[ { "title": "The inducible G protein-coupled receptor edg-1 signals via the G(i)/mitogen-activated protein kinase pathway.", "journal": "The Journal of biological chemistry", "date": "1996", "authors": "Lee MJ, Evans M, Hla T", "reference": { "type": "PubMed", "id": "8626678", "url": "https://pubmed.ncbi.nlm.nih.gov/8626678" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P21453-1", "protein_name": "Sphingosine 1-phosphate receptor 1", "gene_name": "S1PR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H1C0-1", "protein_name": "Lysophosphatidic acid receptor 5", "gene_name": "LPAR5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H228-1", "protein_name": "Sphingosine 1-phosphate receptor 5", "gene_name": "S1PR5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q32ZL2-1", "protein_name": "Phospholipid phosphatase-related protein type 5", "gene_name": "PLPPR5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6T4P5-1", "protein_name": "Phospholipid phosphatase-related protein type 3", "gene_name": "PLPPR3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q7Z2D5-1", "protein_name": "Phospholipid phosphatase-related protein type 4", "gene_name": "PLPPR4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96GM1-1", "protein_name": "Phospholipid phosphatase-related protein type 2", "gene_name": "PLPPR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UBY5-1", "protein_name": "Lysophosphatidic acid receptor 3", "gene_name": "LPAR3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99500-1", "protein_name": "Sphingosine 1-phosphate receptor 3", "gene_name": "S1PR3", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95136-1", "protein_name": "Sphingosine 1-phosphate receptor 2", "gene_name": "S1PR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TBJ4-1", "protein_name": "Phospholipid phosphatase-related protein type 1", "gene_name": "PLPPR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95977-1", "protein_name": "Sphingosine 1-phosphate receptor 4", "gene_name": "S1PR4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HBW0-1", "protein_name": "Lysophosphatidic acid receptor 2", "gene_name": "LPAR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92633-1", "protein_name": "Lysophosphatidic acid receptor 1", "gene_name": "LPAR1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P21453", "url": "https://www.uniprot.org/uniprotkb/P21453" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.8626678", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 14 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Molecular cloning of the novel human G protein-coupled receptor (GPCR) gene mapped on chromosome 9.", "journal": "Biochemical and biophysical research communications", "date": "1996", "authors": "Yamaguchi F, Tokuda M, Hatase O, Brenner S", "reference": { "type": "PubMed", "id": "8878560", "url": "https://pubmed.ncbi.nlm.nih.gov/8878560" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P21453-1", "protein_name": "Sphingosine 1-phosphate receptor 1", "gene_name": "S1PR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H1C0-1", "protein_name": "Lysophosphatidic acid receptor 5", "gene_name": "LPAR5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H228-1", "protein_name": "Sphingosine 1-phosphate receptor 5", "gene_name": "S1PR5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q32ZL2-1", "protein_name": "Phospholipid phosphatase-related protein type 5", "gene_name": "PLPPR5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6T4P5-1", "protein_name": "Phospholipid phosphatase-related protein type 3", "gene_name": "PLPPR3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q7Z2D5-1", "protein_name": "Phospholipid phosphatase-related protein type 4", "gene_name": "PLPPR4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96GM1-1", "protein_name": "Phospholipid phosphatase-related protein type 2", "gene_name": "PLPPR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UBY5-1", "protein_name": "Lysophosphatidic acid receptor 3", "gene_name": "LPAR3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99500-1", "protein_name": "Sphingosine 1-phosphate receptor 3", "gene_name": "S1PR3", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95136-1", "protein_name": "Sphingosine 1-phosphate receptor 2", "gene_name": "S1PR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TBJ4-1", "protein_name": "Phospholipid phosphatase-related protein type 1", "gene_name": "PLPPR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95977-1", "protein_name": "Sphingosine 1-phosphate receptor 4", "gene_name": "S1PR4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HBW0-1", "protein_name": "Lysophosphatidic acid receptor 2", "gene_name": "LPAR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92633-1", "protein_name": "Lysophosphatidic acid receptor 1", "gene_name": "LPAR1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P21453", "url": "https://www.uniprot.org/uniprotkb/P21453" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.8878560", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 14 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Molecular cloning of the human Edg2 protein and its identification as a functional cellular receptor for lysophosphatidic acid.", "journal": "Biochemical and biophysical research communications", "date": "1997", "authors": "An S, Dickens MA, Bleu T, Hallmark OG, Goetzl EJ", "reference": { "type": "PubMed", "id": "9070858", "url": "https://pubmed.ncbi.nlm.nih.gov/9070858" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P21453-1", "protein_name": "Sphingosine 1-phosphate receptor 1", "gene_name": "S1PR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H1C0-1", "protein_name": "Lysophosphatidic acid receptor 5", "gene_name": "LPAR5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H228-1", "protein_name": "Sphingosine 1-phosphate receptor 5", "gene_name": "S1PR5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q32ZL2-1", "protein_name": "Phospholipid phosphatase-related protein type 5", "gene_name": "PLPPR5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6T4P5-1", "protein_name": "Phospholipid phosphatase-related protein type 3", "gene_name": "PLPPR3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q7Z2D5-1", "protein_name": "Phospholipid phosphatase-related protein type 4", "gene_name": "PLPPR4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96GM1-1", "protein_name": "Phospholipid phosphatase-related protein type 2", "gene_name": "PLPPR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UBY5-1", "protein_name": "Lysophosphatidic acid receptor 3", "gene_name": "LPAR3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99500-1", "protein_name": "Sphingosine 1-phosphate receptor 3", "gene_name": "S1PR3", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95136-1", "protein_name": "Sphingosine 1-phosphate receptor 2", "gene_name": "S1PR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TBJ4-1", "protein_name": "Phospholipid phosphatase-related protein type 1", "gene_name": "PLPPR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95977-1", "protein_name": "Sphingosine 1-phosphate receptor 4", "gene_name": "S1PR4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HBW0-1", "protein_name": "Lysophosphatidic acid receptor 2", "gene_name": "LPAR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92633-1", "protein_name": "Lysophosphatidic acid receptor 1", "gene_name": "LPAR1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P21453", "url": "https://www.uniprot.org/uniprotkb/P21453" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.9070858", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 14 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Identification of cDNAs encoding two G protein-coupled receptors for lysosphingolipids.", "journal": "FEBS Lett.", "date": "1997", "authors": "An S, Bleu T, Huang W, Hallmark O G, Coughlin S R, Goetzl E J", "reference": { "type": "PubMed", "id": "9409733", "url": "https://pubmed.ncbi.nlm.nih.gov/9409733" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P21453-1", "protein_name": "Sphingosine 1-phosphate receptor 1", "gene_name": "S1PR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P47752-1", "protein_name": "Sphingosine 1-phosphate receptor 2", "gene_name": "S1pr2", "tax_name": "Rat" }, { "uniprot_canonical_ac": "Q99500-1", "protein_name": "Sphingosine 1-phosphate receptor 3", "gene_name": "S1PR3", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P21453", "url": "https://www.uniprot.org/uniprotkb/P21453" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.9409733", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Sphingosine-1-phosphate as a ligand for the G protein-coupled receptor EDG-1.", "journal": "Science (New York, N.Y.)", "date": "1998", "authors": "Lee MJ, Van Brocklyn JR, Thangada S, Liu CH, Hand AR, Menzeleev R, Spiegel S, Hla T", "reference": { "type": "PubMed", "id": "9488656", "url": "https://pubmed.ncbi.nlm.nih.gov/9488656" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P21453-1", "protein_name": "Sphingosine 1-phosphate receptor 1", "gene_name": "S1PR1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P21453", "url": "https://www.uniprot.org/uniprotkb/P21453" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.9488656", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Characterization of a novel subtype of human G protein-coupled receptor for lysophosphatidic acid.", "journal": "The Journal of biological chemistry", "date": "1998", "authors": "An S, Bleu T, Hallmark OG, Goetzl EJ", "reference": { "type": "PubMed", "id": "9525886", "url": "https://pubmed.ncbi.nlm.nih.gov/9525886" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P21453-1", "protein_name": "Sphingosine 1-phosphate receptor 1", "gene_name": "S1PR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H1C0-1", "protein_name": "Lysophosphatidic acid receptor 5", "gene_name": "LPAR5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H228-1", "protein_name": "Sphingosine 1-phosphate receptor 5", "gene_name": "S1PR5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q32ZL2-1", "protein_name": "Phospholipid phosphatase-related protein type 5", "gene_name": "PLPPR5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6T4P5-1", "protein_name": "Phospholipid phosphatase-related protein type 3", "gene_name": "PLPPR3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q7Z2D5-1", "protein_name": "Phospholipid phosphatase-related protein type 4", "gene_name": "PLPPR4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96GM1-1", "protein_name": "Phospholipid phosphatase-related protein type 2", "gene_name": "PLPPR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UBY5-1", "protein_name": "Lysophosphatidic acid receptor 3", "gene_name": "LPAR3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99500-1", "protein_name": "Sphingosine 1-phosphate receptor 3", "gene_name": "S1PR3", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95136-1", "protein_name": "Sphingosine 1-phosphate receptor 2", "gene_name": "S1PR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TBJ4-1", "protein_name": "Phospholipid phosphatase-related protein type 1", "gene_name": "PLPPR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95977-1", "protein_name": "Sphingosine 1-phosphate receptor 4", "gene_name": "S1PR4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HBW0-1", "protein_name": "Lysophosphatidic acid receptor 2", "gene_name": "LPAR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92633-1", "protein_name": "Lysophosphatidic acid receptor 1", "gene_name": "LPAR1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P21453", "url": "https://www.uniprot.org/uniprotkb/P21453" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.9525886", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 14 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Recombinant human G protein-coupled lysophosphatidic acid receptors mediate intracellular calcium mobilization.", "journal": "Molecular pharmacology", "date": "1998", "authors": "An S, Bleu T, Zheng Y, Goetzl EJ", "reference": { "type": "PubMed", "id": "9804623", "url": "https://pubmed.ncbi.nlm.nih.gov/9804623" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P21453-1", "protein_name": "Sphingosine 1-phosphate receptor 1", "gene_name": "S1PR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H1C0-1", "protein_name": "Lysophosphatidic acid receptor 5", "gene_name": "LPAR5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H228-1", "protein_name": "Sphingosine 1-phosphate receptor 5", "gene_name": "S1PR5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q32ZL2-1", "protein_name": "Phospholipid phosphatase-related protein type 5", "gene_name": "PLPPR5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6T4P5-1", "protein_name": "Phospholipid phosphatase-related protein type 3", "gene_name": "PLPPR3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q7Z2D5-1", "protein_name": "Phospholipid phosphatase-related protein type 4", "gene_name": "PLPPR4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96GM1-1", "protein_name": "Phospholipid phosphatase-related protein type 2", "gene_name": "PLPPR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UBY5-1", "protein_name": "Lysophosphatidic acid receptor 3", "gene_name": "LPAR3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99500-1", "protein_name": "Sphingosine 1-phosphate receptor 3", "gene_name": "S1PR3", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95136-1", "protein_name": "Sphingosine 1-phosphate receptor 2", "gene_name": "S1PR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TBJ4-1", "protein_name": "Phospholipid phosphatase-related protein type 1", "gene_name": "PLPPR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95977-1", "protein_name": "Sphingosine 1-phosphate receptor 4", "gene_name": "S1PR4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HBW0-1", "protein_name": "Lysophosphatidic acid receptor 2", "gene_name": "LPAR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92633-1", "protein_name": "Lysophosphatidic acid receptor 1", "gene_name": "LPAR1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P21453", "url": "https://www.uniprot.org/uniprotkb/P21453" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.9804623", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 14 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Crystal structures of the XLP protein SAP reveal a class of SH2 domains with extended, phosphotyrosine-independent sequence recognition.", "journal": "Molecular cell", "date": "1999-10", "authors": "Poy F, Yaffe M B, Sayos J, Saxena K, Morra M, Sumegi J, Cantley L C, Terhorst C, Eck M J", "reference": { "type": "PubMed", "id": "10549287", "url": "https://pubmed.ncbi.nlm.nih.gov/10549287" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q13291-1", "protein_name": "Signaling lymphocytic activation molecule", "gene_name": "SLAMF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60880-1", "protein_name": "SH2 domain-containing protein 1A", "gene_name": "SH2D1A", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q13291", "url": "https://www.uniprot.org/uniprotkb/Q13291" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 281, "end_pos": 281, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "Phosphotyrosine; by FYN", "evidence": [ { "database": "UniProtKB", "id": "Q13291", "url": "https://www.uniprot.org/uniprotkb/Q13291" }, { "database": "IntAct", "id": "Q13291", "url": "https://www.ebi.ac.uk/intact/interactors/id:Q13291*" }, { "database": "iPTMnet", "id": "Q13291", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q13291" }, { "database": "PubMed", "id": "14674764", "url": "https://pubmed.ncbi.nlm.nih.gov/14674764" }, { "database": "PubMed", "id": "10549287", "url": "https://pubmed.ncbi.nlm.nih.gov/10549287" }, { "database": "PubMed", "id": "10607564", "url": "https://pubmed.ncbi.nlm.nih.gov/10607564" }, { "database": "PubMed", "id": "11313386", "url": "https://pubmed.ncbi.nlm.nih.gov/11313386" }, { "database": "PubMed", "id": "11389028", "url": "https://pubmed.ncbi.nlm.nih.gov/11389028" }, { "database": "PubMed", "id": "11477068", "url": "https://pubmed.ncbi.nlm.nih.gov/11477068" }, { "database": "PubMed", "id": "11806999", "url": "https://pubmed.ncbi.nlm.nih.gov/11806999" }, { "database": "PubMed", "id": "11823424", "url": "https://pubmed.ncbi.nlm.nih.gov/11823424" }, { "database": "PubMed", "id": "12225753", "url": "https://pubmed.ncbi.nlm.nih.gov/12225753" }, { "database": "PubMed", "id": "12545174", "url": "https://pubmed.ncbi.nlm.nih.gov/12545174" }, { "database": "PubMed", "id": "9774102", "url": "https://pubmed.ncbi.nlm.nih.gov/9774102" }, { "database": "PubMed", "id": "11099315", "url": "https://pubmed.ncbi.nlm.nih.gov/11099315" }, { "database": "PubMed", "id": "11689425", "url": "https://pubmed.ncbi.nlm.nih.gov/11689425" } ], "site_lbl": "Tyr281", "uniprot_canonical_ac": "Q13291-1" } ], "record_id": "pubmed.10549287", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Novel