed", "id": "29465778", "url": "https://pubmed.ncbi.nlm.nih.gov/29465778" } ], "uniprot_canonical_ac": "P09022-1" }, { "start_pos": 60, "end_pos": 142, "sequence_org": "HHHHHHHHHHHPQTATYQTSGNLGISYSHSSCGPSYGAQNFSAPYGPYGLNQEADVSGGYPPCAPAVYSGNLSTPMVQHHHHH", "sequence_mut": "", "comment": "Loss of interaction with OGT.", "evidence": [ { "database": "UniProtKB", "id": "P09022", "url": "https://www.uniprot.org/uniprotkb/P09022" }, { "database": "PubMed", "id": "29465778", "url": "https://pubmed.ncbi.nlm.nih.gov/29465778" } ], "uniprot_canonical_ac": "P09022-1" }, { "start_pos": 60, "end_pos": 70, "sequence_org": "HHHHHHHHHHH", "sequence_mut": "", "comment": "Loss of interaction with OGT.", "evidence": [ { "database": "UniProtKB", "id": "P09022", "url": "https://www.uniprot.org/uniprotkb/P09022" }, { "database": "PubMed", "id": "29465778", "url": "https://pubmed.ncbi.nlm.nih.gov/29465778" } ], "uniprot_canonical_ac": "P09022-1" }, { "start_pos": 71, "end_pos": 199, "sequence_org": "PQTATYQTSGNLGISYSHSSCGPSYGAQNFSAPYGPYGLNQEADVSGGYPPCAPAVYSGNLSTPMVQHHHHHQGYAGGTVGSPQYIHHSYGQEQQTLALATYNNSLSPLHASHQEACRSPASETSSPAQ", "sequence_mut": "", "comment": "Loss of interaction with OGT.", "evidence": [ { "database": "UniProtKB", "id": "P09022", "url": "https://www.uniprot.org/uniprotkb/P09022" }, { "database": "PubMed", "id": "29465778", "url": "https://pubmed.ncbi.nlm.nih.gov/29465778" } ], "uniprot_canonical_ac": "P09022-1" } ], "glycosylation": [ { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "T", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 149, "start_aa": "Thr", "end_pos": 149, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr149", "evidence": [ { "id": "29465778", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29465778" }, { "id": "P09022", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P09022" } ], "filter_code": "000000000000000010000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "P09022-1" }, { "glytoucan_ac": "", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "T", "relation": "attached", "comment": "O-linked (GlcNAc) threonine;O-GlcNAcylation", "icn3d_view": {}, "start_pos": 149, "start_aa": "Thr", "end_pos": 149, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr149", "evidence": [ { "id": "P09022", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P09022#ptm_processing" }, { "id": "29465778", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29465778" } ], "filter_code": "000000000000000010000.00000001000000.00.01000", "uniprot_canonical_ac": "P09022-1" } ], "record_id": "pubmed.29465778", "abstract": "", "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "glytoucan_ac" ] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 1 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "exact_sites", "count": 1 }, { "field": "exact_o_linked_sites", "count": 1 }, { "field": "exact_o_linked_glycan_sites", "count": 1 }, { "field": "exact_o_linked_glycans", "count": 1 }, { "field": "fuzzy_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl", "filter_code", "uniprot_canonical_ac" ] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 1 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "exact_sites", "count": 1 }, { "field": "exact_o_linked_sites", "count": 1 }, { "field": "fuzzy_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl", "filter_code", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 1 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "exact_sites", "count": 1 }, { "field": "exact_o_linked_sites", "count": 1 }, { "field": "exact_o_linked_glycan_sites", "count": 1 }, { "field": "exact_o_linked_glycans", "count": 1 }, { "field": "fuzzy_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl", "filter_code", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Molecular characterization and distribution of the opioid growth factor receptor (OGFr) in mouse.", "journal": "Brain Res. Mol. Brain Res.", "date": "2000", "authors": "Zagon IS, Verderame MF, Zimmer WE, McLaughlin PJ", "reference": { "type": "PubMed", "id": "11113537", "url": "https://pubmed.ncbi.nlm.nih.gov/11113537" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q99PG2-1", "protein_name": "Opioid growth factor receptor", "gene_name": "Ogfr", "tax_name": "Mouse" } ], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "Q99PG2", "url": "https://www.uniprot.org/uniprotkb/Q99PG2" } ], "common_name": "Mouse", "glygen_name": "Mouse", "reference_species": "Mus musculus [10090]" } ], "record_id": "pubmed.11113537", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Targeted overexpression of OGFr in epithelium of transgenic mice suppresses cell proliferation and impairs full-thickness wound closure.", "journal": "American journal of physiology. Regulatory, integrative and comparative physiology", "date": "2012", "authors": "McLaughlin PJ, Keiper CL, Verderame MF, Zagon IS", "reference": { "type": "PubMed", "id": "22338080", "url": "https://pubmed.ncbi.nlm.nih.gov/22338080" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q99PG2-1", "protein_name": "Opioid growth factor receptor", "gene_name": "Ogfr", "tax_name": "Mouse" } ], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "Q99PG2", "url": "https://www.uniprot.org/uniprotkb/Q99PG2" } ], "common_name": "Mouse", "glygen_name": "Mouse", "reference_species": "Mus musculus [10090]" } ], "record_id": "pubmed.22338080", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Opioid growth factor receptor: Anatomical distribution and receptor colocalization in neurons of the adult mouse brain.", "journal": "Neuropeptides", "date": "2023-02-15", "authors": "Kareem Zainab Y, McLaughlin Patricia J, Kumari Rashmi", "reference": { "type": "PubMed", "id": "36812665", "url": "https://pubmed.ncbi.nlm.nih.gov/36812665" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q99PG2-1", "protein_name": "Opioid growth factor receptor", "gene_name": "Ogfr", "tax_name": "Mouse" } ], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "Q99PG2", "url": "https://www.uniprot.org/uniprotkb/Q99PG2" } ], "common_name": "Mouse", "glygen_name": "Mouse", "reference_species": "Mus musculus [10090]" } ], "record_id": "pubmed.36812665", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Site-specific O-GlcNAcylation of Psme3 maintains mouse stem cell pluripotency by impairing P-body homeostasis.", "journal": "Cell reports", "date": "2021", "authors": "Pecori F, Kondo N, Ogura C, Miura T, Kume M, Minamijima Y, Yamamoto K, Nishihara S", "reference": { "type": "PubMed", "id": "34260942", "url": "https://pubmed.ncbi.nlm.nih.gov/34260942" }, "referenced_glycans": [ { "glytoucan_ac": "G49108TO" } ], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9D051-1", "protein_name": "Pyruvate dehydrogenase E1 component subunit beta, mitochondrial", "gene_name": "Pdhb", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "P63101-1", "protein_name": "14-3-3 protein zeta/delta", "gene_name": "Ywhaz", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "P38647-1", "protein_name": "Stress-70 protein, mitochondrial", "gene_name": "Hspa9", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "Q07076-1", "protein_name": "Annexin A7", "gene_name": "Anxa7", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "Q76LW6-1", "protein_name": "DAN domain family member 5", "gene_name": "Dand5", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "P80316-1", "protein_name": "T-complex protein 1 subunit epsilon", "gene_name": "Cct5", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "P63038-1", "protein_name": "60 kDa heat shock protein, mitochondrial", "gene_name": "Hspd1", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "P61290-1", "protein_name": "Proteasome activator complex subunit 3", "gene_name": "Psme3", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "P47757-1", "protein_name": "F-actin-capping protein subunit beta", "gene_name": "Capzb", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "Q9D6F9-1", "protein_name": "Tubulin beta-4A chain", "gene_name": "Tubb4a", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "O89090-1", "protein_name": "Transcription factor Sp1", "gene_name": "Sp1", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "P56480-1", "protein_name": "ATP synthase F(1) complex catalytic subunit beta, mitochondrial", "gene_name": "Atp5f1b", "tax_name": "Mouse" } ], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "Q9D051", "url": "https://www.uniprot.org/uniprotkb/Q9D051" } ], "common_name": "Mouse", "glygen_name": "Mouse", "reference_species": "Mus musculus [10090]" } ], "glycosylation": [ { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "evidence": [ { "id": "37453647", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37453647" }, { "id": "Q9D051", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=Q9D051" }, { "id": "36288343", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/36288343" }, { "id": "37507081", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37507081" }, { "id": "33300544", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33300544" }, { "id": "39927985", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/39927985" }, { "id": "34260942", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34260942" } ], "filter_code": "000000000000000000000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "Q9D051-1" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "evidence": [ { "id": "37453647", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37453647" }, { "id": "P63101", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P63101" }, { "id": "37507081", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37507081" }, { "id": "36288343", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/36288343" }, { "id": "33300544", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33300544" }, { "id": "39927985", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/39927985" }, { "id": "34260942", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34260942" }, { "id": "24788674", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24788674" }, { "id": "22645316", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/22645316" } ], "filter_code": "000000000000000000000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "P63101-1" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "evidence": [ { "id": "37453647", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37453647" }, { "id": "P38647", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P38647" }, { "id": "29187734", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29187734" }, { "id": "37507081", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37507081" }, { "id": "36288343", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/36288343" }, { "id": "34887587", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34887587" }, { "id": "39927985", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/39927985" }, { "id": "34260942", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34260942" }, { "id": "39627609", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/39627609" }, { "id": "36064721", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/36064721" }, { "id": "38192280", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/38192280" } ], "filter_code": "000000000000000000000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "P38647-1" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "evidence": [ { "id": "37453647", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37453647" }, { "id": "Q07076", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=Q07076" }, { "id": "36288343", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/36288343" }, { "id": "34260942", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34260942" }, { "id": "40684658", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/40684658" } ], "filter_code": "000000000000000000000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "Q07076-1" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "evidence": [ { "id": "34260942", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34260942" }, { "id": "Q76LW6", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=Q76LW6" }, { "id": "29125738", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29125738" } ], "filter_code": "000000000000000000000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "Q76LW6-1" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "evidence": [ { "id": "37453647", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37453647" }, { "id": "P80316", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P80316" }, { "id": "37507081", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37507081" }, { "id": "33300544", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33300544" }, { "id": "34887587", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34887587" }, { "id": "39927985", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/39927985" }, { "id": "34260942", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34260942" }, { "id": "39627609", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/39627609" }, { "id": "22645316", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/22645316" } ], "filter_code": "000000000000000000000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "P80316-1" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "evidence": [ { "id": "37453647", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37453647" }, { "id": "P63038", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P63038" }, { "id": "37507081", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37507081" }, { "id": "36288343", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/36288343" }, { "id": "34887587", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34887587" }, { "id": "33300544", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33300544" }, { "id": "39927985", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/39927985" }, { "id": "40684658", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/40684658" }, { "id": "34260942", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34260942" }, { "id": "36064721", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/36064721" }, { "id": "20887712", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/20887712" }, { "id": "34105348", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34105348" } ], "filter_code": "000000000000000000000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "P63038-1" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 111, "start_aa": "Ser", "end_pos": 111, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser111", "evidence": [ { "id": "34260942", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34260942" }, { "id": "P61290", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P61290" } ], "filter_code": "000000000000000100000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "P61290-1" }, { "glytoucan_ac": "", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "automatic_literature_mining", "site_category_dict": { "automatic_literature_mining": true }, "site_seq": "S", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 111, "start_aa": "Ser", "end_pos": 111, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser111", "evidence": [ { "id": "34260942", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34260942" }, { "id": "GLY_000492", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000492" } ], "mining_tool": "GlycoSiteMiner_1.0", "mining_tool_list": [ { "label": "GlycoSiteMiner_1.0" } ], "filter_code": "000000000000000100000.00000000001000.00.01001", "uniprot_canonical_ac": "P61290-1" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "evidence": [ { "id": "34260942", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34260942" }, { "id": "P61290", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P61290" }, { "id": "25153642", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/25153642" } ], "filter_code": "000000000000000000000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "P61290-1" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "evidence": [ { "id": "29187734", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29187734" }, { "id": "P47757", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P47757" }, { "id": "36288343", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/36288343" }, { "id": "33300544", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33300544" }, { "id": "34260942", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34260942" }, { "id": "22645316", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/22645316" }, { "id": "24788674", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24788674" }, { "id": "39627609", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/39627609" }, { "id": "21540332", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/21540332" }, { "id": "37507081", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37507081" }, { "id": "28135057", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/28135057" }, { "id": "25153642", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/25153642" }, { "id": "28528544", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/28528544" } ], "filter_code": "000000000000000000000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "P47757-1" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "evidence": [ { "id": "34260942", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34260942" }, { "id": "Q9D6F9", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=Q9D6F9" }, { "id": "22645316", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/22645316" }, { "id": "40684658", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/40684658" }, { "id": "33300544", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33300544" } ], "filter_code": "000000000000000000000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "Q9D6F9-1" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 613, "start_aa": "Ser", "end_pos": 613, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser613", "evidence": [ { "id": "28528544", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/28528544" }, { "id": "O89090", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O89090" }, { "id": "21493720", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/21493720" }, { "id": "16879824", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/16879824" }, { "id": "40997131", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/40997131" }, { "id": "41385373", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/41385373" }, { "id": "23315940", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23315940" }, { "id": "18513490", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/18513490" }, { "id": "25657638", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/25657638" }, { "id": "19598243", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19598243" }, { "id": "27010859", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/27010859" }, { "id": "19285002", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19285002" }, { "id": "19070619", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19070619" }, { "id": "22874425", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/22874425" }, { "id": "20138838", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/20138838" }, { "id": "18596307", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/18596307" }, { "id": "39627609", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/39627609" }, { "id": "34260942", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34260942" }, { "id": "14749383", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/14749383" }, { "id": "29125738", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29125738" }, { "id": "38861834", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/38861834" }, { "id": "O89090", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/O89090" } ], "filter_code": "000000000000000100000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01010", "uniprot_canonical_ac": "O89090-1" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "T", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 641, "start_aa": "Thr", "end_pos": 641, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr641", "evidence": [ { "id": "28528544", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/28528544" }, { "id": "O89090", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O89090" }, { "id": "21493720", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/21493720" }, { "id": "16879824", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/16879824" }, { "id": "40997131", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/40997131" }, { "id": "41385373", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/41385373" }, { "id": "23315940", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23315940" }, { "id": "18513490", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/18513490" }, { "id": "25657638", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/25657638" }, { "id": "19598243", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19598243" }, { "id": "27010859", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/27010859" }, { "id": "19285002", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19285002" }, { "id": "19070619", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19070619" }, { "id": "22874425", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/22874425" }, { "id": "20138838", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/20138838" }, { "id": "18596307", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/18596307" }, { "id": "39627609", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/39627609" }, { "id": "34260942", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34260942" }, { "id": "14749383", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/14749383" }, { "id": "29125738", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29125738" }, { "id": "38861834", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/38861834" }, { "id": "O89090", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/O89090" } ], "filter_code": "000000000000000010000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01010", "uniprot_canonical_ac": "O89090-1" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 642, "start_aa": "Ser", "end_pos": 642, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser642", "evidence": [ { "id": "28528544", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/28528544" }, { "id": "O89090", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O89090" }, { "id": "21493720", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/21493720" }, { "id": "16879824", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/16879824" }, { "id": "40997131", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/40997131" }, { "id": "41385373", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/41385373" }, { "id": "23315940", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23315940" }, { "id": "18513490", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/18513490" }, { "id": "25657638", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/25657638" }, { "id": "19598243", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19598243" }, { "id": "27010859", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/27010859" }, { "id": "19285002", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19285002" }, { "id": "19070619", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19070619" }, { "id": "22874425", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/22874425" }, { "id": "20138838", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/20138838" }, { "id": "18596307", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/18596307" }, { "id": "39627609", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/39627609" }, { "id": "34260942", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34260942" }, { "id": "14749383", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/14749383" }, { "id": "29125738", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29125738" }, { "id": "38861834", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/38861834" }, { "id": "O89090", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/O89090" } ], "filter_code": "000000000000000100000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01010", "uniprot_canonical_ac": "O89090-1" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 699, "start_aa": "Ser", "end_pos": 699, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser699", "evidence": [ { "id": "28528544", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/28528544" }, { "id": "O89090", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O89090" }, { "id": "21493720", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/21493720" }, { "id": "16879824", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/16879824" }, { "id": "40997131", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/40997131" }, { "id": "41385373", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/41385373" }, { "id": "23315940", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23315940" }, { "id": "18513490", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/18513490" }, { "id": "25657638", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/25657638" }, { "id": "19598243", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19598243" }, { "id": "27010859", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/27010859" }, { "id": "19285002", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19285002" }, { "id": "19070619", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19070619" }, { "id": "22874425", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/22874425" }, { "id": "20138838", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/20138838" }, { "id": "18596307", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/18596307" }, { "id": "39627609", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/39627609" }, { "id": "34260942", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34260942" }, { "id": "14749383", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/14749383" }, { "id": "29125738", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29125738" }, { "id": "38861834", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/38861834" }, { "id": "O89090", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/O89090" } ], "filter_code": "000000000000000100000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01010", "uniprot_canonical_ac": "O89090-1" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 703, "start_aa": "Ser", "end_pos": 703, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser703", "evidence": [ { "id": "28528544", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/28528544" }, { "id": "O89090", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O89090" }, { "id": "21493720", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/21493720" }, { "id": "16879824", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/16879824" }, { "id": "40997131", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/40997131" }, { "id": "41385373", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/41385373" }, { "id": "23315940", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23315940" }, { "id": "18513490", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/18513490" }, { "id": "25657638", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/25657638" }, { "id": "19598243", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19598243" }, { "id": "27010859", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/27010859" }, { "id": "19285002", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19285002" }, { "id": "19070619", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19070619" }, { "id": "22874425", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/22874425" }, { "id": "20138838", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/20138838" }, { "id": "18596307", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/18596307" }, { "id": "39627609", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/39627609" }, { "id": "34260942", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34260942" }, { "id": "14749383", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/14749383" }, { "id": "29125738", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29125738" }, { "id": "38861834", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/38861834" }, { "id": "O89090", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/O89090" } ], "filter_code": "000000000000000100000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01010", "uniprot_canonical_ac": "O89090-1" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "evidence": [ { "id": "37453647", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37453647" }, { "id": "P56480", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P56480" }, { "id": "37507081", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37507081" }, { "id": "36288343", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/36288343" }, { "id": "33300544", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33300544" }, { "id": "39927985", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/39927985" }, { "id": "40684658", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/40684658" }, { "id": "34260942", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34260942" }, { "id": "36064721", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/36064721" }, { "id": "39627609", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/39627609" }, { "id": "22645316", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/22645316" } ], "filter_code": "000000000000000000000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "P56480-1" } ], "record_id": "pubmed.34260942", "abstract": "", "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 12 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "glytoucan_ac" ] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 18 }, { "field": "total_sites", "count": 7 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 7 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 7 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "exact_sites", "count": 6 }, { "field": "exact_o_linked_sites", "count": 6 }, { "field": "exact_o_linked_glycan_sites", "count": 6 }, { "field": "exact_o_linked_glycans", "count": 1 }, { "field": "fuzzy_sites", "count": 1 }, { "field": "fuzzy_o_linked_sites", "count": 1 }, { "field": "fuzzy_o_linked_glycan_sites", "count": 1 }, { "field": "fuzzy_o_linked_glycans", "count": 1 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "filter_code", "uniprot_canonical_ac", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl", "mining_tool" ] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 17 }, { "field": "total_sites", "count": 7 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 7 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 7 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "exact_sites", "count": 6 }, { "field": "exact_o_linked_sites", "count": 6 }, { "field": "exact_o_linked_glycan_sites", "count": 6 }, { "field": "exact_o_linked_glycans", "count": 1 }, { "field": "fuzzy_sites", "count": 1 }, { "field": "fuzzy_o_linked_sites", "count": 1 }, { "field": "fuzzy_o_linked_glycan_sites", "count": 1 }, { "field": "fuzzy_o_linked_glycans", "count": 1 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "filter_code", "uniprot_canonical_ac", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl", "mining_tool" ] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 1 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "exact_sites", "count": 1 }, { "field": "exact_o_linked_sites", "count": 1 }, { "field": "fuzzy_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "filter_code", "uniprot_canonical_ac", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl", "mining_tool" ] } ] }, { "title": "Pyruvate dehydrogenase B regulates myogenic differentiation via the FoxP1-Arih2 axis.", "journal": "Journal of cachexia, sarcopenia and muscle", "date": "2022-12-23", "authors": "Jiang Xuan, Ji Siyu, Yuan Fenglai, Li Tushuai, Cui Siyuan, Wang Wei, Ye Xianlong, Wang Rong, Chen Yongquan, Zhu Shenglong", "reference": { "type": "PubMed", "id": "36564038", "url": "https://pubmed.ncbi.nlm.nih.gov/36564038" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9D051-1", "protein_name": "Pyruvate dehydrogenase E1 component subunit beta, mitochondrial", "gene_name": "Pdhb", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "P11177-1", "protein_name": "Pyruvate dehydrogenase E1 component subunit beta, mitochondrial", "gene_name": "PDHB", "tax_name": "Human" } ], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "Q9D051", "url": "https://www.uniprot.org/uniprotkb/Q9D051" } ], "common_name": "Mouse", "glygen_name": "Mouse", "reference_species": "Mus musculus [10090]" } ], "record_id": "pubmed.36564038", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Mice deficient in dihydrolipoyl succinyl transferase show increased vulnerability to mitochondrial toxins.", "journal": "Neurobiology of disease", "date": "2009", "authors": "Yang L, Shi Q, Ho DJ, Starkov AA, Wille EJ, Xu H, Chen HL, Zhang S, Stack CM, Calingasan NY, Gibson GE, Beal MF", "reference": { "type": "PubMed", "id": "19660549", "url": "https://pubmed.ncbi.nlm.nih.gov/19660549" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9D2G2-1", "protein_name": "Dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex, mitochondrial", "gene_name": "Dlst", "tax_name": "Mouse" } ], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "Q9D2G2", "url": "https://www.uniprot.org/uniprotkb/Q9D2G2" } ], "common_name": "Mouse", "glygen_name": "Mouse", "reference_species": "Mus musculus [10090]" } ], "record_id": "pubmed.19660549", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "MCM3-binding GANP DNA-primase is associated with a novel phosphatase component G5PR.", "journal": "Genes to cells : devoted to molecular & cellular mechanisms", "date": "2002", "authors": "Kono Y, Maeda K, Kuwahara K, Yamamoto H, Miyamoto E, Yonezawa K, Takagi K, Sakaguchi N", "reference": { "type": "PubMed", "id": "12167160", "url": "https://pubmed.ncbi.nlm.nih.gov/12167160" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9JK24-1", "protein_name": "Serine/threonine-protein phosphatase 2A regulatory subunit B'' subunit gamma", "gene_name": "Ppp2r3c", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "Q9WUU9-1", "protein_name": "Germinal-center associated nuclear protein", "gene_name": "Mcm3ap", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "Q969Q6-1", "protein_name": "Serine/threonine-protein phosphatase 2A regulatory subunit B'' subunit gamma", "gene_name": "PPP2R3C", "tax_name": "Human" } ], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "Q9JK24", "url": "https://www.uniprot.org/uniprotkb/Q9JK24" } ], "common_name": "Mouse", "glygen_name": "Mouse", "reference_species": "Mus musculus [10090]" } ], "record_id": "pubmed.12167160", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Protein phosphatase subunit G5PR is needed for inhibition of B cell receptor-induced apoptosis.", "journal": "The Journal of experimental medicine", "date": "2005", "authors": "Xing Y, Igarashi H, Wang X, Sakaguchi N", "reference": { "type": "PubMed", "id": "16129705", "url": "https://pubmed.ncbi.nlm.nih.gov/16129705" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9JK24-1", "protein_name": "Serine/threonine-protein phosphatase 2A regulatory subunit B'' subunit gamma", "gene_name": "Ppp2r3c", "tax_name": "Mouse" } ], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "Q9JK24", "url": "https://www.uniprot.org/uniprotkb/Q9JK24" } ], "common_name": "Mouse", "glygen_name": "Mouse", "reference_species": "Mus musculus [10090]" } ], "record_id": "pubmed.16129705", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "BCR-crosslinking induces a transcription of protein phosphatase component G5PR that is required for mature B-cell survival.", "journal": "Biochemical and biophysical research communications", "date": "2006", "authors": "Huq Ronny FM, Igarashi H, Sakaguchi N", "reference": { "type": "PubMed", "id": "16343422", "url": "https://pubmed.ncbi.nlm.nih.gov/16343422" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9JK24-1", "protein_name": "Serine/threonine-protein phosphatase 2A regulatory subunit B'' subunit gamma", "gene_name": "Ppp2r3c", "tax_name": "Mouse" } ], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "Q9JK24", "url": "https://www.uniprot.org/uniprotkb/Q9JK24" } ], "common_name": "Mouse", "glygen_name": "Mouse", "reference_species": "Mus musculus [10090]" } ], "record_id": "pubmed.16343422", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Protein phosphatase subunit G5PR that regulates the JNK-mediated apoptosis signal is essential for the survival of CD4 and CD8 double-positive thymocytes.", "journal": "Molecular immunology", "date": "2008", "authors": "Xing Y, Wang X, Igarashi H, Kawamoto H, Sakaguchi N", "reference": { "type": "PubMed", "id": "18022237", "url": "https://pubmed.ncbi.nlm.nih.gov/18022237" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9JK24-1", "protein_name": "Serine/threonine-protein phosphatase 2A regulatory subunit B'' subunit gamma", "gene_name": "Ppp2r3c", "tax_name": "Mouse" } ], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "Q9JK24", "url": "https://www.uniprot.org/uniprotkb/Q9JK24" } ], "common_name": "Mouse", "glygen_name": "Mouse", "reference_species": "Mus musculus [10090]" } ], "record_id": "pubmed.18022237", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "JNK regulatory molecule G5PR induces IgG autoantibody-producing plasmablasts from peritoneal B1a cells.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "2015", "authors": "Kitabatake M, Soma M, Zhang T, Kuwahara K, Fukushima Y, Nojima T, Kitamura D, Sakaguchi N", "reference": { "type": "PubMed", "id": "25601926", "url": "https://pubmed.ncbi.nlm.nih.gov/25601926" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9JK24-1", "protein_name": "Serine/threonine-protein phosphatase 2A regulatory subunit B'' subunit gamma", "gene_name": "Ppp2r3c", "tax_name": "Mouse" } ], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "Q9JK24", "url": "https://www.uniprot.org/uniprotkb/Q9JK24" } ], "common_name": "Mouse", "glygen_name": "Mouse", "reference_species": "Mus musculus [10090]" } ], "record_id": "pubmed.25601926", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Structure and DNA binding of the human Rtf1 Plus3 domain.", "journal": "Structure (London, England : 1993)", "date": "2008", "authors": "de Jong RN, Truffault V, Diercks T, Ab E, Daniels MA, Kaptein R, Folkers GE", "reference": { "type": "PubMed", "id": "18184592", "url": "https://pubmed.ncbi.nlm.nih.gov/18184592" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "A2AQ19-1", "protein_name": "RNA polymerase-associated protein RTF1 homolog", "gene_name": "Rtf1", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "Q92541-1", "protein_name": "RNA polymerase-associated protein RTF1 homolog", "gene_name": "RTF1", "tax_name": "Human" } ], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "A2AQ19", "url": "https://www.uniprot.org/uniprotkb/A2AQ19" } ], "common_name": "Mouse", "glygen_name": "Mouse", "reference_species": "Mus musculus [10090]" } ], "mutagenesis": [ { "start_pos": 401, "end_pos": 401, "sequence_org": "R", "sequence_mut": "E", "comment": "Loss of binding to single-stranded DNA.", "evidence": [ { "database": "UniProtKB", "id": "Q92541", "url": "https://www.uniprot.org/uniprotkb/Q92541" }, { "database": "PubMed", "id": "18184592", "url": "https://pubmed.ncbi.nlm.nih.gov/18184592" } ], "uniprot_canonical_ac": "Q92541-1" }, { "start_pos": 410, "end_pos": 410, "sequence_org": "E", "sequence_mut": "K", "comment": "Reduced binding to single-stranded DNA.", "evidence": [ { "database": "UniProtKB", "id": "Q92541", "url": "https://www.uniprot.org/uniprotkb/Q92541" }, { "database": "PubMed", "id": "18184592", "url": "https://pubmed.ncbi.nlm.nih.gov/18184592" } ], "uniprot_canonical_ac": "Q92541-1" }, { "start_pos": 429, "end_pos": 429, "sequence_org": "R", "sequence_mut": "E", "comment": "Loss of binding to single-stranded DNA.", "evidence": [ { "database": "UniProtKB", "id": "Q92541", "url": "https://www.uniprot.org/uniprotkb/Q92541" }, { "database": "PubMed", "id": "18184592", "url": "https://pubmed.ncbi.nlm.nih.gov/18184592" } ], "uniprot_canonical_ac": "Q92541-1" }, { "start_pos": 434, "end_pos": 434, "sequence_org": "Q", "sequence_mut": "A", "comment": "Reduced binding to single-stranded DNA.", "evidence": [ { "database": "UniProtKB", "id": "Q92541", "url": "https://www.uniprot.org/uniprotkb/Q92541" }, { "database": "PubMed", "id": "18184592", "url": "https://pubmed.ncbi.nlm.nih.gov/18184592" } ], "uniprot_canonical_ac": "Q92541-1" }, { "start_pos": 435, "end_pos": 435, "sequence_org": "R", "sequence_mut": "E", "comment": "Loss of binding to single-stranded DNA.", "evidence": [ { "database": "UniProtKB", "id": "Q92541", "url": "https://www.uniprot.org/uniprotkb/Q92541" }, { "database": "PubMed", "id": "18184592", "url": "https://pubmed.ncbi.nlm.nih.gov/18184592" } ], "uniprot_canonical_ac": "Q92541-1" } ], "record_id": "pubmed.18184592", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "A genome-scale RNAi screen for Oct4 modulators defines a role of the Paf1 complex for embryonic stem cell identity.", "journal": "Cell stem cell", "date": "2009", "authors": "Ding L, Paszkowski-Rogacz M, Nitzsche A, Slabicki MM, Heninger AK, de Vries I, Kittler R, Junqueira M, Shevchenko A, Schulz H, Hubner N, Doss MX, Sachinidis A, Hescheler J, Iacone R, Anastassiadis K, Stewart AF, Pisabarro MT, Caldarelli A, Poser I, Theis M, Buchholz F", "reference": { "type": "PubMed", "id": "19345177", "url": "https://pubmed.ncbi.nlm.nih.gov/19345177" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "A2AQ19-1", "protein_name": "RNA polymerase-associated protein RTF1 homolog", "gene_name": "Rtf1", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "Q8K2T8-1", "protein_name": "RNA polymerase II-associated factor 1 homolog", "gene_name": "Paf1", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "Q9ERF3-1", "protein_name": "Superkiller complex protein 8", "gene_name": "Skic8", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "Q62018-1", "protein_name": "RNA polymerase-associated protein CTR9 homolog", "gene_name": "Ctr9", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "Q6PD62-1", "protein_name": "RNA polymerase-associated protein CTR9 homolog", "gene_name": "CTR9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8WVC0-1", "protein_name": "RNA polymerase-associated protein LEO1", "gene_name": "LEO1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92541-1", "protein_name": "RNA polymerase-associated protein RTF1 homolog", "gene_name": "RTF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5XJE5-1", "protein_name": "RNA polymerase-associated protein LEO1", "gene_name": "Leo1", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "Q8JZM7-1", "protein_name": "Parafibromin", "gene_name": "Cdc73", "tax_name": "Mouse" } ], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "A2AQ19", "url": "https://www.uniprot.org/uniprotkb/A2AQ19" } ], "common_name": "Mouse", "glygen_name": "Mouse", "reference_species": "Mus musculus [10090]" } ], "record_id": "pubmed.19345177", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 9 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Regulation of transcriptional elongation in pluripotency and cell differentiation by the PHD-finger protein Phf5a.", "journal": "Nat. Cell Biol.", "date": "2016", "authors": "Strikoudis A, Lazaris C, Trimarchi T, Galvao Neto AL, Yang Y, Ntziachristos P, Rothbart S, Buckley S, Dolgalev I, Stadtfeld M, Strahl BD, Dynlacht BD, Tsirigos A, Aifantis I", "reference": { "type": "PubMed", "id": "27749823", "url": "https://pubmed.ncbi.nlm.nih.gov/27749823" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "A2AQ19-1", "protein_name": "RNA polymerase-associated protein RTF1 homolog", "gene_name": "Rtf1", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "Q8K2T8-1", "protein_name": "RNA polymerase II-associated factor 1 homolog", "gene_name": "Paf1", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "Q9ERF3-1", "protein_name": "Superkiller complex protein 8", "gene_name": "Skic8", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "Q62018-1", "protein_name": "RNA polymerase-associated protein CTR9 homolog", "gene_name": "Ctr9", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "Q5XJE5-1", "protein_name": "RNA polymerase-associated protein LEO1", "gene_name": "Leo1", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "P83870-1", "protein_name": "PHD finger-like domain-containing protein 5A", "gene_name": "Phf5a", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "Q8JZM7-1", "protein_name": "Parafibromin", "gene_name": "Cdc73", "tax_name": "Mouse" } ], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "A2AQ19", "url": "https://www.uniprot.org/uniprotkb/A2AQ19" } ], "common_name": "Mouse", "glygen_name": "Mouse", "reference_species": "Mus musculus [10090]" } ], "record_id": "pubmed.27749823", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 7 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Nspl1, a new Z-band-associated protein.", "journal": "J. Muscle Res. Cell Motil.", "date": "1999", "authors": "Geisler J G, Palmer R J, Stubbs L J, Mucenski M L", "reference": { "type": "PubMed", "id": "10672514", "url": "https://pubmed.ncbi.nlm.nih.gov/10672514" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O70622-1", "protein_name": "Reticulon-2", "gene_name": "Rtn2", "tax_name": "Mouse" } ], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "O70622", "url": "https://www.uniprot.org/uniprotkb/O70622" } ], "common_name": "Mouse", "glygen_name": "Mouse", "reference_species": "Mus musculus [10090]" } ], "record_id": "pubmed.10672514", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Functional role of neuroendocrine-specific protein-like 1 in membrane translocation of GLUT4.", "journal": "Diabetes", "date": "2009", "authors": "Ikemoto T, Hosoya T, Takata K, Aoyama H, Hiramatsu T, Onoe H, Suzuki M, Endo M", "reference": { "type": "PubMed", "id": "19720795", "url": "https://pubmed.ncbi.nlm.nih.gov/19720795" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O70622-1", "protein_name": "Reticulon-2", "gene_name": "Rtn2", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "P51907-1", "protein_name": "Excitatory amino acid transporter 3", "gene_name": "Slc1a1", "tax_name": "Rat" }, { "uniprot_canonical_ac": "Q9ES40-1", "protein_name": "PRA1 family protein 3", "gene_name": "Arl6ip5", "tax_name": "Rat" } ], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "O70622", "url": "https://www.uniprot.org/uniprotkb/O70622" } ], "common_name": "Mouse", "glygen_name": "Mouse", "reference_species": "Mus musculus [10090]" } ], "record_id": "pubmed.19720795", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Molecular cloning of a novel mouse gene with predominant muscle and neural expression.", "journal": "Mamm. Genome", "date": "1998", "authors": "Geisler JG, Stubbs LJ, Wasserman WW, Mucenski ML", "reference": { "type": "PubMed", "id": "9530622", "url": "https://pubmed.ncbi.nlm.nih.gov/9530622" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O70622-1", "protein_name": "Reticulon-2", "gene_name": "Rtn2", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "O75298-1", "protein_name": "Reticulon-2", "gene_name": "RTN2", "tax_name": "Human" } ], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "O70622", "url": "https://www.uniprot.org/uniprotkb/O70622" } ], "common_name": "Mouse", "glygen_name": "Mouse", "reference_species": "Mus musculus [10090]" } ], "record_id": "pubmed.9530622", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Primary sequence of the mouse ribosomal protein S8.", "journal": "Nucleic Acids Res.", "date": "1993", "authors": "Su Y, Babu N, Raj K, A WC, Pithal PM", "reference": { "type": "PubMed", "id": "7694236", "url": "https://pubmed.ncbi.nlm.nih.gov/7694236" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P62242-1", "protein_name": "Small ribosomal subunit protein eS8", "gene_name": "Rps8", "tax_name": "Mouse" } ], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "P62242", "url": "https://www.uniprot.org/uniprotkb/P62242" } ], "common_name": "Mouse", "glygen_name": "Mouse", "reference_species": "Mus musculus [10090]" } ], "record_id": "pubmed.7694236", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Ubiquitin-like protein MNSFbeta noncovalently binds to molecular chaperone HSPA8 and regulates osteoclastogenesis.", "journal": "Molecular and cellular biochemistry", "date": "2016", "authors": "Notsu K, Nakagawa M, Nakamura M", "reference": { "type": "PubMed", "id": "27581120", "url": "https://pubmed.ncbi.nlm.nih.gov/27581120" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P62862-1", "protein_name": "Ubiquitin-like FUBI-ribosomal protein eS30 fusion protein", "gene_name": "Fau", "tax_name": "Mouse" } ], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "P62862", "url": "https://www.uniprot.org/uniprotkb/P62862" } ], "common_name": "Mouse", "glygen_name": "Mouse", "reference_species": "Mus musculus [10090]" } ], "record_id": "pubmed.27581120", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Heat shock protein 60 negatively regulates the biological functions of ubiquitin-like protein MNSFbeta in macrophages.", "journal": "Molecular and cellular biochemistry", "date": "2019", "authors": "Nakamura M, Notsu K, Nakagawa M", "reference": { "type": "PubMed", "id": "30710197", "url": "https://pubmed.ncbi.nlm.nih.gov/30710197" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P62862-1", "protein_name": "Ubiquitin-like FUBI-ribosomal protein eS30 fusion protein", "gene_name": "Fau", "tax_name": "Mouse" } ], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "P62862", "url": "https://www.uniprot.org/uniprotkb/P62862" } ], "common_name": "Mouse", "glygen_name": "Mouse", "reference_species": "Mus