mode of ligand binding by the SH2 domain of the human XLP disease gene product SAP/SH2D1A.", "journal": "Current biology : CB", "date": "1999-12-02", "authors": "Li S C, Gish G, Yang D, Coffey A J, Forman-Kay J D, Ernberg I, Kay L E, Pawson T", "reference": { "type": "PubMed", "id": "10607564", "url": "https://pubmed.ncbi.nlm.nih.gov/10607564" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q13291-1", "protein_name": "Signaling lymphocytic activation molecule", "gene_name": "SLAMF1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q13291", "url": "https://www.uniprot.org/uniprotkb/Q13291" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 281, "end_pos": 281, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "Phosphotyrosine; by FYN", "evidence": [ { "database": "UniProtKB", "id": "Q13291", "url": "https://www.uniprot.org/uniprotkb/Q13291" }, { "database": "IntAct", "id": "Q13291", "url": "https://www.ebi.ac.uk/intact/interactors/id:Q13291*" }, { "database": "iPTMnet", "id": "Q13291", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q13291" }, { "database": "PubMed", "id": "14674764", "url": "https://pubmed.ncbi.nlm.nih.gov/14674764" }, { "database": "PubMed", "id": "10549287", "url": "https://pubmed.ncbi.nlm.nih.gov/10549287" }, { "database": "PubMed", "id": "10607564", "url": "https://pubmed.ncbi.nlm.nih.gov/10607564" }, { "database": "PubMed", "id": "11313386", "url": "https://pubmed.ncbi.nlm.nih.gov/11313386" }, { "database": "PubMed", "id": "11389028", "url": "https://pubmed.ncbi.nlm.nih.gov/11389028" }, { "database": "PubMed", "id": "11477068", "url": "https://pubmed.ncbi.nlm.nih.gov/11477068" }, { "database": "PubMed", "id": "11806999", "url": "https://pubmed.ncbi.nlm.nih.gov/11806999" }, { "database": "PubMed", "id": "11823424", "url": "https://pubmed.ncbi.nlm.nih.gov/11823424" }, { "database": "PubMed", "id": "12225753", "url": "https://pubmed.ncbi.nlm.nih.gov/12225753" }, { "database": "PubMed", "id": "12545174", "url": "https://pubmed.ncbi.nlm.nih.gov/12545174" }, { "database": "PubMed", "id": "9774102", "url": "https://pubmed.ncbi.nlm.nih.gov/9774102" }, { "database": "PubMed", "id": "11099315", "url": "https://pubmed.ncbi.nlm.nih.gov/11099315" }, { "database": "PubMed", "id": "11689425", "url": "https://pubmed.ncbi.nlm.nih.gov/11689425" } ], "site_lbl": "Tyr281", "uniprot_canonical_ac": "Q13291-1" } ], "record_id": "pubmed.10607564", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "SLAM (CDw150) is a cellular receptor for measles virus.", "journal": "Nature", "date": "2000-08-24", "authors": "Tatsuo H, Ono N, Tanaka K, Yanagi Y", "reference": { "type": "PubMed", "id": "10972291", "url": "https://pubmed.ncbi.nlm.nih.gov/10972291" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q13291-1", "protein_name": "Signaling lymphocytic activation molecule", "gene_name": "SLAMF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P15529-1", "protein_name": "Membrane cofactor protein", "gene_name": "CD46", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q13291", "url": "https://www.uniprot.org/uniprotkb/Q13291" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.10972291", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Potential pathways for regulation of NK and T cell responses: differential X-linked lymphoproliferative syndrome gene product SAP interactions with SLAM and 2B4.", "journal": "International immunology", "date": "2000", "authors": "Sayos J, Nguyen KB, Wu C, Stepp SE, Howie D, Schatzle JD, Kumar V, Biron CA, Terhorst C", "reference": { "type": "PubMed", "id": "11099315", "url": "https://pubmed.ncbi.nlm.nih.gov/11099315" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q13291-1", "protein_name": "Signaling lymphocytic activation molecule", "gene_name": "SLAMF1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q13291", "url": "https://www.uniprot.org/uniprotkb/Q13291" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 281, "end_pos": 281, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "Phosphotyrosine; by FYN", "evidence": [ { "database": "UniProtKB", "id": "Q13291", "url": "https://www.uniprot.org/uniprotkb/Q13291" }, { "database": "IntAct", "id": "Q13291", "url": "https://www.ebi.ac.uk/intact/interactors/id:Q13291*" }, { "database": "iPTMnet", "id": "Q13291", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q13291" }, { "database": "PubMed", "id": "14674764", "url": "https://pubmed.ncbi.nlm.nih.gov/14674764" }, { "database": "PubMed", "id": "10549287", "url": "https://pubmed.ncbi.nlm.nih.gov/10549287" }, { "database": "PubMed", "id": "10607564", "url": "https://pubmed.ncbi.nlm.nih.gov/10607564" }, { "database": "PubMed", "id": "11313386", "url": "https://pubmed.ncbi.nlm.nih.gov/11313386" }, { "database": "PubMed", "id": "11389028", "url": "https://pubmed.ncbi.nlm.nih.gov/11389028" }, { "database": "PubMed", "id": "11477068", "url": "https://pubmed.ncbi.nlm.nih.gov/11477068" }, { "database": "PubMed", "id": "11806999", "url": "https://pubmed.ncbi.nlm.nih.gov/11806999" }, { "database": "PubMed", "id": "11823424", "url": "https://pubmed.ncbi.nlm.nih.gov/11823424" }, { "database": "PubMed", "id": "12225753", "url": "https://pubmed.ncbi.nlm.nih.gov/12225753" }, { "database": "PubMed", "id": "12545174", "url": "https://pubmed.ncbi.nlm.nih.gov/12545174" }, { "database": "PubMed", "id": "9774102", "url": "https://pubmed.ncbi.nlm.nih.gov/9774102" }, { "database": "PubMed", "id": "11099315", "url": "https://pubmed.ncbi.nlm.nih.gov/11099315" }, { "database": "PubMed", "id": "11689425", "url": "https://pubmed.ncbi.nlm.nih.gov/11689425" } ], "site_lbl": "Tyr281", "uniprot_canonical_ac": "Q13291-1" }, { "start_pos": 327, "end_pos": 327, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "Phosphotyrosine; by FYN", "evidence": [ { "database": "UniProtKB", "id": "Q13291", "url": "https://www.uniprot.org/uniprotkb/Q13291" }, { "database": "iPTMnet", "id": "Q13291", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q13291" }, { "database": "PubMed", "id": "11099315", "url": "https://pubmed.ncbi.nlm.nih.gov/11099315" }, { "database": "PubMed", "id": "15315965", "url": "https://pubmed.ncbi.nlm.nih.gov/15315965" }, { "database": "PubMed", "id": "11806999", "url": "https://pubmed.ncbi.nlm.nih.gov/11806999" } ], "site_lbl": "Tyr327", "uniprot_canonical_ac": "Q13291-1" } ], "record_id": "pubmed.11099315", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "CD150 association with either the SH2-containing inositol phosphatase or the SH2-containing protein tyrosine phosphatase is regulated by the adaptor protein SH2D1A.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "2001", "authors": "Shlapatska LM, Mikhalap SV, Berdova AG, Zelensky OM, Yun TJ, Nichols KE, Clark EA, Sidorenko SP", "reference": { "type": "PubMed", "id": "11313386", "url": "https://pubmed.ncbi.nlm.nih.gov/11313386" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q13291-1", "protein_name": "Signaling lymphocytic activation molecule", "gene_name": "SLAMF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UIB8-1", "protein_name": "SLAM family member 5", "gene_name": "CD84", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q13291", "url": "https://www.uniprot.org/uniprotkb/Q13291" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 269, "end_pos": 269, "sequence_org": "Y", "sequence_mut": "F", "comment": "No effect on interaction with INPP5D/SHIP-1, PTPN11/SHP-2 and SH2D1A.", "evidence": [ { "database": "UniProtKB", "id": "Q13291", "url": "https://www.uniprot.org/uniprotkb/Q13291" }, { "database": "PubMed", "id": "11313386", "url": "https://pubmed.ncbi.nlm.nih.gov/11313386" } ], "uniprot_canonical_ac": "Q13291-1" }, { "start_pos": 281, "end_pos": 281, "sequence_org": "Y", "sequence_mut": "F", "comment": "Disrupts interaction with INPP5D/SHIP-1 and PTPN11/SHP-2, no effect on interaction with SH2D1A.", "evidence": [ { "database": "UniProtKB", "id": "Q13291", "url": "https://www.uniprot.org/uniprotkb/Q13291" }, { "database": "PubMed", "id": "11313386", "url": "https://pubmed.ncbi.nlm.nih.gov/11313386" }, { "database": "PubMed", "id": "11806999", "url": "https://pubmed.ncbi.nlm.nih.gov/11806999" } ], "uniprot_canonical_ac": "Q13291-1" }, { "start_pos": 307, "end_pos": 307, "sequence_org": "Y", "sequence_mut": "F", "comment": "No effect on interaction with PTPN11/SHP-2 and SH2D1A.", "evidence": [ { "database": "UniProtKB", "id": "Q13291", "url": "https://www.uniprot.org/uniprotkb/Q13291" }, { "database": "PubMed", "id": "11313386", "url": "https://pubmed.ncbi.nlm.nih.gov/11313386" } ], "uniprot_canonical_ac": "Q13291-1" }, { "start_pos": 327, "end_pos": 327, "sequence_org": "Y", "sequence_mut": "F", "comment": "Disrupts interaction with INPP5D/SHIP-1 and PTPN11/SHP-2, no effect on interaction with SH2D1A.", "evidence": [ { "database": "UniProtKB", "id": "Q13291", "url": "https://www.uniprot.org/uniprotkb/Q13291" }, { "database": "PubMed", "id": "11313386", "url": "https://pubmed.ncbi.nlm.nih.gov/11313386" }, { "database": "PubMed", "id": "11806999", "url": "https://pubmed.ncbi.nlm.nih.gov/11806999" } ], "uniprot_canonical_ac": "Q13291-1" } ], "phosphorylation": [ { "start_pos": 281, "end_pos": 281, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "Phosphotyrosine; by FYN", "evidence": [ { "database": "UniProtKB", "id": "Q13291", "url": "https://www.uniprot.org/uniprotkb/Q13291" }, { "database": "IntAct", "id": "Q13291", "url": "https://www.ebi.ac.uk/intact/interactors/id:Q13291*" }, { "database": "iPTMnet", "id": "Q13291", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q13291" }, { "database": "PubMed", "id": "14674764", "url": "https://pubmed.ncbi.nlm.nih.gov/14674764" }, { "database": "PubMed", "id": "10549287", "url": "https://pubmed.ncbi.nlm.nih.gov/10549287" }, { "database": "PubMed", "id": "10607564", "url": "https://pubmed.ncbi.nlm.nih.gov/10607564" }, { "database": "PubMed", "id": "11313386", "url": "https://pubmed.ncbi.nlm.nih.gov/11313386" }, { "database": "PubMed", "id": "11389028", "url": "https://pubmed.ncbi.nlm.nih.gov/11389028" }, { "database": "PubMed", "id": "11477068", "url": "https://pubmed.ncbi.nlm.nih.gov/11477068" }, { "database": "PubMed", "id": "11806999", "url": "https://pubmed.ncbi.nlm.nih.gov/11806999" }, { "database": "PubMed", "id": "11823424", "url": "https://pubmed.ncbi.nlm.nih.gov/11823424" }, { "database": "PubMed", "id": "12225753", "url": "https://pubmed.ncbi.nlm.nih.gov/12225753" }, { "database": "PubMed", "id": "12545174", "url": "https://pubmed.ncbi.nlm.nih.gov/12545174" }, { "database": "PubMed", "id": "9774102", "url": "https://pubmed.ncbi.nlm.nih.gov/9774102" }, { "database": "PubMed", "id": "11099315", "url": "https://pubmed.ncbi.nlm.nih.gov/11099315" }, { "database": "PubMed", "id": "11689425", "url": "https://pubmed.ncbi.nlm.nih.gov/11689425" } ], "site_lbl": "Tyr281", "uniprot_canonical_ac": "Q13291-1" } ], "record_id": "pubmed.11313386", "abstract": "", "glycosylation": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Cell surface receptors Ly-9 and CD84 recruit the X-linked lymphoproliferative disease gene product SAP.", "journal": "Blood", "date": "2001", "authors": "Sayos J, Martin M, Chen A, Simarro M, Howie D, Morra M, Engel P, Terhorst C", "reference": { "type": "PubMed", "id": "11389028", "url": "https://pubmed.ncbi.nlm.nih.gov/11389028" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q13291-1", "protein_name": "Signaling lymphocytic activation molecule", "gene_name": "SLAMF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UIB8-1", "protein_name": "SLAM family member 5", "gene_name": "CD84", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HBG7-1", "protein_name": "T-lymphocyte surface antigen Ly-9", "gene_name": "LY9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q06124-2", "protein_name": "Tyrosine-protein phosphatase non-receptor type 11", "gene_name": "PTPN11", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60880-1", "protein_name": "SH2 domain-containing protein 1A", "gene_name": "SH2D1A", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q13291", "url": "https://www.uniprot.org/uniprotkb/Q13291" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 281, "end_pos": 281, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "Phosphotyrosine; by FYN", "evidence": [ { "database": "UniProtKB", "id": "Q13291", "url": "https://www.uniprot.org/uniprotkb/Q13291" }, { "database": "IntAct", "id": "Q13291", "url": "https://www.ebi.ac.uk/intact/interactors/id:Q13291*" }, { "database": "iPTMnet", "id": "Q13291", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q13291" }, { "database": "PubMed", "id": "14674764", "url": "https://pubmed.ncbi.nlm.nih.gov/14674764" }, { "database": "PubMed", "id": "10549287", "url": "https://pubmed.ncbi.nlm.nih.gov/10549287" }, { "database": "PubMed", "id": "10607564", "url": "https://pubmed.ncbi.nlm.nih.gov/10607564" }, { "database": "PubMed", "id": "11313386", "url": "https://pubmed.ncbi.nlm.nih.gov/11313386" }, { "database": "PubMed", "id": "11389028", "url": "https://pubmed.ncbi.nlm.nih.gov/11389028" }, { "database": "PubMed", "id": "11477068", "url": "https://pubmed.ncbi.nlm.nih.gov/11477068" }, { "database": "PubMed", "id": "11806999", "url": "https://pubmed.ncbi.nlm.nih.gov/11806999" }, { "database": "PubMed", "id": "11823424", "url": "https://pubmed.ncbi.nlm.nih.gov/11823424" }, { "database": "PubMed", "id": "12225753", "url": "https://pubmed.ncbi.nlm.nih.gov/12225753" }, { "database": "PubMed", "id": "12545174", "url": "https://pubmed.ncbi.nlm.nih.gov/12545174" }, { "database": "PubMed", "id": "9774102", "url": "https://pubmed.ncbi.nlm.nih.gov/9774102" }, { "database": "PubMed", "id": "11099315", "url": "https://pubmed.ncbi.nlm.nih.gov/11099315" }, { "database": "PubMed", "id": "11689425", "url": "https://pubmed.ncbi.nlm.nih.gov/11689425" } ], "site_lbl": "Tyr281", "uniprot_canonical_ac": "Q13291-1" } ], "record_id": "pubmed.11389028", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 5 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Characterization of SH2D1A missense mutations identified in X-linked lymphoproliferative disease patients.", "journal": "The Journal of biological chemistry", "date": "2001", "authors": "Morra M, Simarro-Grande M, Martin M, Chen AS, Lanyi A, Silander O, Calpe S, Davis J, Pawson T, Eck MJ, Sumegi J, Engel P, Li SC, Terhorst C", "reference": { "type": "PubMed", "id": "11477068", "url": "https://pubmed.ncbi.nlm.nih.gov/11477068" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q13291-1", "protein_name": "Signaling lymphocytic activation molecule", "gene_name": "SLAMF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60880-1", "protein_name": "SH2 domain-containing protein 1A", "gene_name": "SH2D1A", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q13291", "url": "https://www.uniprot.org/uniprotkb/Q13291" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 281, "end_pos": 281, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "Phosphotyrosine; by FYN", "evidence": [ { "database": "UniProtKB", "id": "Q13291", "url": "https://www.uniprot.org/uniprotkb/Q13291" }, { "database": "IntAct", "id": "Q13291", "url": "https://www.ebi.ac.uk/intact/interactors/id:Q13291*" }, { "database": "iPTMnet", "id": "Q13291", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q13291" }, { "database": "PubMed", "id": "14674764", "url": "https://pubmed.ncbi.nlm.nih.gov/14674764" }, { "database": "PubMed", "id": "10549287", "url": "https://pubmed.ncbi.nlm.nih.gov/10549287" }, { "database": "PubMed", "id": "10607564", "url": "https://pubmed.ncbi.nlm.nih.gov/10607564" }, { "database": "PubMed", "id": "11313386", "url": "https://pubmed.ncbi.nlm.nih.gov/11313386" }, { "database": "PubMed", "id": "11389028", "url": "https://pubmed.ncbi.nlm.nih.gov/11389028" }, { "database": "PubMed", "id": "11477068", "url": "https://pubmed.ncbi.nlm.nih.gov/11477068" }, { "database": "PubMed", "id": "11806999", "url": "https://pubmed.ncbi.nlm.nih.gov/11806999" }, { "database": "PubMed", "id": "11823424", "url": "https://pubmed.ncbi.nlm.nih.gov/11823424" }, { "database": "PubMed", "id": "12225753", "url": "https://pubmed.ncbi.nlm.nih.gov/12225753" }, { "database": "PubMed", "id": "12545174", "url": "https://pubmed.ncbi.nlm.nih.gov/12545174" }, { "database": "PubMed", "id": "9774102", "url": "https://pubmed.ncbi.nlm.nih.gov/9774102" }, { "database": "PubMed", "id": "11099315", "url": "https://pubmed.ncbi.nlm.nih.gov/11099315" }, { "database": "PubMed", "id": "11689425", "url": "https://pubmed.ncbi.nlm.nih.gov/11689425" } ], "site_lbl": "Tyr281", "uniprot_canonical_ac": "Q13291-1" } ], "record_id": "pubmed.11477068", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Structural basis for the interaction of the free SH2 domain EAT-2 with SLAM receptors in hematopoietic cells.", "journal": "The EMBO journal", "date": "2001", "authors": "Morra M, Lu J, Poy F, Martin M, Sayos J, Calpe S, Gullo C, Howie D, Rietdijk S, Thompson A, Coyle AJ, Denny C, Yaffe MB, Engel P, Eck MJ, Terhorst C", "reference": { "type": "PubMed", "id": "11689425", "url": "https://pubmed.ncbi.nlm.nih.gov/11689425" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q13291-1", "protein_name": "Signaling lymphocytic activation molecule", "gene_name": "SLAMF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14796-1", "protein_name": "SH2 domain-containing protein 1B", "gene_name": "SH2D1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q18PI6-1", "protein_name": "SLAM family member 5", "gene_name": "Cd84", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "O35324-1", "protein_name": "SH2 domain-containing protein 1B", "gene_name": "Sh2d1b", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "Q9QUM4-1", "protein_name": "Signaling lymphocytic activation molecule", "gene_name": "Slamf1", "tax_name": "Mouse" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q13291", "url": "https://www.uniprot.org/uniprotkb/Q13291" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 281, "end_pos": 281, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "Phosphotyrosine; by FYN", "evidence": [ { "database": "UniProtKB", "id": "Q13291", "url": "https://www.uniprot.org/uniprotkb/Q13291" }, { "database": "IntAct", "id": "Q13291", "url": "https://www.ebi.ac.uk/intact/interactors/id:Q13291*" }, { "database": "iPTMnet", "id": "Q13291", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q13291" }, { "database": "PubMed", "id": "14674764", "url": "https://pubmed.ncbi.nlm.nih.gov/14674764" }, { "database": "PubMed", "id": "10549287", "url": "https://pubmed.ncbi.nlm.nih.gov/10549287" }, { "database": "PubMed", "id": "10607564", "url": "https://pubmed.ncbi.nlm.nih.gov/10607564" }, { "database": "PubMed", "id": "11313386", "url": "https://pubmed.ncbi.nlm.nih.gov/11313386" }, { "database": "PubMed", "id": "11389028", "url": "https://pubmed.ncbi.nlm.nih.gov/11389028" }, { "database": "PubMed", "id": "11477068", "url": "https://pubmed.ncbi.nlm.nih.gov/11477068" }, { "database": "PubMed", "id": "11806999", "url": "https://pubmed.ncbi.nlm.nih.gov/11806999" }, { "database": "PubMed", "id": "11823424", "url": "https://pubmed.ncbi.nlm.nih.gov/11823424" }, { "database": "PubMed", "id": "12225753", "url": "https://pubmed.ncbi.nlm.nih.gov/12225753" }, { "database": "PubMed", "id": "12545174", "url": "https://pubmed.ncbi.nlm.nih.gov/12545174" }, { "database": "PubMed", "id": "9774102", "url": "https://pubmed.ncbi.nlm.nih.gov/9774102" }, { "database": "PubMed", "id": "11099315", "url": "https://pubmed.ncbi.nlm.nih.gov/11099315" }, { "database": "PubMed", "id": "11689425", "url": "https://pubmed.ncbi.nlm.nih.gov/11689425" } ], "site_lbl": "Tyr281", "uniprot_canonical_ac": "Q13291-1" }, { "start_pos": 288, "end_pos": 288, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "Phosphotyrosine; by FYN", "evidence": [ { "database": "UniProtKB", "id": "Q9QUM4", "url": "https://www.uniprot.org/uniprotkb/Q9QUM4" }, { "database": "IntAct", "id": "Q9QUM4", "url": "https://www.ebi.ac.uk/intact/interactors/id:Q9QUM4*" }, { "database": "iPTMnet", "id": "Q9QUM4", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9QUM4" }, { "database": "PubMed", "id": "11477403", "url": "https://pubmed.ncbi.nlm.nih.gov/11477403" }, { "database": "PubMed", "id": "11689425", "url": "https://pubmed.ncbi.nlm.nih.gov/11689425" } ], "site_lbl": "Tyr288", "uniprot_canonical_ac": "Q9QUM4-1" } ], "record_id": "pubmed.11689425", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 5 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Molecular dissection of the signaling and costimulatory functions of CD150 (SLAM): CD150/SAP binding and CD150-mediated costimulation.", "journal": "Blood", "date": "2002", "authors": "Howie D, Simarro M, Sayos J, Guirado M, Sancho J, Terhorst C", "reference": { "type": "PubMed", "id": "11806999", "url": "https://pubmed.ncbi.nlm.nih.gov/11806999" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q13291-1", "protein_name": "Signaling lymphocytic activation molecule", "gene_name": "SLAMF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60880-1", "protein_name": "SH2 domain-containing protein 1A", "gene_name": "SH2D1A", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q13291", "url": "https://www.uniprot.org/uniprotkb/Q13291" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 279, "end_pos": 279, "sequence_org": "T", "sequence_mut": "A", "comment": "Disrupts interaction with SH2D1A; when associated with A-325.", "evidence": [ { "database": "UniProtKB", "id": "Q13291", "url": "https://www.uniprot.org/uniprotkb/Q13291" }, { "database": "PubMed", "id": "11806999", "url": "https://pubmed.ncbi.nlm.nih.gov/11806999" } ], "uniprot_canonical_ac": "Q13291-1" }, { "start_pos": 281, "end_pos": 281, "sequence_org": "Y", "sequence_mut": "F", "comment": "Disrupts interaction with INPP5D/SHIP-1 and PTPN11/SHP-2, no effect on interaction with SH2D1A.", "evidence": [ { "database": "UniProtKB", "id": "Q13291", "url": "https://www.uniprot.org/uniprotkb/Q13291" }, { "database": "PubMed", "id": "11313386", "url": "https://pubmed.ncbi.nlm.nih.gov/11313386" }, { "database": "PubMed", "id": "11806999", "url": "https://pubmed.ncbi.nlm.nih.gov/11806999" } ], "uniprot_canonical_ac": "Q13291-1" }, { "start_pos": 281, "end_pos": 281, "sequence_org": "Y", "sequence_mut": "F", "comment": "Disrupts interaction with SH2D1A; when associated with F-327.", "evidence": [ { "database": "UniProtKB", "id": "Q13291", "url": "https://www.uniprot.org/uniprotkb/Q13291" }, { "database": "PubMed", "id": "11806999", "url": "https://pubmed.ncbi.nlm.nih.gov/11806999" } ], "uniprot_canonical_ac": "Q13291-1" }, { "start_pos": 325, "end_pos": 325, "sequence_org": "T", "sequence_mut": "A", "comment": "Disrupts interaction with SH2D1A; when associated with A-279.", "evidence": [ { "database": "UniProtKB", "id": "Q13291", "url": "https://www.uniprot.org/uniprotkb/Q13291" }, { "database": "PubMed", "id": "11806999", "url": "https://pubmed.ncbi.nlm.nih.gov/11806999" } ], "uniprot_canonical_ac": "Q13291-1" }, { "start_pos": 327, "end_pos": 327, "sequence_org": "Y", "sequence_mut": "F", "comment": "Disrupts interaction with INPP5D/SHIP-1 and PTPN11/SHP-2, no effect on interaction with SH2D1A.", "evidence": [ { "database": "UniProtKB", "id": "Q13291", "url": "https://www.uniprot.org/uniprotkb/Q13291" }, { "database": "PubMed", "id": "11313386", "url": "https://pubmed.ncbi.nlm.nih.gov/11313386" }, { "database": "PubMed", "id": "11806999", "url": "https://pubmed.ncbi.nlm.nih.gov/11806999" } ], "uniprot_canonical_ac": "Q13291-1" }, { "start_pos": 327, "end_pos": 327, "sequence_org": "Y", "sequence_mut": "F", "comment": "Disrupts interaction with SH2D1A; when associated with F-281.", "evidence": [ { "database": "UniProtKB", "id": "Q13291", "url": "https://www.uniprot.org/uniprotkb/Q13291" }, { "database": "PubMed", "id": "11806999", "url": "https://pubmed.ncbi.nlm.nih.gov/11806999" } ], "uniprot_canonical_ac": "Q13291-1" } ], "phosphorylation": [ { "start_pos": 281, "end_pos": 281, "kinase_uniprot_canonical_ac": "P06241-1", "kinase_gene_name": "FYN", "residue": "Tyr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q13291", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q13291" }, { "database": "PubMed", "id": "11806999", "url": "https://pubmed.ncbi.nlm.nih.gov/11806999" } ], "site_lbl": "Tyr281", "uniprot_canonical_ac": "Q13291-1" }, { "start_pos": 281, "end_pos": 281, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "Phosphotyrosine; by FYN", "evidence": [ { "database": "UniProtKB", "id": "Q13291", "url": "https://www.uniprot.org/uniprotkb/Q13291" }, { "database": "IntAct", "id": "Q13291", "url": "https://www.ebi.ac.uk/intact/interactors/id:Q13291*" }, { "database": "iPTMnet", "id": "Q13291", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q13291" }, { "database": "PubMed", "id": "14674764", "url": "https://pubmed.ncbi.nlm.nih.gov/14674764" }, { "database": "PubMed", "id": "10549287", "url": "https://pubmed.ncbi.nlm.nih.gov/10549287" }, { "database": "PubMed", "id": "10607564", "url": "https://pubmed.ncbi.nlm.nih.gov/10607564" }, { "database": "PubMed", "id": "11313386", "url": "https://pubmed.ncbi.nlm.nih.gov/11313386" }, { "database": "PubMed", "id": "11389028", "url": "https://pubmed.ncbi.nlm.nih.gov/11389028" }, { "database": "PubMed", "id": "11477068", "url": "https://pubmed.ncbi.nlm.nih.gov/11477068" }, { "database": "PubMed", "id": "11806999", "url": "https://pubmed.ncbi.nlm.nih.gov/11806999" }, { "database": "PubMed", "id": "11823424", "url": "https://pubmed.ncbi.nlm.nih.gov/11823424" }, { "database": "PubMed", "id": "12225753", "url": "https://pubmed.ncbi.nlm.nih.gov/12225753" }, { "database": "PubMed", "id": "12545174", "url": "https://pubmed.ncbi.nlm.nih.gov/12545174" }, { "database": "PubMed", "id": "9774102", "url": "https://pubmed.ncbi.nlm.nih.gov/9774102" }, { "database": "PubMed", "id": "11099315", "url": "https://pubmed.ncbi.nlm.nih.gov/11099315" }, { "database": "PubMed", "id": "11689425", "url": "https://pubmed.ncbi.nlm.nih.gov/11689425" } ], "site_lbl": "Tyr281", "uniprot_canonical_ac": "Q13291-1" }, { "start_pos": 307, "end_pos": 307, "kinase_uniprot_canonical_ac": "P06241-1", "kinase_gene_name": "FYN", "residue": "Tyr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q13291", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q13291" }, { "database": "PubMed", "id": "11806999", "url": "https://pubmed.ncbi.nlm.nih.gov/11806999" } ], "site_lbl": "Tyr307", "uniprot_canonical_ac": "Q13291-1" }, { "start_pos": 307, "end_pos": 307, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "Phosphotyrosine; by FYN", "evidence": [ { "database": "UniProtKB", "id": "Q13291", "url": "https://www.uniprot.org/uniprotkb/Q13291" }, { "database": "IntAct", "id": "Q13291", "url": "https://www.ebi.ac.uk/intact/interactors/id:Q13291*" }, { "database": "iPTMnet", "id": "Q13291", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q13291" }, { "database": "PubMed", "id": "9774102", "url": "https://pubmed.ncbi.nlm.nih.gov/9774102" }, { "database": "PubMed", "id": "11806999", "url": "https://pubmed.ncbi.nlm.nih.gov/11806999" } ], "site_lbl": "Tyr307", "uniprot_canonical_ac": "Q13291-1" }, { "start_pos": 327, "end_pos": 327, "kinase_uniprot_canonical_ac": "P06241-1", "kinase_gene_name": "FYN", "residue": "Tyr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q13291", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q13291" }, { "database": "PubMed", "id": "11806999", "url": "https://pubmed.ncbi.nlm.nih.gov/11806999" } ], "site_lbl": "Tyr327", "uniprot_canonical_ac": "Q13291-1" }, { "start_pos": 327, "end_pos": 327, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "Phosphotyrosine; by FYN", "evidence": [ { "database": "UniProtKB", "id": "Q13291", "url": "https://www.uniprot.org/uniprotkb/Q13291" }, { "database": "iPTMnet", "id": "Q13291", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q13291" }, { "database": "PubMed", "id": "11099315", "url": "https://pubmed.ncbi.nlm.nih.gov/11099315" }, { "database": "PubMed", "id": "15315965", "url": "https://pubmed.ncbi.nlm.nih.gov/15315965" }, { "database": "PubMed", "id": "11806999", "url": "https://pubmed.ncbi.nlm.nih.gov/11806999" } ], "site_lbl": "Tyr327", "uniprot_canonical_ac": "Q13291-1" } ], "record_id": "pubmed.11806999", "abstract": "", "glycosylation": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 6 }, { "field": "total_sites", "count": 3 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "A `three-pronged` binding mechanism for the SAP/SH2D1A SH2 domain: structural basis and relevance to the XLP syndrome.", "journal": "The EMBO journal", "date": "2002", "authors": "Hwang PM, Li C, Morra M, Lillywhite J, Muhandiram DR, Gertler F, Terhorst C, Kay LE, Pawson T, Forman-Kay JD, Li SC", "reference": { "type": "PubMed", "id": "11823424", "url": "https://pubmed.ncbi.nlm.nih.gov/11823424" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q13291-1", "protein_name": "Signaling lymphocytic activation molecule", "gene_name": "SLAMF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60880-1", "protein_name": "SH2 domain-containing protein 1A", "gene_name": "SH2D1A", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q13291", "url": "https://www.uniprot.org/uniprotkb/Q13291" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 281, "end_pos": 281, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "Phosphotyrosine; by FYN", "evidence": [ { "database": "UniProtKB", "id": "Q13291", "url": "https://www.uniprot.org/uniprotkb/Q13291" }, { "database": "IntAct", "id": "Q13291", "url": "https://www.ebi.ac.uk/intact/interactors/id:Q13291*" }, { "database": "iPTMnet", "id": "Q13291", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q13291" }, { "database": "PubMed", "id": "14674764", "url": "https://pubmed.ncbi.nlm.nih.gov/14674764" }, { "database": "PubMed", "id": "10549287", "url": "https://pubmed.ncbi.nlm.nih.gov/10549287" }, { "database": "PubMed", "id": "10607564", "url": "https://pubmed.ncbi.nlm.nih.gov/10607564" }, { "database": "PubMed", "id": "11313386", "url": "https://pubmed.ncbi.nlm.nih.gov/11313386" }, { "database": "PubMed", "id": "11389028", "url": "https://pubmed.ncbi.nlm.nih.gov/11389028" }, { "database": "PubMed", "id": "11477068", "url": "https://pubmed.ncbi.nlm.nih.gov/11477068" }, { "database": "PubMed", "id": "11806999", "url": "https://pubmed.ncbi.nlm.nih.gov/11806999" }, { "database": "PubMed", "id": "11823424", "url": "https://pubmed.ncbi.nlm.nih.gov/11823424" }, { "database": "PubMed", "id": "12225753", "url": "https://pubmed.ncbi.nlm.nih.gov/12225753" }, { "database": "PubMed", "id": "12545174", "url": "https://pubmed.ncbi.nlm.nih.gov/12545174" }, { "database": "PubMed", "id": "9774102", "url": "https://pubmed.ncbi.nlm.nih.gov/9774102" }, { "database": "PubMed", "id": "11099315", "url": "https://pubmed.ncbi.nlm.nih.gov/11099315" }, { "database": "PubMed", "id": "11689425", "url": "https://pubmed.ncbi.nlm.nih.gov/11689425" } ], "site_lbl": "Tyr281", "uniprot_canonical_ac": "Q13291-1" } ], "mutagenesis": [ { "start_pos": 32, "end_pos": 32, "sequence_org": "R", "sequence_mut": "Q", "comment": "Strongly reduced affinity for SLAMF1.", "evidence": [ { "database": "UniProtKB", "id": "O60880", "url": "https://www.uniprot.org/uniprotkb/O60880" }, { "database": "PubMed", "id": "11823424", "url": "https://pubmed.ncbi.nlm.nih.gov/11823424" } ], "uniprot_canonical_ac": "O60880-1" } ], "record_id": "pubmed.11823424", "abstract": "", "glycosylation": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Side-chain dynamics of the SAP SH2 domain correlate with a binding hot spot and a region with conformational plasticity.", "journal": "Journal of molecular biology", "date": "2002", "authors": "Finerty PJ Jr, Muhandiram R, Forman-Kay JD", "reference": { "type": "PubMed", "id": "12225753", "url": "https://pubmed.ncbi.nlm.nih.gov/12225753" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q13291-1", "protein_name": "Signaling lymphocytic activation molecule", "gene_name": "SLAMF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UIB8-1", "protein_name": "SLAM family member 5", "gene_name": "CD84", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q13291", "url": "https://www.uniprot.org/uniprotkb/Q13291" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 281, "end_pos": 281, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "Phosphotyrosine; by FYN", "evidence": [ { "database": "UniProtKB", "id": "Q13291", "url": "https://www.uniprot.org/uniprotkb/Q13291" }, { "database": "IntAct", "id": "Q13291", "url": "https://www.ebi.ac.uk/intact/interactors/id:Q13291*" }, { "database": "iPTMnet", "id": "Q13291", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q13291" }, { "database": "PubMed", "id": "14674764", "url": "https://pubmed.ncbi.nlm.nih.gov/14674764" }, { "database": "PubMed", "id": "10549287", "url": "https://pubmed.ncbi.nlm.nih.gov/10549287" }, { "database": "PubMed", "id": "10607564", "url": "https://pubmed.ncbi.nlm.nih.gov/10607564" }, { "database": "PubMed", "id": "11313386", "url": "https://pubmed.ncbi.nlm.nih.gov/11313386" }, { "database": "PubMed", "id": "11389028", "url": "https://pubmed.ncbi.nlm.nih.gov/11389028" }, { "database": "PubMed", "id": "11477068", "url": "https://pubmed.ncbi.nlm.nih.gov/11477068" }, { "database": "PubMed", "id": "11806999", "url": "https://pubmed.ncbi.nlm.nih.gov/11806999" }, { "database": "PubMed", "id": "11823424", "url": "https://pubmed.ncbi.nlm.nih.gov/11823424" }, { "database": "PubMed", "id": "12225753", "url": "https://pubmed.ncbi.nlm.nih.gov/12225753" }, { "database": "PubMed", "id": "12545174", "url": "https://pubmed.ncbi.nlm.nih.gov/12545174" }, { "database": "PubMed", "id": "9774102", "url": "https://pubmed.ncbi.nlm.nih.gov/9774102" }, { "database": "PubMed", "id": "11099315", "url": "https://pubmed.ncbi.nlm.nih.gov/11099315" }, { "database": "PubMed", "id": "11689425", "url": "https://pubmed.ncbi.nlm.nih.gov/11689425" } ], "site_lbl": "Tyr281", "uniprot_canonical_ac": "Q13291-1" }, { "start_pos": 281, "end_pos": 281, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "", "evidence": [ { "database": "IntAct", "id": "Q9UIB8", "url": "https://www.ebi.ac.uk/intact/interactors/id:Q9UIB8*" }, { "database": "iPTMnet", "id": "Q9UIB8", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9UIB8" }, { "database": "PubMed", "id": "12225753", "url": "https://pubmed.ncbi.nlm.nih.gov/12225753" } ], "site_lbl": "Tyr281", "uniprot_canonical_ac": "Q9UIB8-1" } ], "record_id": "pubmed.12225753", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Dual functional roles for the X-linked lymphoproliferative syndrome gene product SAP/SH2D1A in signaling through the signaling lymphocyte activation molecule (SLAM) family of immune receptors.", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "Li C, Iosef C, Jia CY, Han VK, Li SS", "reference": { "type": "PubMed", "id": "12458214", "url": "https://pubmed.ncbi.nlm.nih.gov/12458214" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q13291-1", "protein_name": "Signaling lymphocytic activation molecule", "gene_name": "SLAMF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UIB8-1", "protein_name": "SLAM family member 5", "gene_name": "CD84", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BZW8-1", "protein_name": "Natural killer cell receptor 2B4", "gene_name": "CD244", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HBG7-1", "protein_name": "T-lymphocyte surface antigen Ly-9", "gene_name": "LY9", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60880-1", "protein_name": "SH2 domain-containing protein 1A", "gene_name": "SH2D1A", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q13291", "url": "https://www.uniprot.org/uniprotkb/Q13291" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 279, "end_pos": 279, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "Phosphotyrosine", "evidence": [ { "database": "UniProtKB", "id": "Q9UIB8", "url": "https://www.uniprot.org/uniprotkb/Q9UIB8" }, { "database": "PubMed", "id": "12458214", "url": "https://pubmed.ncbi.nlm.nih.gov/12458214" }, { "database": "IntAct", "id": "Q9UIB8", "url": "https://www.ebi.ac.uk/intact/interactors/id:Q9UIB8*" }, { "database": "iPTMnet", "id": "Q9UIB8", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9UIB8" }, { "database": "PubMed", "id": "12928397", "url": "https://pubmed.ncbi.nlm.nih.gov/12928397" } ], "site_lbl": "Tyr279", "uniprot_canonical_ac": "Q9UIB8-1" }, { "start_pos": 316, "end_pos": 316, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "Phosphotyrosine", "evidence": [ { "database": "UniProtKB", "id": "Q9UIB8", "url": "https://www.uniprot.org/uniprotkb/Q9UIB8" }, { "database": "PubMed", "id": "16037392", "url": "https://pubmed.ncbi.nlm.nih.gov/16037392" }, { "database": "PubMed", "id": "12458214", "url": "https://pubmed.ncbi.nlm.nih.gov/12458214" }, { "database": "IntAct", "id": "Q9UIB8", "url": "https://www.ebi.ac.uk/intact/interactors/id:Q9UIB8*" }, { "database": "iPTMnet", "id": "Q9UIB8", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9UIB8" }, { "database": "PubMed", "id": "12928397", "url": "https://pubmed.ncbi.nlm.nih.gov/12928397" } ], "site_lbl": "Tyr316", "uniprot_canonical_ac": "Q9UIB8-1" }, { "start_pos": 271, "end_pos": 271, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "Phosphotyrosine", "evidence": [ { "database": "UniProtKB", "id": "Q9BZW8", "url": "https://www.uniprot.org/uniprotkb/Q9BZW8" }, { "database": "PubMed", "id": "15713798", "url": "https://pubmed.ncbi.nlm.nih.gov/15713798" }, { "database": "PubMed", "id": "12458214", "url": "https://pubmed.ncbi.nlm.nih.gov/12458214" }, { "database": "PubMed", "id": "26221972", "url": "https://pubmed.ncbi.nlm.nih.gov/26221972" }, { "database": "iPTMnet", "id": "Q9BZW8", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9BZW8" } ], "site_lbl": "Tyr271", "uniprot_canonical_ac": "Q9BZW8-1" }, { "start_pos": 297, "end_pos": 297, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "Phosphotyrosine; by FYN", "evidence": [ { "database": "UniProtKB", "id": "Q9BZW8", "url": "https://www.uniprot.org/uniprotkb/Q9BZW8" }, { "database": "iPTMnet", "id": "Q9BZW8", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9BZW8" }, { "database": "PubMed", "id": "15713798", "url": "https://pubmed.ncbi.nlm.nih.gov/15713798" }, { "database": "PubMed", "id": "26221972", "url": "https://pubmed.ncbi.nlm.nih.gov/26221972" }, { "database": "PubMed", "id": "12458214", "url": "https://pubmed.ncbi.nlm.nih.gov/12458214" } ], "site_lbl": "Tyr297", "uniprot_canonical_ac": "Q9BZW8-1" }, { "start_pos": 317, "end_pos": 317, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "Phosphotyrosine", "evidence": [ { "database": "UniProtKB", "id": "Q9BZW8", "url": "https://www.uniprot.org/uniprotkb/Q9BZW8" }, { "database": "PubMed", "id": "15713798", "url": "https://pubmed.ncbi.nlm.nih.gov/15713798" }, { "database": "PubMed", "id": "12458214", "url": "https://pubmed.ncbi.nlm.nih.gov/12458214" }, { "database": "iPTMnet", "id": "Q9BZW8", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9BZW8" } ], "site_lbl": "Tyr317", "uniprot_canonical_ac": "Q9BZW8-1" }, { "start_pos": 342, "end_pos": 342, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "Phosphotyrosine; by FYN", "evidence": [ { "database": "UniProtKB", "id": "Q9BZW8", "url": "https://www.uniprot.org/uniprotkb/Q9BZW8" }, { "database": "IntAct", "id": "Q9BZW8", "url": "https://www.ebi.ac.uk/intact/interactors/id:Q9BZW8*" }, { "database": "iPTMnet", "id": "Q9BZW8", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9BZW8" }, { "database": "PubMed", "id": "16177062", "url": "https://pubmed.ncbi.nlm.nih.gov/16177062" }, { "database": "PubMed", "id": "15713798", "url": "https://pubmed.ncbi.nlm.nih.gov/15713798" }, { "database": "PubMed", "id": "12458214", "url": "https://pubmed.ncbi.nlm.nih.gov/12458214" } ], "site_lbl": "Tyr342", "uniprot_canonical_ac": "Q9BZW8-1" }, { "start_pos": 603, "end_pos": 603, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "Phosphotyrosine", "evidence": [ { "database": "UniProtKB", "id": "Q9HBG7", "url": "https://www.uniprot.org/uniprotkb/Q9HBG7" }, { "database": "PubMed", "id": "26221972", "url": "https://pubmed.ncbi.nlm.nih.gov/26221972" }, { "database": "PubMed", "id": "12458214", "url": "https://pubmed.ncbi.nlm.nih.gov/12458214" }, { "database": "iPTMnet", "id": "Q9HBG7", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9HBG7" } ], "site_lbl": "Tyr603", "uniprot_canonical_ac": "Q9HBG7-1" } ], "record_id": "pubmed.12458214", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 5 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 7 }, { "field": "total_sites", "count": 7 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "SAP couples Fyn to SLAM immune receptors.", "journal": "Nat. Cell Biol.", "date": "2003", "authors": "Chan B, Lanyi A, Song HK, Griesbach J, Simarro-Grande M, Poy F, Howie D, Sumegi J, Terhorst C, Eck MJ", "reference": { "type": "PubMed", "id": "12545174", "url": "https://pubmed.ncbi.nlm.nih.gov/12545174" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q13291-1", "protein_name": "Signaling lymphocytic activation molecule", "gene_name": "SLAMF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06241-1", "protein_name": "Tyrosine-protein kinase Fyn", "gene_name": "FYN", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60880-1", "protein_name": "SH2 domain-containing protein 1A", "gene_name": "SH2D1A", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q13291", "url": "https://www.uniprot.org/uniprotkb/Q13291" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 281, "end_pos": 281, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "Phosphotyrosine; by FYN", "evidence": [ { "database": "UniProtKB", "id": "Q13291", "url": "https://www.uniprot.org/uniprotkb/Q13291" }, { "database": "IntAct", "id": "Q13291", "url": "https://www.ebi.ac.uk/intact/interactors/id:Q13291*" }, { "database": "iPTMnet", "id": "Q13291", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q13291" }, { "database": "PubMed", "id": "14674764", "url": "https://pubmed.ncbi.nlm.nih.gov/14674764" }, { "database": "PubMed", "id": "10549287", "url": "https://pubmed.ncbi.nlm.nih.gov/10549287" }, { "database": "PubMed", "id": "10607564", "url": "https://pubmed.ncbi.nlm.nih.gov/10607564" }, { "database": "PubMed", "id": "11313386", "url": "https://pubmed.ncbi.nlm.nih.gov/11313386" }, { "database": "PubMed", "id": "11389028", "url": "https://pubmed.ncbi.nlm.nih.gov/11389028" }, { "database": "PubMed", "id": "11477068", "url": "https://pubmed.ncbi.nlm.nih.gov/11477068" }, { "database": "PubMed", "id": "11806999", "url": "https://pubmed.ncbi.nlm.nih.gov/11806999" }, { "database": "PubMed", "id": "11823424", "url": "https://pubmed.ncbi.nlm.nih.gov/11823424" }, { "database": "PubMed", "id": "12225753", "url": "https://pubmed.ncbi.nlm.nih.gov/12225753" }, { "database": "PubMed", "id": "12545174", "url": "https://pubmed.ncbi.nlm.nih.gov/12545174" }, { "database": "PubMed", "id": "9774102", "url": "https://pubmed.ncbi.nlm.nih.gov/9774102" }, { "database": "PubMed", "id": "11099315", "url": "https://pubmed.ncbi.nlm.nih.gov/11099315" }, { "database": "PubMed", "id": "11689425", "url": "https://pubmed.ncbi.nlm.nih.gov/11689425" } ], "site_lbl": "Tyr281", "uniprot_canonical_ac": "Q13291-1" } ], "mutagenesis": [ { "start_pos": 78, "end_pos": 78, "sequence_org": "R", "sequence_mut": "E", "comment": "Disrupts interaction with FYN.", "evidence": [ { "database": "UniProtKB", "id": "O60880", "url": "https://www.uniprot.org/uniprotkb/O60880" }, { "database": "PubMed", "id": "12545174", "url": "https://pubmed.ncbi.nlm.nih.gov/12545174" } ], "uniprot_canonical_ac": "O60880-1" } ], "record_id": "pubmed.12545174", "abstract": "", "glycosylation": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Absence of SLAM mutations in EBV-associated lymphoproliferative disease patients.", "journal": "J. Med. Virol.", "date": "2003", "authors": "Ferrand V\u00e9ronique, Li Cuiling, Romeo Giovanni, Yin Luo", "reference": { "type": "PubMed", "id": "12629654", "url": "https://pubmed.ncbi.nlm.nih.gov/12629654" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q13291-1", "protein_name": "Signaling lymphocytic activation molecule", "gene_name": "SLAMF1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q13291", "url": "https://www.uniprot.org/uniprotkb/Q13291" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.12629654", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Disease-causing SAP mutants are defective in ligand binding and protein folding.", "journal": "Biochemistry", "date": "2003", "authors": "Li C, Iosef C, Jia CY, Gkourasas T, Han VK, Shun-Cheng Li S", "reference": { "type": "PubMed", "id": "14674764", "url": "https://pubmed.ncbi.nlm.nih.gov/14674764" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q13291-1", "protein_name": "Signaling lymphocytic activation molecule", "gene_name": "SLAMF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60880-1", "protein_name": "SH2 domain-containing protein 1A", "gene_name": "SH2D1A", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q13291", "url": "https://www.uniprot.org/uniprotkb/Q13291" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 281, "end_pos": 281, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "Phosphotyrosine; by FYN", "evidence": [ { "database": "UniProtKB", "id": "Q13291", "url": "https://www.uniprot.org/uniprotkb/Q13291" }, { "database": "IntAct", "id": "Q13291", "url": "https://www.ebi.ac.uk/intact/interactors/id:Q13291*" }, { "database": "iPTMnet", "id": "Q13291", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q13291" }, { "database": "PubMed", "id": "14674764", "url": "https://pubmed.ncbi.nlm.nih.gov/14674764" }, { "database": "PubMed", "id": "10549287", "url": "https://pubmed.ncbi.nlm.nih.gov/10549287" }, { "database": "PubMed", "id": "10607564", "url": "https://pubmed.ncbi.nlm.nih.gov/10607564" }, { "database": "PubMed", "id": "11313386", "url": "https://pubmed.ncbi.nlm.nih.gov/11313386" }, { "database": "PubMed", "id": "11389028", "url": "https://pubmed.ncbi.nlm.nih.gov/11389028" }, { "database": "PubMed", "id": "11477068", "url": "https://pubmed.ncbi.nlm.nih.gov/11477068" }, { "database": "PubMed", "id": "11806999", "url": "https://pubmed.ncbi.nlm.nih.gov/11806999" }, { "database": "PubMed", "id": "11823424", "url": "https://pubmed.ncbi.nlm.nih.gov/11823424" }, { "database": "PubMed", "id": "12225753", "url": "https://pubmed.ncbi.nlm.nih.gov/12225753" }, { "database": "PubMed", "id": "12545174", "url": "https://pubmed.ncbi.nlm.nih.gov/12545174" }, { "database": "PubMed", "id": "9774102", "url": "https://pubmed.ncbi.nlm.nih.gov/9774102" }, { "database": "PubMed", "id": "11099315", "url": "https://pubmed.ncbi.nlm.nih.gov/11099315" }, { "database": "PubMed", "id": "11689425", "url": "https://pubmed.ncbi.nlm.nih.gov/11689425" } ], "site_lbl": "Tyr281", "uniprot_canonical_ac": "Q13291-1" } ], "record_id": "pubmed.14674764", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The adaptor protein SH2D1A regulates signaling through CD150 (SLAM) in B cells.", "journal": "Blood", "date": "2004", "authors": "Mikhalap SV, Shlapatska LM, Yurchenko OV, Yurchenko MY, Berdova GG, Nichols KE, Clark EA, Sidorenko SP", "reference": { "type": "PubMed", "id": "15315965", "url": "https://pubmed.ncbi.nlm.nih.gov/15315965" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q13291-1", "protein_name": "Signaling lymphocytic activation molecule", "gene_name": "SLAMF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9QUM4-1", "protein_name": "Signaling lymphocytic activation molecule", "gene_name": "Slamf1", "tax_name": "Mouse" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q13291", "url": "https://www.uniprot.org/uniprotkb/Q13291" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 327, "end_pos": 327, "kinase_uniprot_canonical_ac": "P07948-1", "kinase_gene_name": "LYN", "residue": "Tyr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q13291", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q13291" }, { "database": "PubMed", "id": "15315965", "url": "https://pubmed.ncbi.nlm.nih.gov/15315965" } ], "site_lbl": "Tyr327", "uniprot_canonical_ac": "Q13291-1" }, { "start_pos": 327, "end_pos": 327, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "Phosphotyrosine; by FYN", "evidence": [ { "database": "UniProtKB", "id": "Q13291", "url": "https://www.uniprot.org/uniprotkb/Q13291" }, { "database": "iPTMnet", "id": "Q13291", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q13291" }, { "database": "PubMed", "id": "11099315", "url": "https://pubmed.ncbi.nlm.nih.gov/11099315" }, { "database": "PubMed", "id": "15315965", "url": "https://pubmed.ncbi.nlm.nih.gov/15315965" }, { "database": "PubMed", "id": "11806999", "url": "https://pubmed.ncbi.nlm.nih.gov/11806999" } ], "site_lbl": "Tyr327", "uniprot_canonical_ac": "Q13291-1" } ], "record_id": "pubmed.15315965", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "SLAM/SLAM interactions inhibit CD40-induced production of inflammatory cytokines in monocyte-derived dendritic cells.", "journal": "Blood", "date": "2006", "authors": "Rethi