musculus [10090]" } ], "record_id": "pubmed.30710197", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Investigating the regulatory mechanism of glucose metabolism by ubiquitin-like protein MNSF\u03b2.", "journal": "Molecular biology reports", "date": "2024-10-15", "authors": "Kono Megumi, Yamasaki Kyoko, Nakamura Morihiko", "reference": { "type": "PubMed", "id": "39404900", "url": "https://pubmed.ncbi.nlm.nih.gov/39404900" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P62862-1", "protein_name": "Ubiquitin-like FUBI-ribosomal protein eS30 fusion protein", "gene_name": "Fau", "tax_name": "Mouse" } ], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "P62862", "url": "https://www.uniprot.org/uniprotkb/P62862" } ], "common_name": "Mouse", "glygen_name": "Mouse", "reference_species": "Mus musculus [10090]" } ], "record_id": "pubmed.39404900", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Molecular cloning and characterization of a cDNA encoding monoclonal nonspecific suppressor factor.", "journal": "Proc. Natl. Acad. Sci. U.S.A.", "date": "1995", "authors": "Nakamura M, Xavier RM, Tsunematsu T, Tanigawa Y", "reference": { "type": "PubMed", "id": "7724584", "url": "https://pubmed.ncbi.nlm.nih.gov/7724584" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P62862-1", "protein_name": "Ubiquitin-like FUBI-ribosomal protein eS30 fusion protein", "gene_name": "Fau", "tax_name": "Mouse" } ], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "P62862", "url": "https://www.uniprot.org/uniprotkb/P62862" } ], "common_name": "Mouse", "glygen_name": "Mouse", "reference_species": "Mus musculus [10090]" } ], "record_id": "pubmed.7724584", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The mouse Fau gene: genomic structure, chromosomal localization, and characterization of two retropseudogenes.", "journal": "Genomics", "date": "1995", "authors": "Casteels D, Poirier C, Guenet JL, Merregaert J", "reference": { "type": "PubMed", "id": "7774934", "url": "https://pubmed.ncbi.nlm.nih.gov/7774934" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P62862-1", "protein_name": "Ubiquitin-like FUBI-ribosomal protein eS30 fusion protein", "gene_name": "Fau", "tax_name": "Mouse" } ], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "P62862", "url": "https://www.uniprot.org/uniprotkb/P62862" } ], "common_name": "Mouse", "glygen_name": "Mouse", "reference_species": "Mus musculus [10090]" } ], "record_id": "pubmed.7774934", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "fau cDNA encodes a ubiquitin-like-S30 fusion protein and is expressed as an antisense sequence in the Finkel-Biskis-Reilly murine sarcoma virus.", "journal": "Oncogene", "date": "1993", "authors": "Michiels L, Van der Rauwelaert E, Van Hasselt F, Kas K, Merregaert J", "reference": { "type": "PubMed", "id": "8395683", "url": "https://pubmed.ncbi.nlm.nih.gov/8395683" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P62862-1", "protein_name": "Ubiquitin-like FUBI-ribosomal protein eS30 fusion protein", "gene_name": "Fau", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "P62861-1", "protein_name": "Ubiquitin-like FUBI-ribosomal protein eS30 fusion protein", "gene_name": "FAU", "tax_name": "Human" } ], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "P62862", "url": "https://www.uniprot.org/uniprotkb/P62862" } ], "common_name": "Mouse", "glygen_name": "Mouse", "reference_species": "Mus musculus [10090]" } ], "record_id": "pubmed.8395683", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Identification of a recognizable progressive skeletal dysplasia caused by RSPRY1 mutations.", "journal": "Am. J. Hum. Genet.", "date": "2015", "authors": "Faden M, AlZahrani F, Mendoza-Londono R, Dupuis L, Hartley T, Kannu P, Raiman JA, Howard A, Qin W, Tetreault M, Xi JQ, Al-Thamer I, Maas RL, Boycott K, Alkuraya FS", "reference": { "type": "PubMed", "id": "26365341", "url": "https://pubmed.ncbi.nlm.nih.gov/26365341" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q8BVR6-1", "protein_name": "RING finger and SPRY domain-containing protein 1", "gene_name": "Rspry1", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "Q96DX4-1", "protein_name": "RING finger and SPRY domain-containing protein 1", "gene_name": "RSPRY1", "tax_name": "Human" } ], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "Q8BVR6", "url": "https://www.uniprot.org/uniprotkb/Q8BVR6" } ], "common_name": "Mouse", "glygen_name": "Mouse", "reference_species": "Mus musculus [10090]" } ], "record_id": "pubmed.26365341", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Isolation, expression analysis and characterization of NEFA-interacting nuclear protein 30 and RING finger and SPRY domain containing 1 in skeletal muscle.", "journal": "Gene", "date": "2016", "authors": "Waddell DS, Duffin PJ, Haddock AN, Triplett VE, Saredy JJ, Kakareka KM, Eldredge JT", "reference": { "type": "PubMed", "id": "26497270", "url": "https://pubmed.ncbi.nlm.nih.gov/26497270" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q8BVR6-1", "protein_name": "RING finger and SPRY domain-containing protein 1", "gene_name": "Rspry1", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "Q91WE2-1", "protein_name": "PSME3-interacting protein", "gene_name": "Psme3ip1", "tax_name": "Mouse" } ], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "Q8BVR6", "url": "https://www.uniprot.org/uniprotkb/Q8BVR6" } ], "common_name": "Mouse", "glygen_name": "Mouse", "reference_species": "Mus musculus [10090]" } ], "record_id": "pubmed.26497270", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Localization of Nogo-A and Nogo-66 receptor proteins at sites of axon-myelin and synaptic contact.", "journal": "The Journal of neuroscience : the official journal of the Society for Neuroscience", "date": "2002", "authors": "Wang X, Chun SJ, Treloar H, Vartanian T, Greer CA, Strittmatter SM", "reference": { "type": "PubMed", "id": "12097502", "url": "https://pubmed.ncbi.nlm.nih.gov/12097502" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q99PI8-1", "protein_name": "Reticulon-4 receptor", "gene_name": "Rtn4r", "tax_name": "Mouse" } ], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "Q99PI8", "url": "https://www.uniprot.org/uniprotkb/Q99PI8" } ], "common_name": "Mouse", "glygen_name": "Mouse", "reference_species": "Mus musculus [10090]" } ], "record_id": "pubmed.12097502", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Nogo-66 receptor prevents raphespinal and rubrospinal axon regeneration and limits functional recovery from spinal cord injury.", "journal": "Neuron", "date": "2004-10-28", "authors": "Kim Ji-Eun, Liu Betty P, Park James H, Strittmatter Stephen M", "reference": { "type": "PubMed", "id": "15504325", "url": "https://pubmed.ncbi.nlm.nih.gov/15504325" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q99PI8-1", "protein_name": "Reticulon-4 receptor", "gene_name": "Rtn4r", "tax_name": "Mouse" } ], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "Q99PI8", "url": "https://www.uniprot.org/uniprotkb/Q99PI8" } ], "common_name": "Mouse", "glygen_name": "Mouse", "reference_species": "Mus musculus [10090]" } ], "record_id": "pubmed.15504325", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Genetic deletion of the Nogo receptor does not reduce neurite inhibition in vitro or promote corticospinal tract regeneration in vivo.", "journal": "Proc. Natl. Acad. Sci. U.S.A.", "date": "2005", "authors": "Zheng Binhai, Atwal Jasvinder, Ho Carole, Case Lauren, He Xiao-lin, Garcia K Christopher, Steward Oswald, Tessier-Lavigne Marc", "reference": { "type": "PubMed", "id": "15647357", "url": "https://pubmed.ncbi.nlm.nih.gov/15647357" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q99PI8-1", "protein_name": "Reticulon-4 receptor", "gene_name": "Rtn4r", "tax_name": "Mouse" } ], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "Q99PI8", "url": "https://www.uniprot.org/uniprotkb/Q99PI8" } ], "common_name": "Mouse", "glygen_name": "Mouse", "reference_species": "Mus musculus [10090]" } ], "record_id": "pubmed.15647357", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Ganglioside inhibition of neurite outgrowth requires Nogo receptor function: identification of interaction sites and development of novel antagonists.", "journal": "J. Biol. Chem.", "date": "2008", "authors": "Williams G, Wood A, Williams EJ, Gao Y, Mercado ML, Katz A, Joseph-McCarthy D, Bates B, Ling HP, Aulabaugh A, Zaccardi J, Xie Y, Pangalos MN, Walsh FS, Doherty P", "reference": { "type": "PubMed", "id": "18411262", "url": "https://pubmed.ncbi.nlm.nih.gov/18411262" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q99PI8-1", "protein_name": "Reticulon-4 receptor", "gene_name": "Rtn4r", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "Q9BZR6-1", "protein_name": "Reticulon-4 receptor", "gene_name": "RTN4R", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99M75-1", "protein_name": "Reticulon-4 receptor", "gene_name": "Rtn4r", "tax_name": "Rat" } ], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "Q99PI8", "url": "https://www.uniprot.org/uniprotkb/Q99PI8" } ], "common_name": "Mouse", "glygen_name": "Mouse", "reference_species": "Mus musculus [10090]" } ], "mutagenesis": [ { "start_pos": 151, "end_pos": 151, "sequence_org": "R", "sequence_mut": "E", "comment": "Impaired ganglioside binding.", "evidence": [ { "database": "UniProtKB", "id": "Q9BZR6", "url": "https://www.uniprot.org/uniprotkb/Q9BZR6" }, { "database": "PubMed", "id": "18411262", "url": "https://pubmed.ncbi.nlm.nih.gov/18411262" } ], "uniprot_canonical_ac": "Q9BZR6-1" }, { "start_pos": 199, "end_pos": 199, "sequence_org": "R", "sequence_mut": "E", "comment": "Impaired ganglioside binding.", "evidence": [ { "database": "UniProtKB", "id": "Q9BZR6", "url": "https://www.uniprot.org/uniprotkb/Q9BZR6" }, { "database": "PubMed", "id": "18411262", "url": "https://pubmed.ncbi.nlm.nih.gov/18411262" } ], "uniprot_canonical_ac": "Q9BZR6-1" }, { "start_pos": 277, "end_pos": 277, "sequence_org": "K", "sequence_mut": "A", "comment": "No effect on interaction with MAG.", "evidence": [ { "database": "UniProtKB", "id": "Q9BZR6", "url": "https://www.uniprot.org/uniprotkb/Q9BZR6" }, { "database": "PubMed", "id": "18411262", "url": "https://pubmed.ncbi.nlm.nih.gov/18411262" } ], "uniprot_canonical_ac": "Q9BZR6-1" }, { "start_pos": 277, "end_pos": 277, "sequence_org": "K", "sequence_mut": "D", "comment": "Decreases interaction with MAG; when associated with D-279.", "evidence": [ { "database": "UniProtKB", "id": "Q9BZR6", "url": "https://www.uniprot.org/uniprotkb/Q9BZR6" }, { "database": "PubMed", "id": "18411262", "url": "https://pubmed.ncbi.nlm.nih.gov/18411262" } ], "uniprot_canonical_ac": "Q9BZR6-1" }, { "start_pos": 279, "end_pos": 279, "sequence_org": "R", "sequence_mut": "A", "comment": "Mildly decreases interaction with MAG.", "evidence": [ { "database": "UniProtKB", "id": "Q9BZR6", "url": "https://www.uniprot.org/uniprotkb/Q9BZR6" }, { "database": "PubMed", "id": "18411262", "url": "https://pubmed.ncbi.nlm.nih.gov/18411262" } ], "uniprot_canonical_ac": "Q9BZR6-1" }, { "start_pos": 279, "end_pos": 279, "sequence_org": "R", "sequence_mut": "D", "comment": "Decreases interaction with MAG; when associated with D-277.", "evidence": [ { "database": "UniProtKB", "id": "Q9BZR6", "url": "https://www.uniprot.org/uniprotkb/Q9BZR6" }, { "database": "PubMed", "id": "18411262", "url": "https://pubmed.ncbi.nlm.nih.gov/18411262" } ], "uniprot_canonical_ac": "Q9BZR6-1" }, { "start_pos": 279, "end_pos": 279, "sequence_org": "R", "sequence_mut": "E", "comment": "Impaired ganglioside binding.", "evidence": [ { "database": "UniProtKB", "id": "Q9BZR6", "url": "https://www.uniprot.org/uniprotkb/Q9BZR6" }, { "database": "PubMed", "id": "18411262", "url": "https://pubmed.ncbi.nlm.nih.gov/18411262" } ], "uniprot_canonical_ac": "Q9BZR6-1" } ], "record_id": "pubmed.18411262", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Inhibitory activity of myelin-associated glycoprotein on sensory neurons is largely independent of NgR1 and NgR2 and resides within Ig-Like domains 4 and 5.", "journal": "PLoS ONE", "date": "2009", "authors": "Worter V, Schweigreiter R, Kinzel B, Mueller M, Barske C, Bock G, Frentzel S, Bandtlow CE", "reference": { "type": "PubMed", "id": "19367338", "url": "https://pubmed.ncbi.nlm.nih.gov/19367338" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q99PI8-1", "protein_name": "Reticulon-4 receptor", "gene_name": "Rtn4r", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "P07722-1", "protein_name": "Myelin-associated glycoprotein", "gene_name": "Mag", "tax_name": "Rat" }, { "uniprot_canonical_ac": "Q7M6Z0-1", "protein_name": "Reticulon-4 receptor-like 2", "gene_name": "Rtn4rl2", "tax_name": "Mouse" } ], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "Q99PI8", "url": "https://www.uniprot.org/uniprotkb/Q99PI8" } ], "common_name": "Mouse", "glygen_name": "Mouse", "reference_species": "Mus musculus [10090]" } ], "mutagenesis": [ { "start_pos": 118, "end_pos": 118, "sequence_org": "R", "sequence_mut": "A", "comment": "No effect on inhibition of neurite outgrowth from sensory neurons.", "evidence": [ { "database": "UniProtKB", "id": "P07722", "url": "https://www.uniprot.org/uniprotkb/P07722" }, { "database": "PubMed", "id": "19367338", "url": "https://pubmed.ncbi.nlm.nih.gov/19367338" } ], "uniprot_canonical_ac": "P07722-1" } ], "record_id": "pubmed.19367338", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Nogo-a regulates neural precursor migration in the embryonic mouse cortex.", "journal": "Cerebral cortex (New York, N.Y. : 1991)", "date": "2010-10", "authors": "Mathis Carole, Schr\u00f6ter Aileen, Thallmair Michaela, Schwab Martin E", "reference": { "type": "PubMed", "id": "20093372", "url": "https://pubmed.ncbi.nlm.nih.gov/20093372" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q99PI8-1", "protein_name": "Reticulon-4 receptor", "gene_name": "Rtn4r", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "Q9D1T0-1", "protein_name": "Leucine-rich repeat and immunoglobulin-like domain-containing nogo receptor-interacting protein 1", "gene_name": "Lingo1", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "Q99P72-2", "protein_name": "Reticulon-4", "gene_name": "Rtn4", "tax_name": "Mouse" } ], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "Q99PI8", "url": "https://www.uniprot.org/uniprotkb/Q99PI8" } ], "common_name": "Mouse", "glygen_name": "Mouse", "reference_species": "Mus musculus [10090]" } ], "record_id": "pubmed.20093372", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The nogo receptor family restricts synapse number in the developing hippocampus.", "journal": "Neuron", "date": "2012", "authors": "Wills ZP, Mandel-Brehm C, Mardinly AR, McCord AE, Giger RJ, Greenberg ME", "reference": { "type": "PubMed", "id": "22325200", "url": "https://pubmed.ncbi.nlm.nih.gov/22325200" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q99PI8-1", "protein_name": "Reticulon-4 receptor", "gene_name": "Rtn4r", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "Q80WD0-1", "protein_name": "Reticulon-4 receptor-like 1", "gene_name": "Rtn4rl1", "tax_name": "Rat" }, { "uniprot_canonical_ac": "Q80WD1-1", "protein_name": "Reticulon-4 receptor-like 2", "gene_name": "Rtn4rl2", "tax_name": "Rat" }, { "uniprot_canonical_ac": "Q86UN2-1", "protein_name": "Reticulon-4 receptor-like 1", "gene_name": "RTN4RL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BZR6-1", "protein_name": "Reticulon-4 receptor", "gene_name": "RTN4R", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99M75-1", "protein_name": "Reticulon-4 receptor", "gene_name": "Rtn4r", "tax_name": "Rat" }, { "uniprot_canonical_ac": "Q7M6Z0-1", "protein_name": "Reticulon-4 receptor-like 2", "gene_name": "Rtn4rl2", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "Q8K0S5-1", "protein_name": "Reticulon-4 receptor-like 1", "gene_name": "Rtn4rl1", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "Q86UN3-1", "protein_name": "Reticulon-4 receptor-like 2", "gene_name": "RTN4RL2", "tax_name": "Human" } ], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "Q99PI8", "url": "https://www.uniprot.org/uniprotkb/Q99PI8" } ], "common_name": "Mouse", "glygen_name": "Mouse", "reference_species": "Mus musculus [10090]" } ], "record_id": "pubmed.22325200", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 9 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Agenesis of the corpus callosum in Nogo receptor deficient mice.", "journal": "The Journal of comparative neurology", "date": "2017", "authors": "Yoo SW, Motari MG, Schnaar RL", "reference": { "type": "PubMed", "id": "27339102", "url": "https://pubmed.ncbi.nlm.nih.gov/27339102" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q99PI8-1", "protein_name": "Reticulon-4 