B, Gogolak P, Szatmari I, Veres A, Erdos E, Nagy L, Rajnavolgyi E, Terhorst C, Lanyi A", "reference": { "type": "PubMed", "id": "16317102", "url": "https://pubmed.ncbi.nlm.nih.gov/16317102" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q13291-1", "protein_name": "Signaling lymphocytic activation molecule", "gene_name": "SLAMF1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q13291", "url": "https://www.uniprot.org/uniprotkb/Q13291" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.16317102", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "CD150 regulates JNK1/2 activation in normal and Hodgkin's lymphoma B cells.", "journal": "Immunology and cell biology", "date": "2010-07", "authors": "Yurchenko Mariya Y, Kovalevska Larysa M, Shlapatska Larysa M, Berdova Ganna G, Clark Edward A, Sidorenko Svetlana P", "reference": { "type": "PubMed", "id": "20231852", "url": "https://pubmed.ncbi.nlm.nih.gov/20231852" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q13291-1", "protein_name": "Signaling lymphocytic activation molecule", "gene_name": "SLAMF1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q13291", "url": "https://www.uniprot.org/uniprotkb/Q13291" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.20231852", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "SLAM is a microbial sensor that regulates bacterial phagosome functions in macrophages.", "journal": "Nature immunology", "date": "2010-10", "authors": "Berger Scott B, Romero Xavier, Ma Chunyan, Wang Guoxing, Faubion William A, Liao Gongxian, Compeer Ewoud, Keszei Marton, Rameh Lucia, Wang Ninghai, Boes Marianne, Regueiro Jose R, Reinecker Hans-Christian, Terhorst Cox", "reference": { "type": "PubMed", "id": "20818396", "url": "https://pubmed.ncbi.nlm.nih.gov/20818396" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q13291-1", "protein_name": "Signaling lymphocytic activation molecule", "gene_name": "SLAMF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9QUM4-1", "protein_name": "Signaling lymphocytic activation molecule", "gene_name": "Slamf1", "tax_name": "Mouse" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q13291", "url": "https://www.uniprot.org/uniprotkb/Q13291" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.20818396", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Structure of the measles virus hemagglutinin bound to its cellular receptor SLAM.", "journal": "Nature structural & molecular biology", "date": "2011-02", "authors": "Hashiguchi Takao, Ose Toyoyuki, Kubota Marie, Maita Nobuo, Kamishikiryo Jun, Maenaka Katsumi, Yanagi Yusuke", "reference": { "type": "PubMed", "id": "21217702", "url": "https://pubmed.ncbi.nlm.nih.gov/21217702" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q13291-1", "protein_name": "Signaling lymphocytic activation molecule", "gene_name": "SLAMF1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q13291", "url": "https://www.uniprot.org/uniprotkb/Q13291" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.21217702", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Expression of CD150 in tumors of the central nervous system: identification of a novel isoform.", "journal": "PLoS ONE", "date": "2015", "authors": "Romanets-Korbut Olga, Najakshin Alexander M, Yurchenko Mariya, Malysheva Tatyana A, Kovalevska Larysa, Shlapatska Larysa M, Zozulya Yuriy A, Taranin Alexander V, Horvat Branka, Sidorenko Svetlana P", "reference": { "type": "PubMed", "id": "25710480", "url": "https://pubmed.ncbi.nlm.nih.gov/25710480" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q13291-1", "protein_name": "Signaling lymphocytic activation molecule", "gene_name": "SLAMF1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q13291", "url": "https://www.uniprot.org/uniprotkb/Q13291" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.25710480", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Upstream open reading frames regulate translation of the long isoform of SLAMF1 mRNA that encodes costimulatory receptor CD150.", "journal": "Biochemistry. Biokhimiia", "date": "2014", "authors": "Putlyaeva LV, Schwartz AM, Korneev KV, Covic M, Uroshlev LA, Makeev VY, Dmitriev SE, Kuprash DV", "reference": { "type": "PubMed", "id": "25716736", "url": "https://pubmed.ncbi.nlm.nih.gov/25716736" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q13291-1", "protein_name": "Signaling lymphocytic activation molecule", "gene_name": "SLAMF1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q13291", "url": "https://www.uniprot.org/uniprotkb/Q13291" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.25716736", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Measles Virus Hemagglutinin Protein Establishes a Specific Interaction With the Extreme N-Terminal Region of Human Signaling Lymphocytic Activation Molecule to Enhance Infection.", "journal": "Frontiers in microbiology", "date": "2020", "authors": "Seki Fumio, Yamamoto Yuta, Fukuhara Hideo, Ohishi Kazue, Maruyama Tadashi, Maenaka Katsumi, Tokiwa Hiroaki, Takeda Makoto", "reference": { "type": "PubMed", "id": "32922371", "url": "https://pubmed.ncbi.nlm.nih.gov/32922371" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q13291-1", "protein_name": "Signaling lymphocytic activation molecule", "gene_name": "SLAMF1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q13291", "url": "https://www.uniprot.org/uniprotkb/Q13291" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 29, "end_pos": 29, "sequence_org": "M", "sequence_mut": "S", "comment": "Reduced infectivity.", "evidence": [ { "database": "UniProtKB", "id": "Q13291", "url": "https://www.uniprot.org/uniprotkb/Q13291" }, { "database": "PubMed", "id": "32922371", "url": "https://pubmed.ncbi.nlm.nih.gov/32922371" } ], "uniprot_canonical_ac": "Q13291-1" } ], "record_id": "pubmed.32922371", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "SLAMF1/CD150 expression and topology in prostate and breast cancer cell lines.", "journal": "Experimental oncology", "date": "2021", "authors": "Gordiienko IM, Lykhova OO, Shcherbina VM, Shlapatska LM", "reference": { "type": "PubMed", "id": "34967540", "url": "https://pubmed.ncbi.nlm.nih.gov/34967540" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q13291-1", "protein_name": "Signaling lymphocytic activation molecule", "gene_name": "SLAMF1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q13291", "url": "https://www.uniprot.org/uniprotkb/Q13291" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.34967540", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "SLAMF1 is expressed and secreted by hepatocytes and the liver in nonalcoholic fatty liver disease.", "journal": "American journal of physiology. Gastrointestinal and liver physiology", "date": "2022", "authors": "Gomez-Torres O, Amatya S, Kamberov L, Dhaibar HA, Khanna P, Rom O, Yurdagul A Jr, Orr AW, Nunez K, Thevenot P, Cohen A, Samant H, Alexander JS, Burgos-Ramos E, Chapa-Rodriguez A, Cruz-Topete D", "reference": { "type": "PubMed", "id": "35853010", "url": "https://pubmed.ncbi.nlm.nih.gov/35853010" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q13291-1", "protein_name": "Signaling lymphocytic activation molecule", "gene_name": "SLAMF1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q13291", "url": "https://www.uniprot.org/uniprotkb/Q13291" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.35853010", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Identification of SLAMF1 as an immune-related key gene associated with rheumatoid arthritis and verified in mice collagen-induced arthritis model.", "journal": "Frontiers in immunology", "date": "2022", "authors": "Li A, Zhang Z, Ru X, Yi Y, Li X, Qian J, Wang J, Yang X, Yao Y", "reference": { "type": "PubMed", "id": "36110846", "url": "https://pubmed.ncbi.nlm.nih.gov/36110846" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q13291-1", "protein_name": "Signaling lymphocytic activation molecule", "gene_name": "SLAMF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9QUM4-1", "protein_name": "Signaling lymphocytic activation molecule", "gene_name": "Slamf1", "tax_name": "Mouse" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q13291", "url": "https://www.uniprot.org/uniprotkb/Q13291" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.36110846", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "SLAMF1 as a novel molecule mediating the causal association between rheumatoid arthritis and interstitial lung disease: A Mendelian randomization study combined with transcriptomics and in vivo validation.", "journal": "International immunopharmacology", "date": "2024-12-05", "authors": "Liu Muqiu, Jiang Zhihao, Liu Min, Ni Haojie, Li Yanwu, Fang Jiansong, Du Qun, Dong Yan", "reference": { "type": "PubMed", "id": "39260308", "url": "https://pubmed.ncbi.nlm.nih.gov/39260308" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q13291-1", "protein_name": "Signaling lymphocytic activation molecule", "gene_name": "SLAMF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "D3ZAD7-1", "protein_name": "Signaling lymphocytic activation molecule family member 1", "gene_name": "Slamf1", "tax_name": "Rat" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q13291", "url": "https://www.uniprot.org/uniprotkb/Q13291" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.39260308", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "A novel receptor involved in T-cell activation.", "journal": "Nature", "date": "1995", "authors": "Cocks BG, Chang CC, Carballido JM, Yssel H, de Vries JE, Aversa G", "reference": { "type": "PubMed", "id": "7617038", "url": "https://pubmed.ncbi.nlm.nih.gov/7617038" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q13291-1", "protein_name": "Signaling lymphocytic activation molecule", "gene_name": "SLAMF1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q13291", "url": "https://www.uniprot.org/uniprotkb/Q13291" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.7617038", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Soluble and membrane-bound forms of signaling lymphocytic activation molecule (SLAM) induce proliferation and Ig synthesis by activated human B lymphocytes.", "journal": "J. Exp. Med.", "date": "1997", "authors": "Punnonen J, Cocks BG, Carballido JM, Bennett B, Peterson D, Aversa G, de Vries JE", "reference": { "type": "PubMed", "id": "9091591", "url": "https://pubmed.ncbi.nlm.nih.gov/9091591" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q13291-1", "protein_name": "Signaling lymphocytic activation molecule", "gene_name": "SLAMF1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q13291", "url": "https://www.uniprot.org/uniprotkb/Q13291" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.9091591", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The X-linked lymphoproliferative-disease gene product SAP regulates signals induced through the co-receptor SLAM.", "journal": "Nature", "date": "1998", "authors": "Sayos J, Wu C, Morra M, Wang N, Zhang X, Allen D, van Schaik S, Notarangelo L, Geha R, Roncarolo MG, Oettgen H, De Vries JE, Aversa G, Terhorst C", "reference": { "type": "PubMed", "id": "9774102", "url": "https://pubmed.ncbi.nlm.nih.gov/9774102" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q13291-1", "protein_name": "Signaling lymphocytic activation molecule", "gene_name": "SLAMF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O88890-1", "protein_name": "SH2 domain-containing protein 1A", "gene_name": "Sh2d1a", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "O60880-1", "protein_name": "SH2 domain-containing protein 1A", "gene_name": "SH2D1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9QUM4-1", "protein_name": "Signaling lymphocytic activation molecule", "gene_name": "Slamf1", "tax_name": "Mouse" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q13291", "url": "https://www.uniprot.org/uniprotkb/Q13291" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 281, "end_pos": 281, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "Phosphotyrosine; by FYN", "evidence": [ { "database": "UniProtKB", "id": "Q13291", "url": "https://www.uniprot.org/uniprotkb/Q13291" }, { "database": "IntAct", "id": "Q13291", "url": "https://www.ebi.ac.uk/intact/interactors/id:Q13291*" }, { "database": "iPTMnet", "id": "Q13291", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q13291" }, { "database": "PubMed", "id": "14674764", "url": "https://pubmed.ncbi.nlm.nih.gov/14674764" }, { "database": "PubMed", "id": "10549287", "url": "https://pubmed.ncbi.nlm.nih.gov/10549287" }, { "database": "PubMed", "id": "10607564", "url": "https://pubmed.ncbi.nlm.nih.gov/10607564" }, { "database": "PubMed", "id": "11313386", "url": "https://pubmed.ncbi.nlm.nih.gov/11313386" }, { "database": "PubMed", "id": "11389028", "url": "https://pubmed.ncbi.nlm.nih.gov/11389028" }, { "database": "PubMed", "id": "11477068", "url": "https://pubmed.ncbi.nlm.nih.gov/11477068" }, { "database": "PubMed", "id": "11806999", "url": "https://pubmed.ncbi.nlm.nih.gov/11806999" }, { "database": "PubMed", "id": "11823424", "url": "https://pubmed.ncbi.nlm.nih.gov/11823424" }, { "database": "PubMed", "id": "12225753", "url": "https://pubmed.ncbi.nlm.nih.gov/12225753" }, { "database": "PubMed", "id": "12545174", "url": "https://pubmed.ncbi.nlm.nih.gov/12545174" }, { "database": "PubMed", "id": "9774102", "url": "https://pubmed.ncbi.nlm.nih.gov/9774102" }, { "database": "PubMed", "id": "11099315", "url": "https://pubmed.ncbi.nlm.nih.gov/11099315" }, { "database": "PubMed", "id": "11689425", "url": "https://pubmed.ncbi.nlm.nih.gov/11689425" } ], "site_lbl": "Tyr281", "uniprot_canonical_ac": "Q13291-1" }, { "start_pos": 307, "end_pos": 307, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "Phosphotyrosine; by FYN", "evidence": [ { "database": "UniProtKB", "id": "Q13291", "url": "https://www.uniprot.org/uniprotkb/Q13291" }, { "database": "IntAct", "id": "Q13291", "url": "https://www.ebi.ac.uk/intact/interactors/id:Q13291*" }, { "database": "iPTMnet", "id": "Q13291", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q13291" }, { "database": "PubMed", "id": "9774102", "url": "https://pubmed.ncbi.nlm.nih.gov/9774102" }, { "database": "PubMed", "id": "11806999", "url": "https://pubmed.ncbi.nlm.nih.gov/11806999" } ], "site_lbl": "Tyr307", "uniprot_canonical_ac": "Q13291-1" } ], "record_id": "pubmed.9774102", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 4 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Elongin A regulates transcription in vivo through enhanced RNA polymerase processivity.", "journal": "The Journal of biological chemistry", "date": "2021", "authors": "Wang Y, Hou L, Ardehali MB, Kingston RE, Dynlacht BD", "reference": { "type": "PubMed", "id": "33298525", "url": "https://pubmed.ncbi.nlm.nih.gov/33298525" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q14241-2", "protein_name": "Elongin-A", "gene_name": "ELOA", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q14241", "url": "https://www.uniprot.org/uniprotkb/Q14241" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.33298525", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "TCEB3 initiates ovarian cancer apoptosis by mediating ubiquitination and degradation of MCL-1.", "journal": "FASEB journal : official publication of the Federation of American Societies for Experimental Biology", "date": "2024-04-30", "authors": "Cai Ying, Li Yun, Xu Yingjie, Yang Wen, Huang Masha", "reference": { "type": "PubMed", "id": "38661028", "url": "https://pubmed.ncbi.nlm.nih.gov/38661028" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q14241-2", "protein_name": "Elongin-A", "gene_name": "ELOA", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q14241", "url": "https://www.uniprot.org/uniprotkb/Q14241" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.38661028", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "A human cDNA encoding the 110-kDa A subunit of RNA polymerase II transcription factor elongin.", "journal": "Gene", "date": "1996-02-12", "authors": "Aso T, Haque D, Fukudome K, Brower C S, Conaway J W, Conaway R C", "reference": { "type": "PubMed", "id": "8654961", "url": "https://pubmed.ncbi.nlm.nih.gov/8654961" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q14241-2", "protein_name": "Elongin-A", "gene_name": "ELOA", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q14241", "url": "https://www.uniprot.org/uniprotkb/Q14241" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.8654961", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Structure of the VHL-ElonginC-ElonginB