receptor", "gene_name": "Rtn4r", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "Q7M6Z0-1", "protein_name": "Reticulon-4 receptor-like 2", "gene_name": "Rtn4rl2", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "Q8K0S5-1", "protein_name": "Reticulon-4 receptor-like 1", "gene_name": "Rtn4rl1", "tax_name": "Mouse" } ], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "Q99PI8", "url": "https://www.uniprot.org/uniprotkb/Q99PI8" } ], "common_name": "Mouse", "glygen_name": "Mouse", "reference_species": "Mus musculus [10090]" } ], "record_id": "pubmed.27339102", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Nogo Receptor crystal structures with a native disulfide pattern suggest a novel mode of self-interaction.", "journal": "Acta crystallographica. Section D, Structural biology", "date": "2017", "authors": "Pronker MF, Tas RP, Vlieg HC, Janssen BJC", "reference": { "type": "PubMed", "id": "29095159", "url": "https://pubmed.ncbi.nlm.nih.gov/29095159" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q99PI8-1", "protein_name": "Reticulon-4 receptor", "gene_name": "Rtn4r", "tax_name": "Mouse" } ], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "Q99PI8", "url": "https://www.uniprot.org/uniprotkb/Q99PI8" } ], "common_name": "Mouse", "glygen_name": "Mouse", "reference_species": "Mus musculus [10090]" } ], "glycosylation": [ { "glytoucan_ac": "", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "icn3d_view": { "label": "iCn3D", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?bcifid=7R86&bu=0&command=select+.B:179;+center+selection;+zoom+selection" }, "start_pos": 179, "start_aa": "Asn", "end_pos": 179, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn179", "evidence": [ { "id": "Q99PI8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/Q99PI8#ptm_processing" }, { "id": "5O0N", "database": "PDB", "url": "https://www.rcsb.org/sequence/5O0N" }, { "id": "5O0R", "database": "PDB", "url": "https://www.rcsb.org/sequence/5O0R" }, { "id": "5O0M", "database": "PDB", "url": "https://www.rcsb.org/sequence/5O0M" }, { "id": "5O0Q", "database": "PDB", "url": "https://www.rcsb.org/sequence/5O0Q" }, { "id": "5O0P", "database": "PDB", "url": "https://www.rcsb.org/sequence/5O0P" }, { "id": "5O0L", "database": "PDB", "url": "https://www.rcsb.org/sequence/5O0L" }, { "id": "5O0K", "database": "PDB", "url": "https://www.rcsb.org/sequence/5O0K" }, { "id": "5O0O", "database": "PDB", "url": "https://www.rcsb.org/sequence/5O0O" }, { "id": "29095159", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29095159" }, { "id": "7R86", "database": "PDB", "url": "https://www.rcsb.org/structure/7R86" } ], "filter_code": "001000000000000000000.00010000000000.00.01000", "uniprot_canonical_ac": "Q99PI8-1" }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "icn3d_view": {}, "start_pos": 372, "start_aa": "Asn", "end_pos": 372, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn372", "evidence": [ { "id": "Q99PI8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/Q99PI8#ptm_processing" }, { "id": "5O0N", "database": "PDB", "url": "https://www.rcsb.org/sequence/5O0N" }, { "id": "5O0R", "database": "PDB", "url": "https://www.rcsb.org/sequence/5O0R" }, { "id": "5O0M", "database": "PDB", "url": "https://www.rcsb.org/sequence/5O0M" }, { "id": "5O0Q", "database": "PDB", "url": "https://www.rcsb.org/sequence/5O0Q" }, { "id": "5O0P", "database": "PDB", "url": "https://www.rcsb.org/sequence/5O0P" }, { "id": "5O0L", "database": "PDB", "url": "https://www.rcsb.org/sequence/5O0L" }, { "id": "5O0K", "database": "PDB", "url": "https://www.rcsb.org/sequence/5O0K" }, { "id": "5O0O", "database": "PDB", "url": "https://www.rcsb.org/sequence/5O0O" }, { "id": "29095159", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29095159" } ], "filter_code": "001000000000000000000.00010000000000.00.01000", "uniprot_canonical_ac": "Q99PI8-1" }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "icn3d_view": { "label": "iCn3D", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?bcifid=7R86&bu=0&command=select+.B:82;+center+selection;+zoom+selection" }, "start_pos": 82, "start_aa": "Asn", "end_pos": 82, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn82", "evidence": [ { "id": "Q99PI8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/Q99PI8#ptm_processing" }, { "id": "5O0N", "database": "PDB", "url": "https://www.rcsb.org/sequence/5O0N" }, { "id": "5O0R", "database": "PDB", "url": "https://www.rcsb.org/sequence/5O0R" }, { "id": "5O0M", "database": "PDB", "url": "https://www.rcsb.org/sequence/5O0M" }, { "id": "5O0Q", "database": "PDB", "url": "https://www.rcsb.org/sequence/5O0Q" }, { "id": "5O0P", "database": "PDB", "url": "https://www.rcsb.org/sequence/5O0P" }, { "id": "5O0L", "database": "PDB", "url": "https://www.rcsb.org/sequence/5O0L" }, { "id": "5O0K", "database": "PDB", "url": "https://www.rcsb.org/sequence/5O0K" }, { "id": "5O0O", "database": "PDB", "url": "https://www.rcsb.org/sequence/5O0O" }, { "id": "29095159", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29095159" }, { "id": "7R86", "database": "PDB", "url": "https://www.rcsb.org/structure/7R86" } ], "filter_code": "001000000000000000000.00010000000000.00.01000", "uniprot_canonical_ac": "Q99PI8-1" } ], "record_id": "pubmed.29095159", "abstract": "", "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 3 }, { "field": "total_sites", "count": 3 }, { "field": "n_linked_sites", "count": 3 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "exact_sites", "count": 3 }, { "field": "exact_n_linked_sites", "count": 3 }, { "field": "fuzzy_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "icn3d_view.label", "icn3d_view.url", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl", "filter_code", "uniprot_canonical_ac" ] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 3 }, { "field": "total_sites", "count": 3 }, { "field": "n_linked_sites", "count": 3 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "exact_sites", "count": 3 }, { "field": "exact_n_linked_sites", "count": 3 }, { "field": "fuzzy_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "icn3d_view.label", "icn3d_view.url", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl", "filter_code", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Rufy3, a protein specifically expressed in neurons, interacts with actin-bundling protein Fascin to control the growth of axons.", "journal": "Journal of neurochemistry", "date": "2014", "authors": "Wei Z, Sun M, Liu X, Zhang J, Jin Y", "reference": { "type": "PubMed", "id": "24720729", "url": "https://pubmed.ncbi.nlm.nih.gov/24720729" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9D394-1", "protein_name": "Protein RUFY3", "gene_name": "Rufy3", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "Q61553-1", "protein_name": "Fascin", "gene_name": "Fscn1", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "Q9QXS6-1", "protein_name": "Drebrin", "gene_name": "Dbn1", "tax_name": "Mouse" } ], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "Q9D394", "url": "https://www.uniprot.org/uniprotkb/Q9D394" } ], "common_name": "Mouse", "glygen_name": "Mouse", "reference_species": "Mus musculus [10090]" } ], "record_id": "pubmed.24720729", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Rufy3 is an adapter protein for small GTPases that activates a Rac guanine nucleotide exchange factor to control neuronal polarity.", "journal": "The Journal of biological chemistry", "date": "2017", "authors": "Honda A, Usui H, Sakimura K, Igarashi M", "reference": { "type": "PubMed", "id": "29089386", "url": "https://pubmed.ncbi.nlm.nih.gov/29089386" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9D394-1", "protein_name": "Protein RUFY3", "gene_name": "Rufy3", "tax_name": "Mouse" } ], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "Q9D394", "url": "https://www.uniprot.org/uniprotkb/Q9D394" } ], "common_name": "Mouse", "glygen_name": "Mouse", "reference_species": "Mus musculus [10090]" } ], "record_id": "pubmed.29089386", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Neuronally Enriched RUFY3 Is Required for Caspase-Mediated Axon Degeneration.", "journal": "Neuron", "date": "2019", "authors": "Hertz NT, Adams EL, Weber RA, Shen RJ, O'Rourke MK, Simon DJ, Zebroski H, Olsen O, Morgan CW, Mileur TR, Hitchcock AM, Sinnott Armstrong NA, Wainberg M, Bassik MC, Molina H, Wells JA, Tessier-Lavigne M", "reference": { "type": "PubMed", "id": "31221560", "url": "https://pubmed.ncbi.nlm.nih.gov/31221560" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9D394-1", "protein_name": "Protein RUFY3", "gene_name": "Rufy3", "tax_name": "Mouse" } ], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "Q9D394", "url": "https://www.uniprot.org/uniprotkb/Q9D394" } ], "common_name": "Mouse", "glygen_name": "Mouse", "reference_species": "Mus musculus [10090]" } ], "record_id": "pubmed.31221560", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Vitamin C transporter SVCT1 serves a physiological role as a urate importer: functional analyses and in vivo investigations.", "journal": "Pflugers Archiv : European journal of physiology", "date": "2023-04", "authors": "Toyoda Yu, Miyata Hiroshi, Uchida Naohiro, Morimoto Keito, Shigesawa Ryuichiro, Kassai Hidetoshi, Nakao Kazuki, Tomioka Naoko H, Matsuo Hirotaka, Ichida Kimiyoshi, Hosoyamada Makoto, Aiba Atsu, Suzuki Hiroshi, Takada Tappei", "reference": { "type": "PubMed", "id": "36749388", "url": "https://pubmed.ncbi.nlm.nih.gov/36749388" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9Z2J0-1", "protein_name": "Solute carrier family 23 member 1", "gene_name": "Slc23a1", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "Q9UHI7-1", "protein_name": "Solute carrier family 23 member 1", "gene_name": "SLC23A1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NRM0-1", "protein_name": "Solute carrier family 2, facilitated glucose transporter member 9", "gene_name": "SLC2A9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UNQ0-1", "protein_name": "Broad substrate specificity ATP-binding cassette transporter ABCG2", "gene_name": "ABCG2", "tax_name": "Human" } ], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "Q9Z2J0", "url": "https://www.uniprot.org/uniprotkb/Q9Z2J0" } ], "common_name": "Mouse", "glygen_name": "Mouse", "reference_species": "Mus musculus [10090]" } ], "record_id": "pubmed.36749388", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 4 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Structural basis of vitamin C recognition and transport by mammalian SVCT1 transporter.", "journal": "Nature communications", "date": "2023-03-13", "authors": "Wang Mingxing, He Jin, Li Shanshan, Cai Qianwen, Zhang Kaiming, She Ji", "reference": { "type": "PubMed", "id": "36914666", "url": "https://pubmed.ncbi.nlm.nih.gov/36914666" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9Z2J0-1", "protein_name": "Solute carrier family 23 member 1", "gene_name": "Slc23a1", "tax_name": "Mouse" } ], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "Q9Z2J0", "url": "https://www.uniprot.org/uniprotkb/Q9Z2J0" } ], "common_name": "Mouse", "glygen_name": "Mouse", "reference_species": "Mus musculus [10090]" } ], "record_id": "pubmed.36914666", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Molecular characterization of two novel transporters from human and mouse kidney and from LLC-PK1 cells reveals a novel conserved family that is homologous to bacterial and Aspergillus nucleobase transporters.", "journal": "Biochim. Biophys. Acta", "date": "1998", "authors": "Faaland C A, Race J E, Ricken G, Warner F J, Williams W J, Holtzman E J", "reference": { "type": "PubMed", "id": "9804989", "url": "https://pubmed.ncbi.nlm.nih.gov/9804989" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9Z2J0-1", "protein_name": "Solute carrier family 23 member 1", "gene_name": "Slc23a1", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "Q9UGH3-1", "protein_name": "Solute carrier family 23 member 2", "gene_name": "SLC23A2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UHI7-1", "protein_name": "Solute carrier family 23 member 1", "gene_name": "SLC23A1", "tax_name": "Human" } ], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "Q9Z2J0", "url": "https://www.uniprot.org/uniprotkb/Q9Z2J0" } ], "common_name": "Mouse", "glygen_name": "Mouse", "reference_species": "Mus musculus [10090]" } ], "record_id": "pubmed.9804989", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Identification and expression of a novel 3'-exon of mouse Runx1/Pebp2alphaB/Cbfa2/AML1 gene.", "journal": "Biochem. Biophys. Res. Commun.", "date": "2000", "authors": "Tsuji K, Noda M", "reference": { "type": "PubMed", "id": "10903914", "url": "https://pubmed.ncbi.nlm.nih.gov/10903914" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q03347-1", "protein_name": "Runt-related transcription factor 1", "gene_name": "Runx1", "tax_name": "Mouse" } ], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "Q03347", "url": "https://www.uniprot.org/uniprotkb/Q03347" } ], "common_name": "Mouse", "glygen_name": "Mouse", "reference_species": "Mus musculus [10090]" } ], "record_id": "pubmed.10903914", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Expression and function of a stem cell promoter for the murine CBFalpha2 gene: distinct roles and regulation in natural killer and T cell development.", "journal": "Developmental biology", "date": "2001-01-15", "authors": "Telfer J C, Rothenberg E V", "reference": { "type": "PubMed", "id": "11203699", "url": "https://pubmed.ncbi.nlm.nih.gov/11203699" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q03347-1", "protein_name": "Runt-related transcription factor 1", "gene_name": "Runx1", "tax_name": "Mouse" } ], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "Q03347", "url": "https://www.uniprot.org/uniprotkb/Q03347" } ], "common_name": "Mouse", "glygen_name": "Mouse", "reference_species": "Mus musculus [10090]" } ], "record_id": "pubmed.11203699", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Identification of an alternatively spliced form of the mouse AML1/RUNX1 gene transcript AML1c and its expression in early hematopoietic development.", "journal": "Biochem. Biophys. Res. Commun.", "date": "2001", "authors": "Fujita Y, Nishimura M, Taniwaki M, Abe T, Okuda T", "reference": { "type": "PubMed", "id": "11243869", "url": "https://pubmed.ncbi.nlm.nih.gov/11243869" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q03347-1", "protein_name": "Runt-related transcription factor 1", "gene_name": "Runx1", "tax_name": "Mouse" } ], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "Q03347", "url": "https://www.uniprot.org/uniprotkb/Q03347" } ], "common_name": "Mouse", "glygen_name": "Mouse", "reference_species": "Mus musculus [10090]" } ], "record_id": "pubmed.11243869", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Structural analyses of DNA recognition by the AML1/Runx-1 Runt domain and its allosteric control by CBFbeta.", "journal": "Cell", "date": "2001", "authors": "Tahirov TH, Inoue-Bungo T, Morii H, Fujikawa A, Sasaki M, Kimura K, Shiina M, Sato K, Kumasaka T, Yamamoto M, Ishii S, Ogata K", "reference": { "type": "PubMed", "id": "11257229", "url": "https://pubmed.ncbi.nlm.nih.gov/11257229" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q03347-1", "protein_name": "Runt-related transcription factor 1", "gene_name": "Runx1", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "Q08024-1", "protein_name": "Core-binding factor subunit beta", "gene_name": "Cbfb", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "P17676-1", "protein_name": "CCAAT/enhancer-binding protein beta", "gene_name": "CEBPB", "tax_name": "Human" } ], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "Q03347", "url": "https://www.uniprot.org/uniprotkb/Q03347" } ], "common_name": "Mouse", "glygen_name": "Mouse", "reference_species": "Mus musculus [10090]" } ], "mutagenesis": [ { "start_pos": 109, "end_pos": 109, "sequence_org": "N", "sequence_mut": "A", "comment": "Interferes with heterodimerization.", "evidence": [ { "database": "UniProtKB", "id": "Q03347", "url": "https://www.uniprot.org/uniprotkb/Q03347" }, { "database": "PubMed", "id": "11257229", "url": "https://pubmed.ncbi.nlm.nih.gov/11257229" } ], "uniprot_canonical_ac": "Q03347-1" }, { "start_pos": 113, "end_pos": 113, "sequence_org": "Y", "sequence_mut": "A", "comment": "Interferes with heterodimerization.", "evidence": [ { "database": "UniProtKB", "id": "Q03347", "url": "https://www.uniprot.org/uniprotkb/Q03347" }, { "database": "PubMed", "id": "11257229", "url": "https://pubmed.ncbi.nlm.nih.gov/11257229" } ], "uniprot_canonical_ac": "Q03347-1" }, { "start_pos": 142, "end_pos": 142, "sequence_org": "R", "sequence_mut": "A", "comment": "Interferes with DNA-binding.", "evidence": [ { "database": "UniProtKB", "id": "Q03347", "url": "https://www.uniprot.org/uniprotkb/Q03347" }, { "database": "PubMed", "id": "11257229", "url": "https://pubmed.ncbi.nlm.nih.gov/11257229" } ], "uniprot_canonical_ac": "Q03347-1" }, { "start_pos": 144, "end_pos": 144, "sequence_org": "K", "sequence_mut": "M", "comment": "Interferes with DNA-binding.", "evidence": [ { "database": "UniProtKB", "id": "Q03347", "url": "https://www.uniprot.org/uniprotkb/Q03347" }, { "database": "PubMed", "id": "11257229", "url": "https://pubmed.ncbi.nlm.nih.gov/11257229" } ], "uniprot_canonical_ac": "Q03347-1" }, { "start_pos": 149, "end_pos": 149, "sequence_org": "T", "sequence_mut": "A", "comment": "Interferes with heterodimerization.", "evidence": [ { "database": "UniProtKB", "id": "Q03347", "url": "https://www.uniprot.org/uniprotkb/Q03347" }, { "database": "PubMed", "id": "11257229", "url": "https://pubmed.ncbi.nlm.nih.gov/11257229" } ], "uniprot_canonical_ac": "Q03347-1" }, { "start_pos": 170, "end_pos": 170, "sequence_org": "V", "sequence_mut": "A", "comment": "No effect.", "evidence": [ { "database": "UniProtKB", "id": "Q03347", "url": "https://www.uniprot.org/uniprotkb/Q03347" }, { "database": "PubMed", "id": "11257229", "url": "https://pubmed.ncbi.nlm.nih.gov/11257229" } ], "uniprot_canonical_ac": "Q03347-1" }, { "start_pos": 171, "end_pos": 171, "sequence_org": "D", "sequence_mut": "A", "comment": "Interferes with DNA-binding.", "evidence": [ { "database": "UniProtKB", "id": "Q03347", "url": "https://www.uniprot.org/uniprotkb/Q03347" }, { "database": "PubMed", "id": "11257229", "url": "https://pubmed.ncbi.nlm.nih.gov/11257229" } ], "uniprot_canonical_ac": "Q03347-1" }, { "start_pos": 174, "end_pos": 174, "sequence_org": "R", "sequence_mut": "A", "comment": "Interferes with DNA-binding.", "evidence": [ { "database": "UniProtKB", "id": "Q03347", "url": "https://www.uniprot.org/uniprotkb/Q03347" }, { "database": "PubMed", "id": "11257229", "url": "https://pubmed.ncbi.nlm.nih.gov/11257229" } ], "uniprot_canonical_ac": "Q03347-1" }, { "start_pos": 177, "end_pos": 177, "sequence_org": "R", "sequence_mut": "A", "comment": "Interferes with DNA-binding.", "evidence": [ { "database": "UniProtKB", "id": "Q03347", "url": "https://www.uniprot.org/uniprotkb/Q03347" }, { "database": "PubMed", "id": "11257229", "url": "https://pubmed.ncbi.nlm.nih.gov/11257229" } ], "uniprot_canonical_ac": "Q03347-1" }, { "start_pos": 80, "end_pos": 80, "sequence_org": "R", "sequence_mut": "A", "comment": "Interferes with DNA-binding.", "evidence": [ { "database": "UniProtKB", "id": "Q03347", "url": "https://www.uniprot.org/uniprotkb/Q03347" }, { "database": "PubMed", "id": "11257229", "url": "https://pubmed.ncbi.nlm.nih.gov/11257229" } ], "uniprot_canonical_ac": "Q03347-1" }, { "start_pos": 104, "end_pos": 104, "sequence_org": "N", "sequence_mut": "A", "comment": "Interferes with heterodimerization.", "evidence": [ { "database": "UniProtKB", "id": "Q08024", "url": "https://www.uniprot.org/uniprotkb/Q08024" }, { "database": "PubMed", "id": "11257229", "url": "https://pubmed.ncbi.nlm.nih.gov/11257229" } ], "uniprot_canonical_ac": "Q08024-1" }, { "start_pos": 5, "end_pos": 5, "sequence_org": "V", "sequence_mut": "A", "comment": "Interferes with heterodimerization.", "evidence": [ { "database": "UniProtKB", "id": "Q08024", "url": "https://www.uniprot.org/uniprotkb/Q08024" }, { "database": "PubMed", "id": "11257229", "url": "https://pubmed.ncbi.nlm.nih.gov/11257229" } ], "uniprot_canonical_ac": "Q08024-1" }, { "start_pos": 63, "end_pos": 63, "sequence_org": "N", "sequence_mut": "A", "comment": "Interferes with heterodimerization.", "evidence": [ { "database": "UniProtKB", "id": "Q08024", "url": "https://www.uniprot.org/uniprotkb/Q08024" }, { "database": "PubMed", "id": "11257229", "url": "https://pubmed.ncbi.nlm.nih.gov/11257229" } ], "uniprot_canonical_ac": "Q08024-1" } ], "record_id": "pubmed.11257229", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Crystallization and preliminary X-ray analyses of quaternary, ternary and binary protein-DNA complexes with involvement of AML1/Runx-1/CBFalpha Runt domain, CBFbeta and the C/EBPbeta bZip region.", "journal": "Acta Crystallogr. D", "date": "2001", "authors": "Tahirov T H, Inoue-Bungo T, Sasaki M, Shiina M, Kimura K, Sato K, Kumasaka T, Yamamoto M, Kamiya N, Ogata K", "reference": { "type": "PubMed", "id": "11375505", "url": "https://pubmed.ncbi.nlm.nih.gov/11375505" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q03347-1", "protein_name": "Runt-related transcription factor 1", "gene_name": "Runx1", "tax_name": "Mouse" } ], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "Q03347", "url": "https://www.uniprot.org/uniprotkb/Q03347" } ], "common_name": "Mouse", "glygen_name": "Mouse", "reference_species": "Mus musculus [10090]" } ], "record_id": "pubmed.11375505", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The RUNX1 Runt domain at 1.25A resolution: a structural switch and specifically bound chloride ions modulate DNA binding.", "journal": "J. Mol. Biol.", "date": "2002", "authors": "B\u00e4ckstr\u00f6m Stefan, Wolf-Watz Magnus, Grundstr\u00f6m Christine, H\u00e4rd Torleif, Grundstr\u00f6m Thomas, Sauer Uwe H", "reference": { "type": "PubMed", "id": "12217689", "url": "https://pubmed.ncbi.nlm.nih.gov/12217689" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q03347-1", "protein_name": "Runt-related transcription factor 1", "gene_name": "Runx1", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "Q01196-1", "protein_name": "Runt-related transcription factor 1", "gene_name": "RUNX1", "tax_name": "Human" } ], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "Q03347", "url": "https://www.uniprot.org/uniprotkb/Q03347" } ], "common_name": "Mouse", "glygen_name": "Mouse", "reference_species": "Mus musculus [10090]" } ], "record_id": "pubmed.12217689", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "T-bet represses T(H)17 differentiation by preventing Runx1-mediated activation of the gene encoding RORgammat.", "journal": "Nature immunology", "date": "2011", "authors": "Lazarevic V, Chen X, Shim JH, Hwang ES, Jang E, Bolm AN, Oukka M, Kuchroo VK, Glimcher LH", "reference": { "type": "PubMed", "id": "21151104", "url": "https://pubmed.ncbi.nlm.nih.gov/21151104" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q03347-1", "protein_name": "Runt-related transcription factor 1", "gene_name": "Runx1", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "Q64131-1", "protein_name": "Runt-related transcription factor 3", "gene_name": "Runx3", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "Q9JKD8-1", "protein_name": "T-box transcription factor TBX21", "gene_name": "Tbx21", "tax_name": "Mouse" } ], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "Q03347", "url": "https://www.uniprot.org/uniprotkb/Q03347" } ], "common_name": "Mouse", "glygen_name": "Mouse", "reference_species": "Mus musculus [10090]" } ], "mutagenesis": [ { "start_pos": 265, "end_pos": 265, "sequence_org": "Y", "sequence_mut": "F", "comment": "No loss of interaction with RUNX1.", "evidence": [ { "database": "UniProtKB", "id": "Q9JKD8", "url": "https://www.uniprot.org/uniprotkb/Q9JKD8" }, { "database": "PubMed", "id": "21151104", "url": "https://pubmed.ncbi.nlm.nih.gov/21151104" } ], "uniprot_canonical_ac": "Q9JKD8-1" }, { "start_pos": 304, "end_pos": 304, "sequence_org": "Y", "sequence_mut": "F", "comment": "Loss of interaction with RUNX1 and loss of its ability to inhibit RUNX1 transcriptional activity and suppress TH17 lineage development. Significant loss of ABL1-mediated phosphorylation and loss of transcriptional activator activity; when associated with F-219 and F-225.", "evidence": [ { "database": "UniProtKB", "id": "Q9JKD8", "url": "https://www.uniprot.org/uniprotkb/Q9JKD8" }, { "database": "PubMed", "id": "21690296", "url": "https://pubmed.ncbi.nlm.nih.gov/21690296" }, { "database": "PubMed", "id": "21151104", "url": "https://pubmed.ncbi.nlm.nih.gov/21151104" } ], "uniprot_canonical_ac": "Q9JKD8-1" }, { "start_pos": 508, "end_pos": 508, "sequence_org": "S", "sequence_mut": "A", "comment": "No loss of interaction with RUNX1. No loss in its ability to induce IFN-gamma.", "evidence": [ { "database": "UniProtKB", "id": "Q9JKD8", "url": "https://www.uniprot.org/uniprotkb/Q9JKD8" }, { "database": "PubMed", "id": "28424242", "url": "https://pubmed.ncbi.nlm.nih.gov/28424242" }, { "database": "PubMed", "id": "21151104", "url": "https://pubmed.ncbi.nlm.nih.gov/21151104" } ], "uniprot_canonical_ac": "Q9JKD8-1" }, { "start_pos": 525, "end_pos": 525, "sequence_org": "Y", "sequence_mut": "F", "comment": "No loss of interaction with RUNX1. Loss of interaction with ITK and GATA3.", "evidence": [ { "database": "UniProtKB", "id": "Q9JKD8", "url": "https://www.uniprot.org/uniprotkb/Q9JKD8" }, { "database": "PubMed", "id": "15662016", "url": "https://pubmed.ncbi.nlm.nih.gov/15662016" }, { "database": "PubMed", "id": "21151104", "url": "https://pubmed.ncbi.nlm.nih.gov/21151104" } ], "uniprot_canonical_ac": "Q9JKD8-1" } ], "record_id": "pubmed.21151104", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "PEBP2 alpha B/mouse AML1 consists of multiple isoforms that possess differential transactivation potentials.", "journal": "Mol. Cell. Biol.", "date": "1994", "authors": "Bae S C, Ogawa E, Maruyama M, Oka H, Satake M, Shigesada K, Jenkins N A, Gilbert D J, Copeland N G, Ito Y", "reference": { "type": "PubMed", "id": "8164679", "url": "https://pubmed.ncbi.nlm.nih.gov/8164679" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q03347-1", "protein_name": "Runt-related transcription factor 1", "gene_name": "Runx1", "tax_name": "Mouse" } ], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "Q03347", "url": "https://www.uniprot.org/uniprotkb/Q03347" } ], "common_name": "Mouse", "glygen_name": "Mouse", "reference_species": "Mus musculus [10090]" } ], "record_id": "pubmed.8164679", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Isolation of PEBP2 alpha B cDNA representing the mouse homolog of human acute myeloid leukemia gene, AML1.", "journal": "Oncogene", "date": "1993", "authors": "Bae SC, Yamaguchi-Iwai Y, Ogawa E, Maruyama M, Inuzuka M, Kagoshima H, Shigesada K, Satake M, Ito Y", "reference": { "type": "PubMed", "id": "8437866", "url": "https://pubmed.ncbi.nlm.nih.gov/8437866" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q03347-1", "protein_name": "Runt-related transcription factor 1", "gene_name": "Runx1", "tax_name": "Mouse" } ], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "Q03347", "url": "https://www.uniprot.org/uniprotkb/Q03347" } ], "common_name": "Mouse", "glygen_name": "Mouse", "reference_species": "Mus musculus [10090]" } ], "record_id": "pubmed.8437866", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "AML1, the target of multiple chromosomal translocations in human leukemia, is essential for normal fetal liver hematopoiesis.", "journal": "Cell", "date": "1996", "authors": "Okuda T, van Deursen J, Hiebert S W, Grosveld G, Downing J R", "reference": { "type": "PubMed", "id": "8565077", "url": "https://pubmed.ncbi.nlm.nih.gov/8565077" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q03347-1", "protein_name": "Runt-related transcription factor 1", "gene_name": "Runx1", "tax_name": "Mouse" } ], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "Q03347", "url": "https://www.uniprot.org/uniprotkb/Q03347" } ], "common_name": "Mouse", "glygen_name": "Mouse", "reference_species": "Mus musculus [10090]" } ], "record_id": "pubmed.8565077", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Disruption of the Cbfa2 gene causes necrosis and hemorrhaging in the central nervous system and blocks definitive hematopoiesis.", "journal": "Proc. Natl. Acad. Sci. U.S.A.", "date": "1996", "authors": "Wang Q, Stacy T, Binder M, Marin-Padilla M, Sharpe A H, Speck N A", "reference": { "type": "PubMed", "id": "8622955", "url": "https://pubmed.ncbi.nlm.nih.gov/8622955" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q03347-1", "protein_name": "Runt-related transcription factor 1", "gene_name": "Runx1", "tax_name": "Mouse" } ], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "Q03347", "url": "https://www.uniprot.org/uniprotkb/Q03347" } ], "common_name": "Mouse", "glygen_name": "Mouse", "reference_species": "Mus musculus [10090]" } ], "record_id": "pubmed.8622955", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Genomic structure of and a cardiac promoter for the mouse carnitine palmitoyltransferase II gene.", "journal": "Genomics", "date": "1993", "authors": "Gelb BD", "reference": { "type": "PubMed", "id": "8307575", "url": "https://pubmed.ncbi.nlm.nih.gov/8307575" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P52825-1", "protein_name": "Carnitine O-palmitoyltransferase 2, mitochondrial", "gene_name": "Cpt2", "tax_name": "Mouse" } ], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "P52825", "url": "https://www.uniprot.org/uniprotkb/P52825" } ], "common_name": "Mouse", "glygen_name": "Mouse", "reference_species": "Mus musculus [10090]" } ], "record_id": "pubmed.8307575", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Caveolin-3 promotes nicotinic acetylcholine receptor clustering and regulates neuromuscular junction activity.", "journal": "Mol. Biol. Cell", "date": "2010", "authors": "Hezel Michael, de Groat William C, Galbiati Ferruccio", "reference": { "type": "PubMed", "id": "19940021", "url": "https://pubmed.ncbi.nlm.nih.gov/19940021" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P51637-1", "protein_name": "Caveolin-3", "gene_name": "Cav3", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "Q61006-1", "protein_name": "Muscle, skeletal receptor tyrosine-protein kinase", "gene_name": "Musk", "tax_name": "Mouse" } ], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "P51637", "url": "https://www.uniprot.org/uniprotkb/P51637" } ], "common_name": "Mouse", "glygen_name": "Mouse", "reference_species": "Mus musculus [10090]" } ], "record_id": "pubmed.19940021", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Popeye domain containing 1 (Popdc1/Bves) is a caveolae-associated protein involved in ischemia tolerance.", "journal": "PLoS ONE", "date": "2013", "authors": "Alcalay Y, Hochhauser E, Kliminski V, Dick J, Zahalka MA, Parnes D, Schlesinger H, Abassi Z, Shainberg A, Schindler RF, Brand T, Kessler-Icekson G", "reference": { "type": "PubMed", "id": "24066022", "url": "https://pubmed.ncbi.nlm.nih.gov/24066022" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P51637-1", "protein_name": "Caveolin-3", "gene_name": "Cav3", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "Q3BCU4-1", "protein_name": "Popeye domain-containing protein 1", "gene_name": "Popdc1", "tax_name": "Rat" }, { "uniprot_canonical_ac": "Q9ES83-1", "protein_name": "Popeye domain-containing protein 1", "gene_name": "Popdc1", "tax_name": "Mouse" } ], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "P51637", "url": "https://www.uniprot.org/uniprotkb/P51637" } ], "common_name": "Mouse", "glygen_name": "Mouse", "reference_species": "Mus musculus [10090]" } ], "record_id": "pubmed.24066022", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The coiled-coil domain of MURC/cavin-4 is involved in membrane trafficking of caveolin-3 in cardiomyocytes.", "journal": "Am. J. Physiol.", "date": "2015", "authors": "Naito D, Ogata T, Hamaoka T, Nakanishi N, Miyagawa K, Maruyama N, Kasahara T, Taniguchi T, Nishi M, Matoba S, Ueyama T", "reference": { "type": "PubMed", "id": "26497963", "url": "https://pubmed.ncbi.nlm.nih.gov/26497963" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P51637-1", "protein_name": "Caveolin-3", "gene_name": "Cav3", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "A2AMM0-1", "protein_name": "Caveolae-associated protein 4", "gene_name": "Cavin4", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "P56539-1", "protein_name": "Caveolin-3", "gene_name": "CAV3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5BKX8-1", "protein_name": "Caveolae-associated protein 4", "gene_name": "CAVIN4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51638-1", "protein_name": "Caveolin-3", "gene_name": "Cav3", "tax_name": "Rat" }, { "uniprot_canonical_ac": "B1PRL5-1", "protein_name": "Caveolae-associated protein 4", "gene_name": "Cavin4", "tax_name": "Rat" } ], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "P51637", "url": "https://www.uniprot.org/uniprotkb/P51637" } ], "common_name": "Mouse", "glygen_name": "Mouse", "reference_species": "Mus musculus [10090]" } ], "record_id": "pubmed.26497963", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 6 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Cav3.2 T-type calcium channel mediates acute itch and contributes to chronic itch and inflammation in experimental atopic dermatitis.", "journal": "The Journal of investigative dermatology", "date": "2023-10-18", "authors": "Ahn Ji-Woong, Kim Song-Ee, Kim Do-Young, Jeong Inhye, Kim Sohyun, Chung Seungsoo, Lee Sang Eun", "reference": { "type": "PubMed", "id": "37863387", "url": "https://pubmed.ncbi.nlm.nih.gov/37863387" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P51637-1", "protein_name": "Caveolin-3", "gene_name": "Cav3", "tax_name": "Mouse" } ], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "P51637", "url": "https://www.uniprot.org/uniprotkb/P51637" } ], "common_name": "Mouse", "glygen_name": "Mouse", "reference_species": "Mus musculus [10090]" } ], "record_id": "pubmed.37863387", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "CAV3 alleviates diabetic cardiomyopathy via inhibiting NDUFA10-mediated mitochondrial dysfunction.", "journal": "Journal of translational medicine", "date": "2024-04-26", "authors": "Guo Ping, Hu Shuiqing, Liu Xiaohui, He Miaomiao, Li Jie, Ma Tingqiong, Huang Man, Fang Qin, Wang Yan", "reference": { "type": "PubMed", "id": "38671439", "url": "https://pubmed.ncbi.nlm.nih.gov/38671439" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P51637-1", "protein_name": "Caveolin-3", "gene_name": "Cav3", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "Q99LC3-1", "protein_name": "NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrial", "gene_name": "Ndufa10", "tax_name": "Mouse" } ], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "P51637", "url": "https://www.uniprot.org/uniprotkb/P51637" } ], "common_name": "Mouse", "glygen_name": "Mouse", "reference_species": "Mus musculus [10090]" } ], "record_id": "pubmed.38671439", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "M-caveolin, a muscle-specific caveolin-related protein.", "journal": "FEBS Lett.", "date": "1995", "authors": "Way M, Parton R G", "reference": { "type": "PubMed", "id": "8521953", "url": "https://pubmed.ncbi.nlm.nih.gov/8521953" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P51637-1", "protein_name": "Caveolin-3", "gene_name": "Cav3", "tax_name": "Mouse" } ], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "P51637", "url": "https://www.uniprot.org/uniprotkb/P51637" } ], "common_name": "Mouse", "glygen_name": "Mouse", "reference_species": "Mus musculus [10090]" } ], "record_id": "pubmed.8521953", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Clasps are CLIP-115 and -170 associating proteins involved in the regional regulation of microtubule dynamics in motile fibroblasts.", "journal": "Cell", "date": "2001", "authors": "Akhmanova A, Hoogenraad CC, Drabek K, Stepanova T, Dortland B, Verkerk T, Vermeulen W, Burgering BM, De Zeeuw CI, Grosveld F, Galjart N", "reference": { "type": "PubMed", "id": "11290329", "url": "https://pubmed.ncbi.nlm.nih.gov/11290329" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q8BRT1-1", "protein_name": "CLIP-associating protein 2", "gene_name": "Clasp2", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "O75122-1", "protein_name": "CLIP-associating protein 2", "gene_name": "CLASP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q80TV8-1", "protein_name": "CLIP-associating protein 1", "gene_name": "Clasp1", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "Q9JK25-1", "protein_name": "CAP-Gly domain-containing linker protein 1", "gene_name": "Clip1", "tax_name": "Rat" }, { "uniprot_canonical_ac": "Q99JD4-1", "protein_name": "CLIP-associating protein 2", "gene_name": "Clasp2", "tax_name": "Rat" }, { "uniprot_canonical_ac": "Q9Z0H8-1", "protein_name": "CAP-Gly domain-containing linker protein 2", "gene_name": "Clip2", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "Q9UDT6-1", "protein_name": "CAP-Gly domain-containing linker protein 2", "gene_name": "CLIP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q7Z460-1", "protein_name": "CLIP-associating protein 1", "gene_name": "CLASP1", "tax_name": "Human" } ], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "Q8BRT1", "url": "https://www.uniprot.org/uniprotkb/Q8BRT1" } ], "common_name": "Mouse", "glygen_name": "Mouse", "reference_species": "Mus musculus [10090]" } ], "mutagenesis": [ { "start_pos": 10, "end_pos": 10, "sequence_org": "C", "sequence_mut": "S", "comment": "Impairs Golgi localization; when associated with S-6.", "evidence": [ { "database": "UniProtKB", "id": "Q8BRT1", "url": "https://www.uniprot.org/uniprotkb/Q8BRT1" }, { "database": "PubMed", "id": "11290329", "url": "https://pubmed.ncbi.nlm.nih.gov/11290329" } ], "uniprot_canonical_ac": "Q8BRT1-1" }, { "start_pos": 6, "end_pos": 6, "sequence_org": "C", "sequence_mut": "S", "comment": "Impairs Golgi localization; when associated with S-10.", "evidence": [ { "database": "UniProtKB", "id": "Q8BRT1", "url": "https://www.uniprot.org/uniprotkb/Q8BRT1" }, { "database": "PubMed", "id": "11290329", "url": "https://pubmed.ncbi.nlm.nih.gov/11290329" } ], "uniprot_canonical_ac": "Q8BRT1-1" } ], "record_id": "pubmed.11290329", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 8 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "PAR-1 and the microtubule-associated proteins CLASP2 and dynactin-p50 have specific localisation on mouse meiotic and first mitotic spindles.", "journal": "Reproduction", "date": "2005", "authors": "Moore Catherine A, Zernicka-Goetz Magdalena", "reference": { "type": "PubMed", "id": "16123238", "url": "https://pubmed.ncbi.nlm.nih.gov/16123238" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q8BRT1-1", "protein_name": "CLIP-associating protein 2", "gene_name": "Clasp2", "tax_name": "Mouse" } ], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "Q8BRT1", "url": "https://www.uniprot.org/uniprotkb/Q8BRT1" } ], "common_name": "Mouse", "glygen_name": "Mouse", "reference_species": "Mus musculus [10090]" } ], "record_id": "pubmed.16123238", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Mammalian CLASP1 and CLASP2 cooperate to ensure mitotic fidelity by regulating spindle and kinetochore function.", "journal": "Molecular biology of the cell", "date": "2006-10", "authors": "Pereira Ana L, Pereira Ant\u00f3nio J, Maia Ana R R, Drabek Ksenija, Sayas C Laura, Hergert Polla J, Lince-Faria Mariana, Matos Irina, Duque Cristina, Stepanova Tatiana, Rieder Conly L, Earnshaw William C, Galjart Niels, Maiato Helder", "reference": { "type": "PubMed", "id": "16914514", "url": "https://pubmed.ncbi.nlm.nih.gov/16914514" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q8BRT1-1", "protein_name": "CLIP-associating protein 2", "gene_name": "Clasp2", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "O75122-1", "protein_name": "CLIP-associating protein 2", "gene_name": "CLASP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q7Z460-1", "protein_name": "CLIP-associating protein 1", "gene_name": "CLASP1", "tax_name": "Human" } ], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "Q8BRT1", "url": "https://www.uniprot.org/uniprotkb/Q8BRT1" } ], "common_name": "Mouse", "glygen_name": "Mouse", "reference_species": "Mus musculus [10090]" } ], "record_id": "pubmed.16914514", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "CLASP2 has two distinct TOG domains that contribute differently to microtubule dynamics.", "journal": "J. Mol. Biol.", "date": "2015", "authors": "Maki T, Grimaldi AD, Fuchigami S, Kaverina I, Hayashi I", "reference": { "type": "PubMed", "id": "26003921", "url": "https://pubmed.ncbi.nlm.nih.gov/26003921" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q8BRT1-1", "protein_name": "CLIP-associating protein 2", "gene_name": "Clasp2", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "O75122-1", "protein_name": "CLIP-associating protein 2", "gene_name": "CLASP2", "tax_name": "Human" } ], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "Q8BRT1", "url": "https://www.uniprot.org/uniprotkb/Q8BRT1" } ], "common_name": "Mouse", "glygen_name": "Mouse", "reference_species": "Mus musculus [10090]" } ], "mutagenesis": [ { "start_pos": 106, "end_pos": 106, "sequence_org": "W", "sequence_mut": "E", "comment": "Decreases affinity for microtubules; when associated with A-191; E-667; E-833; A-838 and A-839.", "evidence": [ { "database": "UniProtKB", "id": "O75122", "url": "https://www.uniprot.org/uniprotkb/O75122" }, { "database": "PubMed", "id": "26003921", "url": "https://pubmed.ncbi.nlm.nih.gov/26003921" } ], "uniprot_canonical_ac": "O75122-1" }, { "start_pos": 191, "end_pos": 191, "sequence_org": "K", "sequence_mut": "A", "comment": "Decreases affinity for microtubules; when associated with E-106; E-667; E-833; A-838 and A-839.", "evidence": [ { "database": "UniProtKB", "id": "O75122", "url": "https://www.uniprot.org/uniprotkb/O75122" }, { "database": "PubMed", "id": "26003921", "url": "https://pubmed.ncbi.nlm.nih.gov/26003921" } ], "uniprot_canonical_ac": "O75122-1" }, { "start_pos": 496, "end_pos": 497, "sequence_org": "IP", "sequence_mut": "AA", "comment": "No effect on MAPRE1 binding. Abolishes interaction with MAPRE1; when associated with 519-A-A-520.", "evidence": [ { "database": "UniProtKB", "id": "O75122", "url": "https://www.uniprot.org/uniprotkb/O75122" }, { "database": "PubMed", "id": "26003921", "url": "https://pubmed.ncbi.nlm.nih.gov/26003921" } ], "uniprot_canonical_ac": "O75122-1" }, { "start_pos": 499, "end_pos": 499, "sequence_org": "S", "sequence_mut": "D", "comment": "Phosphomimetic mutant that reduces MAPRE1 binding; when associated with D-503; D-507; D-525; D-529; D-533; D-537 and D-541.", "evidence": [ { "database": "UniProtKB", "id": "O75122", "url": "https://www.uniprot.org/uniprotkb/O75122" }, { "database": "PubMed", "id": "26003921", "url": "https://pubmed.ncbi.nlm.nih.gov/26003921" } ], "uniprot_canonical_ac": "O75122-1" }, { "start_pos": 503, "end_pos": 503, "sequence_org": "S", "sequence_mut": "D", "comment": "Phosphomimetic mutant that reduces MAPRE1 binding; when associated with D-499; D-507; D-525; D-529; D-533; D-537 and D-541.", "evidence": [ { "database": "UniProtKB", "id": "O75122", "url": "https://www.uniprot.org/uniprotkb/O75122" }, { "database": "PubMed", "id": "26003921", "url": "https://pubmed.ncbi.nlm.nih.gov/26003921" } ], "uniprot_canonical_ac": "O75122-1" }, { "start_pos": 507, "end_pos": 507, "sequence_org": "S", "sequence_mut": "D", "comment": "Phosphomimetic mutant that reduces MAPRE1 binding; when associated with D-499; D-503; D-525; D-529; D-533; D-537 and D-541.", "evidence": [ { "database": "UniProtKB", "id": "O75122", "url": "https://www.uniprot.org/uniprotkb/O75122" }, { "database": "PubMed", "id": "26003921", "url": "https://pubmed.ncbi.nlm.nih.gov/26003921" } ], "uniprot_canonical_ac": "O75122-1" }, { "start_pos": 519, "end_pos": 520, "sequence_org": "IP", "sequence_mut": "AA", "comment": "No effect on MAPRE1 binding. Abolishes interaction with MAPRE1; when associated with 496-A-A-497.", "evidence": [ { "database": "UniProtKB", "id": "O75122", "url": "https://www.uniprot.org/uniprotkb/O75122" }, { "database": "PubMed", "id": "26003921", "url": "https://pubmed.ncbi.nlm.nih.gov/26003921" } ], "uniprot_canonical_ac": "O75122-1" }, { "start_pos": 525, "end_pos": 525, "sequence_org": "S", "sequence_mut": "D", "comment": "Phosphomimetic mutant that reduces MAPRE1 binding; when associated with D-499; D-503; D-507; D-529; D-533; D-537 and D-541.", "evidence": [ { "database": "UniProtKB", "id": "O75122", "url": "https://www.uniprot.org/uniprotkb/O75122" }, { "database": "PubMed", "id": "26003921", "url": "https://pubmed.ncbi.nlm.nih.gov/26003921" } ], "uniprot_canonical_ac": "O75122-1" }, { "start_pos": 529, "end_pos": 529, "sequence_org": "S", "sequence_mut": "D", "comment": "Phosphomimetic mutant that reduces MAPRE1 binding; when associated with D-499; D-503; D-507; D-525; D-533; D-537 and D-541.", "evidence": [ { "database": "UniProtKB", "id": "O75122", "url": "https://www.uniprot.org/uniprotkb/O75122" }, { "database": "PubMed", "id": "26003921", "url": "https://pubmed.ncbi.nlm.nih.gov/26003921" } ], "uniprot_canonical_ac": "O75122-1" }, { "start_pos": 533, "end_pos": 533, "sequence_org": "S", "sequence_mut": "D", "comment": "Phosphomimetic mutant that reduces MAPRE1 binding; when associated with D-499; D-503; D-507; D-525; D-529; D-537 and D-541.", "evidence": [ { "database": "UniProtKB", "id": "O75122", "url": "https://www.uniprot.org/uniprotkb/O75122" }, { "database": "PubMed", "id": "26003921", "url": "https://pubmed.ncbi.nlm.nih.gov/26003921" } ], "uniprot_canonical_ac": "O75122-1" }, { "start_pos": 537, "end_pos": 537, "sequence_org": "S", "sequence_mut": "D", "comment": "Phosphomimetic mutant that reduces MAPRE1 binding; when associated with D-499; D-503; D-507; D-525; D-529; D-533 and D-541.", "evidence": [ { "database": "UniProtKB", "id": "O75122", "url": "https://www.uniprot.org/uniprotkb/O75122" }, { "database": "PubMed", "id": "26003921", "url": "https://pubmed.ncbi.nlm.nih.gov/26003921" } ], "uniprot_canonical_ac": "O75122-1" }, { "start_pos": 541, "end_pos": 541, "sequence_org": "S", "sequence_mut": "D", "comment": "Phosphomimetic mutant that reduces MAPRE1 binding; when associated with D-499; D-503; D-507; D-525; D-529; D-533 and D-537.", "evidence": [ { "database": "UniProtKB", "id": "O75122", "url": "https://www.uniprot.org/uniprotkb/O75122" }, { "database": "PubMed", "id": "26003921", "url": "https://pubmed.ncbi.nlm.nih.gov/26003921" } ], "uniprot_canonical_ac": "O75122-1" }, { "start_pos": 667, "end_pos": 667, "sequence_org": "W", "sequence_mut": "E", "comment": "Decreases affinity for microtubules; when associated with E-106; A-191; E-833; A-838 and A-839.", "evidence": [ { "database": "UniProtKB", "id": "O75122", "url": "https://www.uniprot.org/uniprotkb/O75122" }, { "database": "PubMed", "id": "26003921", "url": "https://pubmed.ncbi.nlm.nih.gov/26003921" } ], "uniprot_canonical_ac": "O75122-1" }, { "start_pos": 833, "end_pos": 833, "sequence_org": "K", "sequence_mut": "E", "comment": "Decreases affinity for microtubules; when associated with E-106; A-191; E-667; A-838 and A-839.", "evidence": [ { "database": "UniProtKB", "id": "O75122", "url": "https://www.uniprot.org/uniprotkb/O75122" }, { "database": "PubMed", "id": "26003921", "url": "https://pubmed.ncbi.nlm.nih.gov/26003921" } ], "uniprot_canonical_ac": "O75122-1" }, { "start_pos": 838, "end_pos": 838, "sequence_org": "R", "sequence_mut": "A", "comment": "Decreases affinity for microtubules; when associated with E-106; A-191; E-667; E-833 and A-839.", "evidence": [ { "database": "UniProtKB", "id": "O75122", "url": "https://www.uniprot.org/uniprotkb/O75122" }, { "database": "PubMed", "id": "26003921", "url": "https://pubmed.ncbi.nlm.nih.gov/26003921" } ], "uniprot_canonical_ac": "O75122-1" }, { "start_pos": 839, "end_pos": 839, "sequence_org": "K", "sequence_mut": "A", "comment": "Decreases affinity for microtubules; when associated with E-106; A-191; E-667; E-833 and A-838.", "evidence": [ { "database": "UniProtKB", "id": "O75122", "url": "https://www.uniprot.org/uniprotkb/O75122" }, { "database": "PubMed", "id": "26003921", "url": "https://pubmed.ncbi.nlm.nih.gov/26003921" } ], "uniprot_canonical_ac": "O75122-1" } ], "record_id": "pubmed.26003921", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Characterization of the CLASP2 Protein Interaction Network Identifies SOGA1 as a Microtubule-Associated Protein.", "journal": "Mol. Cell. Proteomics", "date": "2017", "authors": "Kruse R, Krantz J, Barker N, Coletta RL, Rafikov R, Luo M, Hojlund K, Mandarino LJ, Langlais PR", "reference": { "type": "PubMed", "id": "28550165", "url": "https://pubmed.ncbi.nlm.nih.gov/28550165" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q8BRT1-1", "protein_name": "CLIP-associating protein 2", "gene_name": "Clasp2", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "E1U8D0-1", "protein_name": "Microtubule cross-linking factor 2", "gene_name": "Mtcl2", "tax_name": "Mouse" } ], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "Q8BRT1", "url": "https://www.uniprot.org/uniprotkb/Q8BRT1" } ], "common_name": "Mouse", "glygen_name": "Mouse", "reference_species": "Mus musculus [10090]" } ], "record_id": "pubmed.28550165", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Targeting the Microtubule EB1-CLASP2 Complex Modulates NaV1.5 at Intercalated Discs.", "journal": "Circulation research", "date": "2021", "authors": "Marchal GA, Jouni M, Chiang DY, Perez-Hernandez M, Podliesna S, Yu N, Casini S, Potet F, Veerman CC, Klerk M, Lodder EM, Mengarelli I, Guan K, Vanoye CG, Rothenberg E, Charpentier F, Redon R, George AL Jr, Verkerk AO, Bezzina CR, MacRae CA, Burridge PW, Delmar M, Galjart N, Portero V, Remme CA", "reference": { "type": "PubMed", "id": "34092082", "url": "https://pubmed.ncbi.nlm.nih.gov/34092082" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q8BRT1-1", "protein_name": "CLIP-associating protein 