complex: implications for VHL tumor suppressor function.", "journal": "Science (New York, N.Y.)", "date": "1999-04-16", "authors": "Stebbins C E, Kaelin W G, Pavletich N P", "reference": { "type": "PubMed", "id": "10205047", "url": "https://pubmed.ncbi.nlm.nih.gov/10205047" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q15369-1", "protein_name": "Elongin-C", "gene_name": "ELOC", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15370-1", "protein_name": "Elongin-B", "gene_name": "ELOB", "tax_name": "Human" }, { "uniprot_canonical_ac": "P40337-1", "protein_name": "von Hippel-Lindau disease tumor suppressor", "gene_name": "VHL", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q15369", "url": "https://www.uniprot.org/uniprotkb/Q15369" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.10205047", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Amplification and overexpression of Elongin C gene discovered in prostate cancer by cDNA microarrays.", "journal": "Lab. Invest.", "date": "2002", "authors": "Porkka Kati, Saram\u00e4ki Outi, Tanner Minna, Visakorpi Tapio", "reference": { "type": "PubMed", "id": "12004003", "url": "https://pubmed.ncbi.nlm.nih.gov/12004003" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q15369-1", "protein_name": "Elongin-C", "gene_name": "ELOC", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q15369", "url": "https://www.uniprot.org/uniprotkb/Q15369" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.12004003", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "TMF/ARA160 is a BC-box-containing protein that mediates the degradation of Stat3.", "journal": "Oncogene", "date": "2004", "authors": "Perry E, Tsruya R, Levitsky P, Pomp O, Taller M, Weisberg S, Parris W, Kulkarni S, Malovani H, Pawson T, Shpungin S, Nir U", "reference": { "type": "PubMed", "id": "15467733", "url": "https://pubmed.ncbi.nlm.nih.gov/15467733" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q15369-1", "protein_name": "Elongin-C", "gene_name": "ELOC", "tax_name": "Human" }, { "uniprot_canonical_ac": "P70451-1", "protein_name": "Tyrosine-protein kinase Fer", "gene_name": "Fer", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "B9EKI3-1", "protein_name": "TATA element modulatory factor", "gene_name": "Tmf1", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "P40763-1", "protein_name": "Signal transducer and activator of transcription 3", "gene_name": "STAT3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P82094-1", "protein_name": "TATA element modulatory factor", "gene_name": "TMF1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q15369", "url": "https://www.uniprot.org/uniprotkb/Q15369" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 333, "end_pos": 335, "sequence_org": "SLD", "sequence_mut": "AAA", "comment": "Strongly reduced the ubiquitination directing activity of the protein.", "evidence": [ { "database": "UniProtKB", "id": "P82094", "url": "https://www.uniprot.org/uniprotkb/P82094" }, { "database": "PubMed", "id": "15467733", "url": "https://pubmed.ncbi.nlm.nih.gov/15467733" } ], "uniprot_canonical_ac": "P82094-1" } ], "record_id": "pubmed.15467733", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 5 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Suppressors of cytokine signaling 4 and 5 regulate epidermal growth factor receptor signaling.", "journal": "The Journal of biological chemistry", "date": "2005", "authors": "Kario E, Marmor MD, Adamsky K, Citri A, Amit I, Amariglio N, Rechavi G, Yarden Y", "reference": { "type": "PubMed", "id": "15590694", "url": "https://pubmed.ncbi.nlm.nih.gov/15590694" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q15369-1", "protein_name": "Elongin-C", "gene_name": "ELOC", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15370-1", "protein_name": "Elongin-B", "gene_name": "ELOB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8WXH5-1", "protein_name": "Suppressor of cytokine signaling 4", "gene_name": "SOCS4", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75159-1", "protein_name": "Suppressor of cytokine signaling 5", "gene_name": "SOCS5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P00533-1", "protein_name": "Epidermal growth factor receptor", "gene_name": "EGFR", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q15369", "url": "https://www.uniprot.org/uniprotkb/Q15369" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 406, "end_pos": 406, "sequence_org": "R", "sequence_mut": "K", "comment": "Abrogates the ability to induce EGFR degradation.", "evidence": [ { "database": "UniProtKB", "id": "O75159", "url": "https://www.uniprot.org/uniprotkb/O75159" }, { "database": "PubMed", "id": "15590694", "url": "https://pubmed.ncbi.nlm.nih.gov/15590694" } ], "uniprot_canonical_ac": "O75159-1" }, { "start_pos": 484, "end_pos": 484, "sequence_org": "L", "sequence_mut": "P", "comment": "Abrogates the interaction with ELOB and ELOC and the ability to suppress EGFR signaling; when associated with F-488.", "evidence": [ { "database": "UniProtKB", "id": "O75159", "url": "https://www.uniprot.org/uniprotkb/O75159" }, { "database": "PubMed", "id": "15590694", "url": "https://pubmed.ncbi.nlm.nih.gov/15590694" } ], "uniprot_canonical_ac": "O75159-1" }, { "start_pos": 488, "end_pos": 488, "sequence_org": "C", "sequence_mut": "F", "comment": "Abrogates the interaction with ELOB and ELOC and the ability to suppress EGFR signaling; when associated with P-484.", "evidence": [ { "database": "UniProtKB", "id": "O75159", "url": "https://www.uniprot.org/uniprotkb/O75159" }, { "database": "PubMed", "id": "15590694", "url": "https://pubmed.ncbi.nlm.nih.gov/15590694" } ], "uniprot_canonical_ac": "O75159-1" } ], "record_id": "pubmed.15590694", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 5 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Structural basis for protein recognition by B30.2/SPRY domains.", "journal": "Mol. Cell", "date": "2006", "authors": "Woo JS, Suh HY, Park SY, Oh BH", "reference": { "type": "PubMed", "id": "17189197", "url": "https://pubmed.ncbi.nlm.nih.gov/17189197" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q15369-1", "protein_name": "Elongin-C", "gene_name": "ELOC", "tax_name": "Human" }, { "uniprot_canonical_ac": "A1Z6E0-1", "protein_name": "Protein gustavus", "gene_name": "gus", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q15370-1", "protein_name": "Elongin-B", "gene_name": "ELOB", "tax_name": "Human" }, { "uniprot_canonical_ac": "P09052-1", "protein_name": "ATP-dependent RNA helicase vasa", "gene_name": "vas", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q96BD6-1", "protein_name": "SPRY domain-containing SOCS box protein 1", "gene_name": "SPSB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96IZ0-1", "protein_name": "PRKC apoptosis WT1 regulator protein", "gene_name": "PAWR", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q15369", "url": "https://www.uniprot.org/uniprotkb/Q15369" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 219, "end_pos": 219, "sequence_org": "W", "sequence_mut": "L", "comment": "Does not affect binding to Elongin BC complex. Decreases interaction with vas.", "evidence": [ { "database": "UniProtKB", "id": "A1Z6E0", "url": "https://www.uniprot.org/uniprotkb/A1Z6E0" }, { "database": "PubMed", "id": "16498413", "url": "https://pubmed.ncbi.nlm.nih.gov/16498413" }, { "database": "PubMed", "id": "17189197", "url": "https://pubmed.ncbi.nlm.nih.gov/17189197" }, { "database": "PubMed", "id": "20123973", "url": "https://pubmed.ncbi.nlm.nih.gov/20123973" } ], "uniprot_canonical_ac": "A1Z6E0-1" }, { "start_pos": 184, "end_pos": 184, "sequence_org": "D", "sequence_mut": "A", "comment": "Decreases interaction with gus.", "evidence": [ { "database": "UniProtKB", "id": "P09052", "url": "https://www.uniprot.org/uniprotkb/P09052" }, { "database": "PubMed", "id": "17189197", "url": "https://pubmed.ncbi.nlm.nih.gov/17189197" }, { "database": "PubMed", "id": "20123973", "url": "https://pubmed.ncbi.nlm.nih.gov/20123973" } ], "uniprot_canonical_ac": "P09052-1" }, { "start_pos": 185, "end_pos": 185, "sequence_org": "I", "sequence_mut": "A", "comment": "Decreases interaction with gus.", "evidence": [ { "database": "UniProtKB", "id": "P09052", "url": "https://www.uniprot.org/uniprotkb/P09052" }, { "database": "PubMed", "id": "17189197", "url": "https://pubmed.ncbi.nlm.nih.gov/17189197" } ], "uniprot_canonical_ac": "P09052-1" }, { "start_pos": 186, "end_pos": 188, "sequence_org": "NNN", "sequence_mut": "AAA", "comment": "Abolishes interaction with gus.", "evidence": [ { "database": "UniProtKB", "id": "P09052", "url": "https://www.uniprot.org/uniprotkb/P09052" }, { "database": "PubMed", "id": "17189197", "url": "https://pubmed.ncbi.nlm.nih.gov/17189197" } ], "uniprot_canonical_ac": "P09052-1" }, { "start_pos": 186, "end_pos": 189, "sequence_org": "NNNN", "sequence_mut": "ANNA", "comment": "Strongly decreases interaction with gus.", "evidence": [ { "database": "UniProtKB", "id": "P09052", "url": "https://www.uniprot.org/uniprotkb/P09052" }, { "database": "PubMed", "id": "17189197", "url": "https://pubmed.ncbi.nlm.nih.gov/17189197" } ], "uniprot_canonical_ac": "P09052-1" }, { "start_pos": 187, "end_pos": 187, "sequence_org": "N", "sequence_mut": "A", "comment": "Strongly decreases interaction with gus.", "evidence": [ { "database": "UniProtKB", "id": "P09052", "url": "https://www.uniprot.org/uniprotkb/P09052" }, { "database": "PubMed", "id": "17189197", "url": "https://pubmed.ncbi.nlm.nih.gov/17189197" }, { "database": "PubMed", "id": "20123973", "url": "https://pubmed.ncbi.nlm.nih.gov/20123973" } ], "uniprot_canonical_ac": "P09052-1" }, { "start_pos": 188, "end_pos": 188, "sequence_org": "N", "sequence_mut": "A", "comment": "Strongly decreases interaction with gus.", "evidence": [ { "database": "UniProtKB", "id": "P09052", "url": "https://www.uniprot.org/uniprotkb/P09052" }, { "database": "PubMed", "id": "17189197", "url": "https://pubmed.ncbi.nlm.nih.gov/17189197" }, { "database": "PubMed", "id": "20123973", "url": "https://pubmed.ncbi.nlm.nih.gov/20123973" } ], "uniprot_canonical_ac": "P09052-1" }, { "start_pos": 189, "end_pos": 189, "sequence_org": "N", "sequence_mut": "A", "comment": "Does not affect interaction with gus.", "evidence": [ { "database": "UniProtKB", "id": "P09052", "url": "https://www.uniprot.org/uniprotkb/P09052" }, { "database": "PubMed", "id": "17189197", "url": "https://pubmed.ncbi.nlm.nih.gov/17189197" }, { "database": "PubMed", "id": "20123973", "url": "https://pubmed.ncbi.nlm.nih.gov/20123973" } ], "uniprot_canonical_ac": "P09052-1" }, { "start_pos": 72, "end_pos": 72, "sequence_org": "N", "sequence_mut": "A", "comment": "Loss of interaction with SPSB1-Elongin BC complex and SPSB2 and SPSB4.", "evidence": [ { "database": "UniProtKB", "id": "Q96IZ0", "url": "https://www.uniprot.org/uniprotkb/Q96IZ0" }, { "database": "PubMed", "id": "20561531", "url": "https://pubmed.ncbi.nlm.nih.gov/20561531" }, { "database": "PubMed", "id": "17189197", "url": "https://pubmed.ncbi.nlm.nih.gov/17189197" } ], "uniprot_canonical_ac": "Q96IZ0-1" } ], "record_id": "pubmed.17189197", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 6 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Structure of the SOCS4-ElonginB/C complex reveals a distinct SOCS box interface and the molecular basis for SOCS-dependent EGFR degradation.", "journal": "Structure", "date": "2007", "authors": "Bullock AN, Rodriguez MC, Debreczeni JE, Songyang Z, Knapp S", "reference": { "type": "PubMed", "id": "17997974", "url": "https://pubmed.ncbi.nlm.nih.gov/17997974" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q15369-1", "protein_name": "Elongin-C", "gene_name": "ELOC", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15370-1", "protein_name": "Elongin-B", "gene_name": "ELOB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8WXH5-1", "protein_name": "Suppressor of cytokine signaling 4", "gene_name": "SOCS4", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q15369", "url": "https://www.uniprot.org/uniprotkb/Q15369" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.17997974", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The Kelch repeat protein KLHDC10 regulates oxidative stress-induced ASK1 activation by suppressing PP5.", "journal": "Mol. Cell", "date": "2012", "authors": "Sekine Y, Hatanaka R, Watanabe T, Sono N, Iemura S, Natsume T, Kuranaga E, Miura M, Takeda K, Ichijo H", "reference": { "type": "PubMed", "id": "23102700", "url": "https://pubmed.ncbi.nlm.nih.gov/23102700" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q15369-1", "protein_name": "Elongin-C", "gene_name": "ELOC", "tax_name": "Human" }, { "uniprot_canonical_ac": "A1ZB86-1", "protein_name": "Kelch domain-containing protein 10 homolog", "gene_name": "slim", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q15370-1", "protein_name": "Elongin-B", "gene_name": "ELOB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6PID8-1", "protein_name": "Kelch domain-containing protein 10", "gene_name": "KLHDC10", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6PAR0-1", "protein_name": "Kelch domain-containing protein 10", "gene_name": "Klhdc10", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "P53041-1", "protein_name": "Serine/threonine-protein phosphatase 5", "gene_name": "PPP5C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13617-1", "protein_name": "Cullin-2", "gene_name": "CUL2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99683-1", "protein_name": "Mitogen-activated protein kinase kinase kinase 5", "gene_name": "MAP3K5", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q15369", "url": "https://www.uniprot.org/uniprotkb/Q15369" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 409, "end_pos": 409, "sequence_org": "A", "sequence_mut": "P", "comment": "Loss of interaction with CUL2. No effect on MAP3K5 activation.", "evidence": [ { "database": "UniProtKB", "id": "Q6PID8", "url": "https://www.uniprot.org/uniprotkb/Q6PID8" }, { "database": "PubMed", "id": "23102700", "url": "https://pubmed.ncbi.nlm.nih.gov/23102700" } ], "uniprot_canonical_ac": "Q6PID8-1" } ], "phosphorylation": [ { "start_pos": 838, "end_pos": 838, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine; by autocatalysis, MELK and MAP3K6", "evidence": [ { "database": "UniProtKB", "id": "Q99683", "url": "https://www.uniprot.org/uniprotkb/Q99683" }, { "database": "iPTMnet", "id": "Q99683", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q99683" }, { "database": "PubMed", "id": "11920685", "url": "https://pubmed.ncbi.nlm.nih.gov/11920685" }, { "database": "PubMed", "id": "17937911", "url": "https://pubmed.ncbi.nlm.nih.gov/17937911" }, { "database": "PubMed", "id": "19570911", "url": "https://pubmed.ncbi.nlm.nih.gov/19570911" }, { "database": "PubMed", "id": "19805025", "url": "https://pubmed.ncbi.nlm.nih.gov/19805025" }, { "database": "PubMed", "id": "19935702", "url": "https://pubmed.ncbi.nlm.nih.gov/19935702" }, { "database": "PubMed", "id": "20112989", "url": "https://pubmed.ncbi.nlm.nih.gov/20112989" }, { "database": "PubMed", "id": "28600984", "url": "https://pubmed.ncbi.nlm.nih.gov/28600984" }, { "database": "PubMed", "id": "31926625", "url": "https://pubmed.ncbi.nlm.nih.gov/31926625" }, { "database": "PubMed", "id": "17210579", "url": "https://pubmed.ncbi.nlm.nih.gov/17210579" }, { "database": "PubMed", "id": "18948261", "url": "https://pubmed.ncbi.nlm.nih.gov/18948261" }, { "database": "PubMed", "id": "19590015", "url": "https://pubmed.ncbi.nlm.nih.gov/19590015" }, { "database": "PubMed", "id": "23102700", "url": "https://pubmed.ncbi.nlm.nih.gov/23102700" } ], "site_lbl": "Thr838", "uniprot_canonical_ac": "Q99683-1" } ], "record_id": "pubmed.23102700", "abstract": "", "glycosylation": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 8 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Multimeric complexes among ankyrin-repeat and SOCS-box protein 9 (ASB9), ElonginBC, and Cullin 5: insights into the structure and assembly of ECS-type Cullin-RING E3 ubiquitin ligases.", "journal": "Biochemistry", "date": "2013", "authors": "Thomas JC, Matak-Vinkovic D, Van Molle I, Ciulli A", "reference": { "type": "PubMed", "id": "23837592", "url": "https://pubmed.ncbi.nlm.nih.gov/23837592" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q15369-1", "protein_name": "Elongin-C", "gene_name": "ELOC", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15370-1", "protein_name": "Elongin-B", "gene_name": "ELOB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96DX5-1", "protein_name": "Ankyrin