2", "gene_name": "Clasp2", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "B0S585-1", "protein_name": "Microtubule-associated protein RP/EB family member 1", "gene_name": "mapre1a", "tax_name": "Zebrafish" }, { "uniprot_canonical_ac": "Q61166-1", "protein_name": "Microtubule-associated protein RP/EB family member 1", "gene_name": "Mapre1", "tax_name": "Mouse" } ], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "Q8BRT1", "url": "https://www.uniprot.org/uniprotkb/Q8BRT1" } ], "common_name": "Mouse", "glygen_name": "Mouse", "reference_species": "Mus musculus [10090]" } ], "record_id": "pubmed.34092082", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "CLASP2 safeguards hematopoietic stem cell properties during mouse and fish development.", "journal": "Cell reports", "date": "2022", "authors": "Klaus A, Clapes T, Yvernogeau L, Basu S, Weijts B, Maas J, Smal I, Galjart N, Robin C", "reference": { "type": "PubMed", "id": "35705037", "url": "https://pubmed.ncbi.nlm.nih.gov/35705037" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q8BRT1-1", "protein_name": "CLIP-associating protein 2", "gene_name": "Clasp2", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "Q6NYW6-1", "protein_name": "CLIP-associating protein 2", "gene_name": "clasp2", "tax_name": "Zebrafish" } ], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "Q8BRT1", "url": "https://www.uniprot.org/uniprotkb/Q8BRT1" } ], "common_name": "Mouse", "glygen_name": "Mouse", "reference_species": "Mus musculus [10090]" } ], "record_id": "pubmed.35705037", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Identification and characterization of a mouse dipeptidase that hydrolyzes L-carnosine.", "journal": "J. Biochem.", "date": "2005", "authors": "Otani Hiroto, Okumura Nobuaki, Hashida-Okumura Akiko, Nagai Katsuya", "reference": { "type": "PubMed", "id": "15749831", "url": "https://pubmed.ncbi.nlm.nih.gov/15749831" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9D1A2-1", "protein_name": "Cytosolic non-specific dipeptidase", "gene_name": "Cndp2", "tax_name": "Mouse" } ], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "Q9D1A2", "url": "https://www.uniprot.org/uniprotkb/Q9D1A2" } ], "common_name": "Mouse", "glygen_name": "Mouse", "reference_species": "Mus musculus [10090]" } ], "record_id": "pubmed.15749831", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Structural basis for substrate recognition and hydrolysis by mouse carnosinase CN2.", "journal": "The Journal of biological chemistry", "date": "2008", "authors": "Unno H, Yamashita T, Ujita S, Okumura N, Otani H, Okumura A, Nagai K, Kusunoki M", "reference": { "type": "PubMed", "id": "18550540", "url": "https://pubmed.ncbi.nlm.nih.gov/18550540" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9D1A2-1", "protein_name": "Cytosolic non-specific dipeptidase", "gene_name": "Cndp2", "tax_name": "Mouse" } ], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "Q9D1A2", "url": "https://www.uniprot.org/uniprotkb/Q9D1A2" } ], "common_name": "Mouse", "glygen_name": "Mouse", "reference_species": "Mus musculus [10090]" } ], "mutagenesis": [ { "start_pos": 228, "end_pos": 228, "sequence_org": "H", "sequence_mut": "A", "comment": "Loss of activity.", "evidence": [ { "database": "UniProtKB", "id": "Q9D1A2", "url": "https://www.uniprot.org/uniprotkb/Q9D1A2" }, { "database": "PubMed", "id": "18550540", "url": "https://pubmed.ncbi.nlm.nih.gov/18550540" } ], "uniprot_canonical_ac": "Q9D1A2-1" } ], "record_id": "pubmed.18550540", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "An exercise-inducible metabolite that suppresses feeding and obesity.", "journal": "Nature", "date": "2022", "authors": "Liu H., Kiens B., Richter E.A., Xu Y., He Y., Long J.Z., Wei W., Yang A.C., Kim J.T., Li V.L., Wallis G.A., Jansen R.S., van de Wetering K., Snyder M.P., Stahl A., Tung A.S., Contrepois K., Terrell S.M., Zushin P.H., Carl C.S., Lyu X., Arthur R.M., Banik S.M., Loh K.Y., Michael B., Moeller B.C., Tanzo J.T., Voldstedlund C.T., Wiggenhorn A.L.", "reference": { "type": "PubMed", "id": "35705806", "url": "https://pubmed.ncbi.nlm.nih.gov/35705806" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9D1A2-1", "protein_name": "Cytosolic non-specific dipeptidase", "gene_name": "Cndp2", "tax_name": "Mouse" } ], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "Q9D1A2", "url": "https://www.uniprot.org/uniprotkb/Q9D1A2" } ], "common_name": "Mouse", "glygen_name": "Mouse", "reference_species": "Mus musculus [10090]" } ], "record_id": "pubmed.35705806", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "COP9 signalosome subunit 3 is essential for maintenance of cell proliferation in the mouse embryonic epiblast.", "journal": "Molecular and cellular biology", "date": "2003", "authors": "Yan J, Walz K, Nakamura H, Carattini-Rivera S, Zhao Q, Vogel H, Wei N, Justice MJ, Bradley A, Lupski JR", "reference": { "type": "PubMed", "id": "12972600", "url": "https://pubmed.ncbi.nlm.nih.gov/12972600" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O88543-1", "protein_name": "COP9 signalosome complex subunit 3", "gene_name": "Cops3", "tax_name": "Mouse" } ], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "O88543", "url": "https://www.uniprot.org/uniprotkb/O88543" } ], "common_name": "Mouse", "glygen_name": "Mouse", "reference_species": "Mus musculus [10090]" } ], "record_id": "pubmed.12972600", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The COP9 signalosome subunit 3 is necessary for early embryo survival by way of a stable protein deposit in mouse oocytes.", "journal": "Molecular human reproduction", "date": "2021", "authors": "Israel S, Drexler HCA, Fuellen G, Boiani M", "reference": { "type": "PubMed", "id": "34264319", "url": "https://pubmed.ncbi.nlm.nih.gov/34264319" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O88543-1", "protein_name": "COP9 signalosome complex subunit 3", "gene_name": "Cops3", "tax_name": "Mouse" } ], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "O88543", "url": "https://www.uniprot.org/uniprotkb/O88543" } ], "common_name": "Mouse", "glygen_name": "Mouse", "reference_species": "Mus musculus [10090]" } ], "record_id": "pubmed.34264319", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "COPS3 AS lncRNA enhances myogenic differentiation and maintains fast-type myotube phenotype.", "journal": "Cellular signalling", "date": "2022", "authors": "He ZZ, Zhao T, Qimuge N, Tian T, Yan W, Yi X, Jin J, Cai R, Yu T, Yang G, Pang W", "reference": { "type": "PubMed", "id": "35491006", "url": "https://pubmed.ncbi.nlm.nih.gov/35491006" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O88543-1", "protein_name": "COP9 signalosome complex subunit 3", "gene_name": "Cops3", "tax_name": "Mouse" } ], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "O88543", "url": "https://www.uniprot.org/uniprotkb/O88543" } ], "common_name": "Mouse", "glygen_name": "Mouse", "reference_species": "Mus musculus [10090]" } ], "record_id": "pubmed.35491006", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "FMIP, a novel Fms-interacting protein, affects granulocyte/macrophage differentiation.", "journal": "Oncogene", "date": "1999", "authors": "Tamura T, Mancini A, Joos H, Koch A, Hakim C, Dumanski J, Weidner KM, Niemann H", "reference": { "type": "PubMed", "id": "10597251", "url": "https://pubmed.ncbi.nlm.nih.gov/10597251" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P09581-1", "protein_name": "Macrophage colony-stimulating factor 1 receptor", "gene_name": "Csf1r", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "Q8BKT7-1", "protein_name": "THO complex subunit 5 homolog", "gene_name": "Thoc5", "tax_name": "Mouse" } ], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "P09581", "url": "https://www.uniprot.org/uniprotkb/P09581" } ], "common_name": "Mouse", "glygen_name": "Mouse", "reference_species": "Mus musculus [10090]" } ], "mutagenesis": [ { "start_pos": 544, "end_pos": 544, "sequence_org": "Y", "sequence_mut": "F", "comment": "No effect on binding to THOC5.", "evidence": [ { "database": "UniProtKB", "id": "P09581", "url": "https://www.uniprot.org/uniprotkb/P09581" }, { "database": "PubMed", "id": "10597251", "url": "https://pubmed.ncbi.nlm.nih.gov/10597251" } ], "uniprot_canonical_ac": "P09581-1" }, { "start_pos": 614, "end_pos": 614, "sequence_org": "K", "sequence_mut": "A", "comment": "Loss of kinase activity.", "evidence": [ { "database": "UniProtKB", "id": "P09581", "url": "https://www.uniprot.org/uniprotkb/P09581" }, { "database": "PubMed", "id": "10597251", "url": "https://pubmed.ncbi.nlm.nih.gov/10597251" }, { "database": "PubMed", "id": "9312046", "url": "https://pubmed.ncbi.nlm.nih.gov/9312046" }, { "database": "PubMed", "id": "8262059", "url": "https://pubmed.ncbi.nlm.nih.gov/8262059" } ], "uniprot_canonical_ac": "P09581-1" }, { "start_pos": 614, "end_pos": 614, "sequence_org": "K", "sequence_mut": "M", "comment": "Loss of kinase activity. Abolishes binding to THOC5.", "evidence": [ { "database": "UniProtKB", "id": "P09581", "url": "https://www.uniprot.org/uniprotkb/P09581" }, { "database": "PubMed", "id": "10597251", "url": "https://pubmed.ncbi.nlm.nih.gov/10597251" }, { "database": "PubMed", "id": "9312046", "url": "https://pubmed.ncbi.nlm.nih.gov/9312046" }, { "database": "PubMed", "id": "8262059", "url": "https://pubmed.ncbi.nlm.nih.gov/8262059" } ], "uniprot_canonical_ac": "P09581-1" }, { "start_pos": 706, "end_pos": 706, "sequence_org": "Y", "sequence_mut": "F", "comment": "No effect on binding to THOC5. Slightly reduced enhancement of cell proliferation.", "evidence": [ { "database": "UniProtKB", "id": "P09581", "url": "https://www.uniprot.org/uniprotkb/P09581" }, { "database": "PubMed", "id": "10597251", "url": "https://pubmed.ncbi.nlm.nih.gov/10597251" }, { "database": "PubMed", "id": "1652061", "url": "https://pubmed.ncbi.nlm.nih.gov/1652061" } ], "uniprot_canonical_ac": "P09581-1" }, { "start_pos": 706, "end_pos": 706, "sequence_org": "Y", "sequence_mut": "G", "comment": "Slightly impaired signaling.", "evidence": [ { "database": "UniProtKB", "id": "P09581", "url": "https://www.uniprot.org/uniprotkb/P09581" }, { "database": "PubMed", "id": "10597251", "url": "https://pubmed.ncbi.nlm.nih.gov/10597251" }, { "database": "PubMed", "id": "1652061", "url": "https://pubmed.ncbi.nlm.nih.gov/1652061" } ], "uniprot_canonical_ac": "P09581-1" }, { "start_pos": 721, "end_pos": 721, "sequence_org": "Y", "sequence_mut": "F", "comment": "Abolishes interaction with PIK3R1. Strongly reduced phosphorylation of PLCG2. No effect on binding to THOC5.", "evidence": [ { "database": "UniProtKB", "id": "P09581", "url": "https://www.uniprot.org/uniprotkb/P09581" }, { "database": "PubMed", "id": "9312046", "url": "https://pubmed.ncbi.nlm.nih.gov/9312046" }, { "database": "PubMed", "id": "10597251", "url": "https://pubmed.ncbi.nlm.nih.gov/10597251" }, { "database": "PubMed", "id": "21610095", "url": "https://pubmed.ncbi.nlm.nih.gov/21610095" }, { "database": "PubMed", "id": "8262059", "url": "https://pubmed.ncbi.nlm.nih.gov/8262059" } ], "uniprot_canonical_ac": "P09581-1" }, { "start_pos": 807, "end_pos": 807, "sequence_org": "Y", "sequence_mut": "F", "comment": "Reduced kinase activity. Strongly reduced phosphorylation of PLCG2. Diminishes binding to THOC5.", "evidence": [ { "database": "UniProtKB", "id": "P09581", "url": "https://www.uniprot.org/uniprotkb/P09581" }, { "database": "PubMed", "id": "9312046", "url": "https://pubmed.ncbi.nlm.nih.gov/9312046" }, { "database": "PubMed", "id": "10597251", "url": "https://pubmed.ncbi.nlm.nih.gov/10597251" }, { "database": "PubMed", "id": "1652061", "url": "https://pubmed.ncbi.nlm.nih.gov/1652061" } ], "uniprot_canonical_ac": "P09581-1" }, { "start_pos": 807, "end_pos": 807, "sequence_org": "Y", "sequence_mut": "G", "comment": "May alter protein folding or stability. Loss of kinase activity. No effect on interaction with PIK3R1.", "evidence": [ { "database": "UniProtKB", "id": "P09581", "url": "https://www.uniprot.org/uniprotkb/P09581" }, { "database": "PubMed", "id": "9312046", "url": "https://pubmed.ncbi.nlm.nih.gov/9312046" }, { "database": "PubMed", "id": "10597251", "url": "https://pubmed.ncbi.nlm.nih.gov/10597251" }, { "database": "PubMed", "id": "1652061", "url": "https://pubmed.ncbi.nlm.nih.gov/1652061" } ], "uniprot_canonical_ac": "P09581-1" } ], "record_id": "pubmed.10597251", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Both src-dependent and -independent mechanisms mediate phosphatidylinositol 3-kinase regulation of colony-stimulating factor 1-activated mitogen-activated protein kinases in myeloid progenitors.", "journal": "Molecular and cellular biology", "date": "2000", "authors": "Lee AW, States DJ", "reference": { "type": "PubMed", "id": "10958675", "url": "https://pubmed.ncbi.nlm.nih.gov/10958675" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P09581-1", "protein_name": "Macrophage colony-stimulating factor 1 receptor", "gene_name": "Csf1r", "tax_name": "Mouse" } ], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "P09581", "url": "https://www.uniprot.org/uniprotkb/P09581" } ], "common_name": "Mouse", "glygen_name": "Mouse", "reference_species": "Mus musculus [10090]" } ], "record_id": "pubmed.10958675", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Suppressor of cytokine signaling 1 interacts with the macrophage colony-stimulating factor receptor and negatively regulates its proliferation signal.", "journal": "The Journal of biological chemistry", "date": "2001", "authors": "Bourette RP, De Sepulveda P, Arnaud S, Dubreuil P, Rottapel R, Mouchiroud G", "reference": { "type": "PubMed", "id": "11297560", "url": "https://pubmed.ncbi.nlm.nih.gov/11297560" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P09581-1", "protein_name": "Macrophage colony-stimulating factor 1 receptor", "gene_name": "Csf1r", "tax_name": "Mouse" } ], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "P09581", "url": "https://www.uniprot.org/uniprotkb/P09581" } ], "common_name": "Mouse", "glygen_name": "Mouse", "reference_species": "Mus musculus [10090]" } ], "phosphorylation": [ { "start_pos": 697, "end_pos": 697, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "Phosphotyrosine; by autocatalysis", "evidence": [ { "database": "UniProtKB", "id": "P09581", "url": "https://www.uniprot.org/uniprotkb/P09581" }, { "database": "IntAct", "id": "P09581", "url": "https://www.ebi.ac.uk/intact/interactors/id:P09581*" }, { "database": "iPTMnet", "id": "P09581", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P09581" }, { "database": "PubMed", "id": "9380408", "url": "https://pubmed.ncbi.nlm.nih.gov/9380408" }, { "database": "PubMed", "id": "9857184", "url": "https://pubmed.ncbi.nlm.nih.gov/9857184" }, { "database": "PubMed", "id": "11297560", "url": "https://pubmed.ncbi.nlm.nih.gov/11297560" } ], "site_lbl": "Tyr697", "uniprot_canonical_ac": "P09581-1" }, { "start_pos": 721, "end_pos": 721, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "Phosphotyrosine; by autocatalysis", "evidence": [ { "database": "UniProtKB", "id": "P09581", "url": "https://www.uniprot.org/uniprotkb/P09581" }, { "database": "IntAct", "id": "P09581", "url": "https://www.ebi.ac.uk/intact/interactors/id:P09581*" }, { "database": "iPTMnet", "id": "P09581", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P09581" }, { "database": "PubMed", "id": "1314163", "url": "https://pubmed.ncbi.nlm.nih.gov/1314163" }, { "database": "PubMed", "id": "11297560", "url": "https://pubmed.ncbi.nlm.nih.gov/11297560" }, { "database": "PubMed", "id": "21610095", "url": "https://pubmed.ncbi.nlm.nih.gov/21610095" }, { "database": "PubMed", "id": "8262059", "url": "https://pubmed.ncbi.nlm.nih.gov/8262059" } ], "site_lbl": "Tyr721", "uniprot_canonical_ac": "P09581-1" } ], "record_id": "pubmed.11297560", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Targeted disruption of the mouse colony-stimulating factor 1 receptor gene results in osteopetrosis, mononuclear phagocyte deficiency, increased primitive progenitor cell frequencies, and reproductive defects.", "journal": "Blood", "date": "2002-01-01", "authors": "Dai Xu-Ming, Ryan Gregory R, Hapel Andrew J, Dominguez Melissa G, Russell Robert G, Kapp Sara, Sylvestre Vonetta, Stanley E Richard", "reference": { "type": "PubMed", "id": "11756160", "url": "https://pubmed.ncbi.nlm.nih.gov/11756160" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P09581-1", "protein_name": "Macrophage colony-stimulating factor 1 receptor", "gene_name": "Csf1r", "tax_name": "Mouse" } ], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "P09581", "url": "https://www.uniprot.org/uniprotkb/P09581" } ], "common_name": "Mouse", "glygen_name": "Mouse", "reference_species": "Mus musculus [10090]" } ], "record_id": "pubmed.11756160", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] } ]