repeat and SOCS box protein 9", "gene_name": "ASB9", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q15369", "url": "https://www.uniprot.org/uniprotkb/Q15369" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.23837592", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Insight into the HIV-1 Vif SOCS-box-ElonginBC interaction.", "journal": "Open biology", "date": "2013-11-13", "authors": "Lu Zhisheng, Bergeron Julien R C, Atkinson R Andrew, Schaller Torsten, Veselkov Dennis A, Oregioni Alain, Yang Yi, Matthews Stephen J, Malim Michael H, Sanderson Mark R", "reference": { "type": "PubMed", "id": "24225024", "url": "https://pubmed.ncbi.nlm.nih.gov/24225024" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q15369-1", "protein_name": "Elongin-C", "gene_name": "ELOC", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15370-1", "protein_name": "Elongin-B", "gene_name": "ELOB", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q15369", "url": "https://www.uniprot.org/uniprotkb/Q15369" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.24225024", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "C-Terminal End-Directed Protein Elimination by CRL2 Ubiquitin Ligases.", "journal": "Molecular cell", "date": "2018", "authors": "Lin HC, Yeh CW, Chen YF, Lee TT, Hsieh PY, Rusnac DV, Lin SY, Elledge SJ, Zheng N, Yen HS", "reference": { "type": "PubMed", "id": "29775578", "url": "https://pubmed.ncbi.nlm.nih.gov/29775578" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q15369-1", "protein_name": "Elongin-C", "gene_name": "ELOC", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15370-1", "protein_name": "Elongin-B", "gene_name": "ELOB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BQ90-1", "protein_name": "Kelch domain-containing protein 3", "gene_name": "KLHDC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y2U9-1", "protein_name": "Kelch domain-containing protein 2", "gene_name": "KLHDC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92624-1", "protein_name": "Amyloid protein-binding protein 2", "gene_name": "APPBP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O94782-1", "protein_name": "Ubiquitin carboxyl-terminal hydrolase 1", "gene_name": "USP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13617-1", "protein_name": "Cullin-2", "gene_name": "CUL2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96JP0-1", "protein_name": "Protein fem-1 homolog C", "gene_name": "FEM1C", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q15369", "url": "https://www.uniprot.org/uniprotkb/Q15369" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.29775578", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 8 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The Eukaryotic Proteome Is Shaped by E3 Ubiquitin Ligases Targeting C-Terminal Degrons.", "journal": "Cell", "date": "2018", "authors": "Koren I, Timms RT, Kula T, Xu Q, Li MZ, Elledge SJ", "reference": { "type": "PubMed", "id": "29779948", "url": "https://pubmed.ncbi.nlm.nih.gov/29779948" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q15369-1", "protein_name": "Elongin-C", "gene_name": "ELOC", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15370-1", "protein_name": "Elongin-B", "gene_name": "ELOB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BQ90-1", "protein_name": "Kelch domain-containing protein 3", "gene_name": "KLHDC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6PID8-1", "protein_name": "Kelch domain-containing protein 10", "gene_name": "KLHDC10", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y2U9-1", "protein_name": "Kelch domain-containing protein 2", "gene_name": "KLHDC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TEL6-1", "protein_name": "Short transient receptor potential channel 4-associated protein", "gene_name": "TRPC4AP", "tax_name": "Human" }, { "uniprot_canonical_ac": "P43357-1", "protein_name": "Melanoma-associated antigen 3", "gene_name": "MAGEA3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H0U9-1", "protein_name": "Testis-specific Y-encoded-like protein 1", "gene_name": "TSPYL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92624-1", "protein_name": "Amyloid protein-binding protein 2", "gene_name": "APPBP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01106-2", "protein_name": "Myc proto-oncogene protein", "gene_name": "MYC", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13617-1", "protein_name": "Cullin-2", "gene_name": "CUL2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13619-1", "protein_name": "Cullin-4A", "gene_name": "CUL4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13620-2", "protein_name": "Cullin-4B", "gene_name": "CUL4B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5T6F0-1", "protein_name": "DDB1- and CUL4-associated factor 12", "gene_name": "DCAF12", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86YD1-1", "protein_name": "Prostate tumor-overexpressed gene 1 protein", "gene_name": "PTOV1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96JP0-1", "protein_name": "Protein fem-1 homolog C", "gene_name": "FEM1C", "tax_name": "Human" }, { "uniprot_canonical_ac": "P48643-1", "protein_name": "T-complex protein 1 subunit epsilon", "gene_name": "CCT5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BSK4-1", "protein_name": "Protein fem-1 homolog A", "gene_name": "FEM1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UK73-1", "protein_name": "Protein fem-1 homolog B", "gene_name": "FEM1B", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q15369", "url": "https://www.uniprot.org/uniprotkb/Q15369" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 450, "end_pos": 450, "sequence_org": "R", "sequence_mut": "K", "comment": "Abolished ubiquitination and degradation by the DCX(TRPC4AP) complex.", "evidence": [ { "database": "UniProtKB", "id": "P01106", "url": "https://www.uniprot.org/uniprotkb/P01106" }, { "database": "PubMed", "id": "29779948", "url": "https://pubmed.ncbi.nlm.nih.gov/29779948" } ], "uniprot_canonical_ac": "P01106-2" } ], "record_id": "pubmed.29779948", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 19 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "CRL4(AMBRA1) targets Elongin C for ubiquitination and degradation to modulate CRL5 signaling.", "journal": "The EMBO journal", "date": "2018", "authors": "Chen SH, Jang GM, Huttenhain R, Gordon DE, Du D, Newton BW, Johnson JR, Hiatt J, Hultquist JF, Johnson TL, Liu YL, Burton LA, Ye J, Reichermeier KM, Stroud RM, Marson A, Debnath J, Gross JD, Krogan NJ", "reference": { "type": "PubMed", "id": "30166453", "url": "https://pubmed.ncbi.nlm.nih.gov/30166453" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q15369-1", "protein_name": "Elongin-C", "gene_name": "ELOC", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9C0C7-1", "protein_name": "Activating molecule in BECN1-regulated autophagy protein 1", "gene_name": "AMBRA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13619-1", "protein_name": "Cullin-4A", "gene_name": "CUL4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13620-2", "protein_name": "Cullin-4B", "gene_name": "CUL4B", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q15369", "url": "https://www.uniprot.org/uniprotkb/Q15369" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 1, "end_pos": 22, "sequence_org": "MKVVPEKNAVRILWGRERGARA", "sequence_mut": "", "comment": "Abolished interaction with DDB1.", "evidence": [ { "database": "UniProtKB", "id": "Q9C0C7", "url": "https://www.uniprot.org/uniprotkb/Q9C0C7" }, { "database": "PubMed", "id": "30166453", "url": "https://pubmed.ncbi.nlm.nih.gov/30166453" } ], "uniprot_canonical_ac": "Q9C0C7-1" }, { "start_pos": 1, "end_pos": 43, "sequence_org": "MKVVPEKNAVRILWGRERGARAMGAQRLLQELVEDKTRWMKWE", "sequence_mut": "", "comment": "Abolished interaction with DDB1.", "evidence": [ { "database": "UniProtKB", "id": "Q9C0C7", "url": "https://www.uniprot.org/uniprotkb/Q9C0C7" }, { "database": "PubMed", "id": "30166453", "url": "https://pubmed.ncbi.nlm.nih.gov/30166453" } ], "uniprot_canonical_ac": "Q9C0C7-1" } ], "record_id": "pubmed.30166453", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 4 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Structural insights into substrate recognition by the SOCS2 E3 ubiquitin ligase.", "journal": "Nat. Commun.", "date": "2019", "authors": "Kung Wei-Wei, Ramachandran Sarath, Makukhin Nikolai, Bruno Elvira, Ciulli Alessio", "reference": { "type": "PubMed", "id": "31182716", "url": "https://pubmed.ncbi.nlm.nih.gov/31182716" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q15369-1", "protein_name": "Elongin-C", "gene_name": "ELOC", "tax_name": "Human" }, { "uniprot_canonical_ac": "P10912-1", "protein_name": "Growth hormone receptor", "gene_name": "GHR", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15370-1", "protein_name": "Elongin-B", "gene_name": "ELOB", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14508-1", "protein_name": "Suppressor of cytokine signaling 2", "gene_name": "SOCS2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P19235-1", "protein_name": "Erythropoietin receptor", "gene_name": "EPOR", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q15369", "url": "https://www.uniprot.org/uniprotkb/Q15369" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.31182716", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 5 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Discovery of an exosite on the SOCS2-SH2 domain that enhances SH2 binding to phosphorylated ligands.", "journal": "Nat. Commun.", "date": "2021", "authors": "Linossi EM, Li K, Veggiani G, Tan C, Dehkhoda F, Hockings C, Calleja DJ, Keating N, Feltham R, Brooks AJ, Li SS, Sidhu SS, Babon JJ, Kershaw NJ, Nicholson SE", "reference": { "type": "PubMed", "id": "34857742", "url": "https://pubmed.ncbi.nlm.nih.gov/34857742" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q15369-1", "protein_name": "Elongin-C", "gene_name": "ELOC", "tax_name": "Human" }, { "uniprot_canonical_ac": "P10912-1", "protein_name": "Growth hormone receptor", "gene_name": "GHR", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15370-1", "protein_name": "Elongin-B", "gene_name": "ELOB", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14508-1", "protein_name": "Suppressor of cytokine signaling 2", "gene_name": "SOCS2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q15369", "url": "https://www.uniprot.org/uniprotkb/Q15369" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.34857742", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 4 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "E3 ligase autoinhibition by C-degron mimicry maintains C-degron substrate fidelity.", "journal": "Molecular cell", "date": "2023-03-02", "authors": "Scott Daniel C, King Moeko T, Baek Kheewoong, Gee Clifford T, Kalathur Ravi, Li Jerry, Purser Nicholas, Nourse Amanda, Chai Sergio C, Vaithiyalingam Sivaraja, Chen Taosheng, Lee Richard E, Elledge Stephen J, Kleiger Gary, Schulman Brenda A", "reference": { "type": "PubMed", "id": "36805027", "url": "https://pubmed.ncbi.nlm.nih.gov/36805027" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q15369-1", "protein_name": "Elongin-C", "gene_name": "ELOC", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15370-1", "protein_name": "Elongin-B", "gene_name": "ELOB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BQ90-1", "protein_name": "Kelch domain-containing protein 3", "gene_name": "KLHDC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y2U9-1", "protein_name": "Kelch domain-containing protein 2", "gene_name": "KLHDC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P29323-1", "protein_name": "Ephrin type-B receptor 2", "gene_name": "EPHB2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q15369", "url": "https://www.uniprot.org/uniprotkb/Q15369" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 177, "end_pos": 177, "sequence_org": "F", "sequence_mut": "A", "comment": "Impairs oligomerization of KLHDC2-ELOB-ELOC complex; when associated with A-182 and A-183. Impairs oligomerization of KLHDC2-ELOB-ELOC complex; when associated with K-182 and A-183.", "evidence": [ { "database": "UniProtKB", "id": "Q9Y2U9", "url": "https://www.uniprot.org/uniprotkb/Q9Y2U9" }, { "database": "PubMed", "id": "36805027", "url": "https://pubmed.ncbi.nlm.nih.gov/36805027" } ], "uniprot_canonical_ac": "Q9Y2U9-1" }, { "start_pos": 182, "end_pos": 182, "sequence_org": "F", "sequence_mut": "A", "comment": "Impairs oligomerization of KLHDC2-ELOB-ELOC complex; when associated with A-177 and A-183.", "evidence": [ { "database": "UniProtKB", "id": "Q9Y2U9", "url": "https://www.uniprot.org/uniprotkb/Q9Y2U9" }, { "database": "PubMed", "id": "36805027", "url": "https://pubmed.ncbi.nlm.nih.gov/36805027" } ], "uniprot_canonical_ac": "Q9Y2U9-1" }, { "start_pos": 182, "end_pos": 182, "sequence_org": "F", "sequence_mut": "K", "comment": "Impairs oligomerization of KLHDC2-ELOB-ELOC complex; when associated with A-177 and A-183.", "evidence": [ { "database": "UniProtKB", "id": "Q9Y2U9", "url": "https://www.uniprot.org/uniprotkb/Q9Y2U9" }, { "database": "PubMed", "id": "36805027", "url": "https://pubmed.ncbi.nlm.nih.gov/36805027" } ], "uniprot_canonical_ac": "Q9Y2U9-1" }, { "start_pos": 183, "end_pos": 183, "sequence_org": "W", "sequence_mut": "A", "comment": "Impairs oligomerization of KLHDC2-ELOB-ELOC complex; when associated with A-177 and A-182. Impairs oligomerization of KLHDC2-ELOB-ELOC complex; when associated with A-177 and K-182.", "evidence": [ { "database": "UniProtKB", "id": "Q9Y2U9", "url": "https://www.uniprot.org/uniprotkb/Q9Y2U9" }, { "database": "PubMed", "id": "36805027", "url": "https://pubmed.ncbi.nlm.nih.gov/36805027" } ], "uniprot_canonical_ac": "Q9Y2U9-1" }, { "start_pos": 269, "end_pos": 269, "sequence_org": "S", "sequence_mut": "E", "comment": "Abolishes oligomerization of KLHDC2-ELOB-ELOC complex.", "evidence": [ { "database": "UniProtKB", "id": "Q9Y2U9", "url": "https://www.uniprot.org/uniprotkb/Q9Y2U9" }, { "database": "PubMed", "id": "36805027", "url": "https://pubmed.ncbi.nlm.nih.gov/36805027" } ], "uniprot_canonical_ac": "Q9Y2U9-1" }, { "start_pos": 373, "end_pos": 373, "sequence_org": "I", "sequence_mut": "R", "comment": "Impairs oligomerization of KLHDC2-ELOB-ELOC complex.", "evidence": [ { "database": "UniProtKB", "id": "Q9Y2U9", "url": "https://www.uniprot.org/uniprotkb/Q9Y2U9" }, { "database": "PubMed", "id": "36805027", "url": "https://pubmed.ncbi.nlm.nih.gov/36805027" } ], "uniprot_canonical_ac": "Q9Y2U9-1" }, { "start_pos": 401, "end_pos": 406, "sequence_org": "NNTSGS", "sequence_mut": "", "comment": "Abolishes oligomerization of KLHDC2-ELOB-ELOC complex.", "evidence": [ { "database": "UniProtKB", "id": "Q9Y2U9", "url": "https://www.uniprot.org/uniprotkb/Q9Y2U9" }, { "database": "PubMed", "id": "36805027", "url": "https://pubmed.ncbi.nlm.nih.gov/36805027" } ], "uniprot_canonical_ac": "Q9Y2U9-1" }, { "start_pos": 405, "end_pos": 406, "sequence_org": "GS", "sequence_mut": "KK", "comment": "Abolishes oligomerization of KLHDC2-ELOB-ELOC complex.", "evidence": [ { "database": "UniProtKB", "id": "Q9Y2U9", "url": "https://www.uniprot.org/uniprotkb/Q9Y2U9" }, { "database": "PubMed", "id": "36805027", "url": "https://pubmed.ncbi.nlm.nih.gov/36805027" } ], "uniprot_canonical_ac": "Q9Y2U9-1" }, { "start_pos": 406, "end_pos": 406, "sequence_org": "S", "sequence_mut": "G", "comment": "Promotes oligomerization of KLHDC2-ELOB-ELOC complex. Abolishes the activity of CRL2(KLHDC2) complex to ubiquitinate SELENOK.", "evidence": [ { "database": "UniProtKB", "id": "Q9Y2U9", "url": "https://www.uniprot.org/uniprotkb/Q9Y2U9" }, { "database": "PubMed", "id": "36805027", "url": "https://pubmed.ncbi.nlm.nih.gov/36805027" } ], "uniprot_canonical_ac": "Q9Y2U9-1" } ], "record_id": "pubmed.36805027", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 5 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Structure-based design of a phosphotyrosine-masked covalent ligand targeting the E3 ligase SOCS2.", "journal": "Nat. Commun.", "date": "2023", "authors": "Ramachandran Sarath, Makukhin Nikolai, Haubrich Kevin, Nagala Manjula, Forrester Beth, Lynch Dylan M, Casement Ryan, Testa Andrea, Bruno Elvira, Gitto Rosaria, Ciulli Alessio", "reference": { "type": "PubMed", "id": "37816714", "url": "https://pubmed.ncbi.nlm.nih.gov/37816714" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q15369-1", "protein_name": "Elongin-C", "gene_name": "ELOC", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15370-1", "protein_name": "Elongin-B", "gene_name": "ELOB", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14508-1", "protein_name": "Suppressor of cytokine signaling 2", "gene_name": "SOCS2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q15369", "url": "https://www.uniprot.org/uniprotkb/Q15369" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.37816714", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Molecular basis for C-degron recognition by CRL2APPBP2 ubiquitin ligase.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2023-10-24", "authors": "Zhao Shidong, Olmayev-Yaakobov Diana, Ru Wenwen, Li Shanshan, Chen Xinyan, Zhang Jiahai, Yao Xuebiao, Koren Itay, Zhang Kaiming, Xu Chao", "reference": { "type": "PubMed", "id": "37844242", "url": "https://pubmed.ncbi.nlm.nih.gov/37844242" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q15369-1", "protein_name": "Elongin-C", "gene_name": "ELOC", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15370-1", "protein_name": "Elongin-B", "gene_name": "ELOB", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62877-1", "protein_name": "E3 ubiquitin-protein ligase RBX1", "gene_name": "RBX1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92624-1", "protein_name": "Amyloid protein-binding protein 2", "gene_name": "APPBP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13617-1", "protein_name": "Cullin-2", "gene_name": "CUL2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q15369", "url": "https://www.uniprot.org/uniprotkb/Q15369" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 345, "end_pos": 345, "sequence_org": "Y", "sequence_mut": "A", "comment": "Abolished ability to recognize and bind C-degrons; when associated with A-437.", "evidence": [ { "database": "UniProtKB", "id": "Q92624", "url": "https://www.uniprot.org/uniprotkb/Q92624" }, { "database": "PubMed", "id": "37844242", "url": "https://pubmed.ncbi.nlm.nih.gov/37844242" } ], "uniprot_canonical_ac": "Q92624-1" }, { "start_pos": 380, "end_pos": 380, "sequence_org": "R", "sequence_mut": "E", "comment": "Decreased ability to recognize and bind C-degrons; when associated with E-430.", "evidence": [ { "database": "UniProtKB", "id": "Q92624", "url": "https://www.uniprot.org/uniprotkb/Q92624" }, { "database": "PubMed", "id": "37844242", "url": "https://pubmed.ncbi.nlm.nih.gov/37844242" } ], "uniprot_canonical_ac": "Q92624-1" }, { "start_pos": 387, "end_pos": 388, "sequence_org": "EE", "sequence_mut": "RR", "comment": "Abolished ability to recognize and bind C-degrons.", "evidence": [ { "database": "UniProtKB", "id": "Q92624", "url": "https://www.uniprot.org/uniprotkb/Q92624" }, { "database": "PubMed", "id": "37844242", "url": "https://pubmed.ncbi.nlm.nih.gov/37844242" } ], "uniprot_canonical_ac": "Q92624-1" }, { "start_pos": 430, "end_pos": 430, "sequence_org": "K", "sequence_mut": "E", "comment": "Decreased ability to recognize and bind C-degrons; when associated with E-380.", "evidence": [ { "database": "UniProtKB", "id": "Q92624", "url": "https://www.uniprot.org/uniprotkb/Q92624" }, { "database": "PubMed", "id": "37844242", "url": "https://pubmed.ncbi.nlm.nih.gov/37844242" } ], "uniprot_canonical_ac": "Q92624-1" }, { "start_pos": 437, "end_pos": 437, "sequence_org": "R", "sequence_mut": "A", "comment": "Abolished ability to recognize and bind C-degrons; when associated with A-345.", "evidence": [ { "database": "UniProtKB", "id": "Q92624", "url": "https://www.uniprot.org/uniprotkb/Q92624" }, { "database": "PubMed", "id": "37844242", "url": "https://pubmed.ncbi.nlm.nih.gov/37844242" } ], "uniprot_canonical_ac": "Q92624-1" }, { "start_pos": 476, "end_pos": 479, "sequence_org": "HLAS", "sequence_mut": "ELAE", "comment": "Reduced ability to recognize and bind C-degrons.", "evidence": [ { "database": "UniProtKB", "id": "Q92624", "url": "https://www.uniprot.org/uniprotkb/Q92624" }, { "database": "PubMed", "id": "37844242", "url": "https://pubmed.ncbi.nlm.nih.gov/37844242" } ], "uniprot_canonical_ac": "Q92624-1" } ], "record_id": "pubmed.37844242", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 5 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Co-opting the E3 ligase KLHDC2 for targeted protein degradation by small molecules.", "journal": "Nature structural & molecular biology", "date": "2024-02", "authors": "Hickey Christopher M, Digianantonio Katherine M, Zimmermann Kurt, Harbin Alicia, Quinn Connor, Patel Avani, Gareiss Peter, Chapman Amanda, Tiberi Bernadette, Dobrodziej Jennifer, Corradi John, Cacace Angela M, Langley David R, B\u00e9k\u00e9s Mikl\u00f3s", "reference": { "type": "PubMed", "id": "38177675", "url": "https://pubmed.ncbi.nlm.nih.gov/38177675" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q15369-1", "protein_name": "Elongin-C", "gene_name": "ELOC", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15370-1", "protein_name": "Elongin-B", "gene_name": "ELOB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y2U9-1", "protein_name": "Kelch domain-containing protein 2", "gene_name": "KLHDC2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q15369", "url": "https://www.uniprot.org/uniprotkb/Q15369" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.38177675", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Structural basis for C-degron selectivity across KLHDCX family E3 ubiquitin ligases.", "journal": "Nat. Commun.", "date": "2024", "authors": "Scott Daniel C, Chittori Sagar, Purser Nicholas, King Moeko T, Maiwald Samuel A, Churion Kelly, Nourse Amanda, Lee Chan, Paulo Joao A, Miller Darcie J, Elledge Stephen J, Harper J Wade, Kleiger Gary, Schulman Brenda A", "reference": { "type": "PubMed", "id": "39548056", "url": "https://pubmed.ncbi.nlm.nih.gov/39548056" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q15369-1", "protein_name": "Elongin-C", "gene_name": "ELOC", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15370-1", "protein_name": "Elongin-B", "gene_name": "ELOB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6PID8-1", "protein_name": "Kelch domain-containing protein 10", "gene_name": "KLHDC10", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG48-1", "protein_name": "Polyubiquitin-C", "gene_name": "UBC", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q15369", "url": "https://www.uniprot.org/uniprotkb/Q15369" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 42, "end_pos": 42, "sequence_org": "R", "sequence_mut": "E", "comment": "Impairs ubiquitination by CRL2(KLHDC3) E3 ligase complex; when associated with D-44. Impairs ubiquitination by CRL2(KLHDC3) E3 ligase complex; when associated with A-72.", "evidence": [ { "database": "UniProtKB", "id": "P0CG48", "url": "https://www.uniprot.org/uniprotkb/P0CG48" }, { "database": "PubMed", "id": "39548056", "url": "https://pubmed.ncbi.nlm.nih.gov/39548056" } ], "uniprot_canonical_ac": "P0CG48-1" }, { "start_pos": 44, "end_pos": 44, "sequence_org": "I", "sequence_mut": "D", "comment": "Impairs ubiquitination by CRL2(KLHDC3) E3 ligase complex; when associated with E-42. Impairs ubiquitination by CRL2(KLHDC3) E3 ligase complex; when associated with A-68.", "evidence": [ { "database": "UniProtKB", "id": "P0CG48", "url": "https://www.uniprot.org/uniprotkb/P0CG48" }, { "database": "PubMed", "id": "39548056", "url": "https://pubmed.ncbi.nlm.nih.gov/39548056" } ], "uniprot_canonical_ac": "P0CG48-1" }, { "start_pos": 48, "end_pos": 48, "sequence_org": "K", "sequence_mut": "R", "comment": "No effect on HLTF-mediated polyubiquitination of PCNA. Impairs ubiquitination by CRL2(KLHDC3) E3 ligase complex.", "evidence": [ { "database": "UniProtKB", "id": "P0CG48", "url": "https://www.uniprot.org/uniprotkb/P0CG48" }, { "database": "PubMed", "id": "18719106", "url": "https://pubmed.ncbi.nlm.nih.gov/18719106" }, { "database": "PubMed", "id": "39548056", "url": "https://pubmed.ncbi.nlm.nih.gov/39548056" } ], "uniprot_canonical_ac": "P0CG48-1" }, { "start_pos": 68, "end_pos": 68, "sequence_org": "H", "sequence_mut": "A", "comment": "Decreases affinity for UBE2R2 in ECS(FEM1C)-UBE2R2 complex. Impairs ubiquitination by CRL2(KLHDC3) E3 ligase complex; when associated with D-44. Impairs ubiquitination by CRL2(KLHDC3) E3 ligase complex; when associated with A-72.", "evidence": [ { "database": "UniProtKB", "id": "P0CG48", "url": "https://www.uniprot.org/uniprotkb/P0CG48" }, { "database": "PubMed", "id": "38326650", "url": "https://pubmed.ncbi.nlm.nih.gov/38326650" }, { "database": "PubMed", "id": "39548056", "url": "https://pubmed.ncbi.nlm.nih.gov/39548056" } ], "uniprot_canonical_ac": "P0CG48-1" }, { "start_pos": 72, "end_pos": 72, "sequence_org": "R", "sequence_mut": "A", "comment": "Impairs ubiquitination by CRL2(KLHDC3) E3 ligase complex; when associated with E-42. Impairs ubiquitination by CRL2(KLHDC3) E3 ligase complex; when associated with A-68.", "evidence": [ { "database": "UniProtKB", "id": "P0CG48", "url": "https://www.uniprot.org/uniprotkb/P0CG48" }, { "database": "PubMed", "id": "39548056", "url": "https://pubmed.ncbi.nlm.nih.gov/39548056" } ], "uniprot_canonical_ac": "P0CG48-1" }, { "start_pos": 75, "end_pos": 75, "sequence_org": "G", "sequence_mut": "Q", "comment": "No effect on ubiquitination by CRL2(KLHDC3) E3 ligase complex. Impairs ubiquitination by CRL2(KLHDC10) E3 ligase complex.", "evidence": [ { "database": "UniProtKB", "id": "P0CG48", "url": "https://www.uniprot.org/uniprotkb/P0CG48" }, { "database": "PubMed", "id": "39548056", "url": "https://pubmed.ncbi.nlm.nih.gov/39548056" } ], "uniprot_canonical_ac": "P0CG48-1" }, { "start_pos": 75, "end_pos": 75, "sequence_org": "G", "sequence_mut": "R", "comment": "No effect on ubiquitination by CRL2(KLHDC3) E3 ligase complex. Impairs ubiquitination by CRL2(KLHDC10) E3 ligase complex.", "evidence": [ { "database": "UniProtKB", "id": "P0CG48", "url": "https://www.uniprot.org/uniprotkb/P0CG48" }, { "database": "PubMed", "id": "39548056", "url": "https://pubmed.ncbi.nlm.nih.gov/39548056" } ], "uniprot_canonical_ac": "P0CG48-1" }, { "start_pos": 76, "end_pos": 76, "sequence_org": "G", "sequence_mut": "A", "comment": "Loss of ADP-ribosylation. Impairs ubiquitination by CRL2(KLHDC3) E3 ligase complex. No effect on ubiquitination by CRL2(KLHDC10) E3 ligase complex.", "evidence": [ { "database": "UniProtKB", "id": "P0CG48", "url": "https://www.uniprot.org/uniprotkb/P0CG48" }, { "database": "PubMed", "id": "28525742", "url": "https://pubmed.ncbi.nlm.nih.gov/28525742" }, { "database": "PubMed", "id": "39548056", "url": "https://pubmed.ncbi.nlm.nih.gov/39548056" } ], "uniprot_canonical_ac": "P0CG48-1" }, { "start_pos": 76, "end_pos": 76, "sequence_org": "G", "sequence_mut": "D", "comment": "Impairs ubiquitination by CRL2(KLHDC3) and CRL2(KLHDC10) E3 ligase complex.", "evidence": [ { "database": "UniProtKB", "id": "P0CG48", "url": "https://www.uniprot.org/uniprotkb/P0CG48" }, { "database": "PubMed", "id": "39548056", "url": "https://pubmed.ncbi.nlm.nih.gov/39548056" } ], "uniprot_canonical_ac": "P0CG48-1" }, { "start_pos": 7, "end_pos": 7, "sequence_org": "T", "sequence_mut": "D", "comment": "Impairs ubiquitination by CRL2(KLHDC3) E3 ligase complex; when associated with D-9.", "evidence": [ { "database": "UniProtKB", "id": "P0CG48", "url": "https://www.uniprot.org/uniprotkb/P0CG48" }, { "database": "PubMed", "id": "39548056", "url": "https://pubmed.ncbi.nlm.nih.gov/39548056" } ], "uniprot_canonical_ac": "P0CG48-1" }, { "start_pos": 9, "end_pos": 9, "sequence_org": "T", "sequence_mut": "D", "comment": "Impairs ubiquitination by CRL2(KLHDC3) E3 ligase complex; when associated with D-7.", "evidence": [ { "database": "UniProtKB", "id": "P0CG48", "url": "https://www.uniprot.org/uniprotkb/P0CG48" }, { "database": "PubMed", "id": "39548056", "url": "https://pubmed.ncbi.nlm.nih.gov/39548056" } ], "uniprot_canonical_ac": "P0CG48-1" } ], "record_id": "pubmed.39548056", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 4 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "A human cDNA encoding the small subunit of RNA polymerase II transcription factor SIII.", "journal": "Gene", "date": "1994", "authors": "Garrett KP, Haque D, Conaway RC, Conaway JW", "reference": { "type": "PubMed", "id": "7821821", "url": "https://pubmed.ncbi.nlm.nih.gov/7821821" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q15369-1", "protein_name": "Elongin-C", "gene_name": "ELOC", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q15369", "url": "https://www.uniprot.org/uniprotkb/Q15369" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.7821821", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "I-Rel: a novel rel-related protein that inhibits NF-kappa B transcriptional activity.", "journal": "Genes Dev.", "date": "1992", "authors": "Ruben S M, Klement J F, Coleman T A, Maher M, Chen C H, Rosen C A", "reference": { "type": "PubMed", "id": "1577270", "url": "https://pubmed.ncbi.nlm.nih.gov/1577270" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q01201-1", "protein_name": "Transcription factor RelB", "gene_name": "RELB", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q01201", "url": "https://www.uniprot.org/uniprotkb/Q01201" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.1577270", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "IKK phosphorylates RelB to modulate its promoter specificity and promote fibroblast migration downstream of TNF receptors.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2014", "authors": "Authier H, Billot K, Derudder E, Bordereaux D, Riviere P, Rodrigues-Ferreira S, Nahmias C, Baud V", "reference": { "type": "PubMed", "id": "25267645", "url": "https://pubmed.ncbi.nlm.nih.gov/25267645" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q01201-1", "protein_name": "Transcription factor RelB", "gene_name": "RELB", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q01201", "url": "https://www.uniprot.org/uniprotkb/Q01201" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 472, "end_pos": 472, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q01201", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q01201" }, { "database": "PubMed", "id": "25267645", "url": "https://pubmed.ncbi.nlm.nih.gov/25267645" } ], "site_lbl": "Ser472", "uniprot_canonical_ac": "Q01201-1" } ], "record_id": "pubmed.25267645", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The effects of RelB deficiency on lymphocyte development and function.", "journal": "Journal of autoimmunity", "date": "2015", "authors": "Sharfe N, Merico D, Karanxha A, Macdonald C, Dadi H, Ngan B, Herbrick JA, Roifman CM", "reference": { "type": "PubMed", "id": "26385063", "url": "https://pubmed.ncbi.nlm.nih.gov/26385063" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q01201-1", "protein_name": "Transcription factor RelB", "gene_name": "RELB", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q01201", "url": "https://www.uniprot.org/uniprotkb/Q01201" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.26385063", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "PAK4 suppresses RELB to prevent senescence-like growth arrest in breast cancer.", "journal": "Nature communications", "date": "2019", "authors": "Costa TDF, Zhuang T, Lorent J, Turco E, Olofsson H, Masia-Balague M, Zhao M, Rabieifar P, Robertson N, Kuiper R, Sjolund J, Spiess M, Hernandez-Varas P, Rabenhorst U, Roswall P, Ma R, Gong X, Hartman J, Pietras K, Adams PD, Defilippi P, Stromblad S", "reference": { "type": "PubMed", "id": "31399573", "url": "https://pubmed.ncbi.nlm.nih.gov/31399573" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q01201-1", "protein_name": "Transcription factor RelB", "gene_name": "RELB", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q01201", "url": "https://www.uniprot.org/uniprotkb/Q01201" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 151, "end_pos": 151, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q01201", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q01201" }, { "database": "PubMed", "id": "31399573", "url": "https://pubmed.ncbi.nlm.nih.gov/31399573" } ], "site_lbl": "Ser151", "uniprot_canonical_ac": "Q01201-1" } ], "record_id": "pubmed.31399573", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "NF\u03baB pathway dysregulation due to reduced RelB expression leads to severe autoimmune disorders and declining immunity.", "journal": "Journal of autoimmunity", "date": "2022-11-16", "authors": "Sharfe Nigel, Dalal Ilan, Naghdi Zahra, Lefaudeux Diane, Vong Linda, Dadi Harjit, Navarro Hector, Tasher Diana, Ovadia Adi, Zangen Tzili, Ater Dorit, Ngan Bo, Hoffmann Alexander, Roifman Chaim M", "reference": { "type": "PubMed", "id": "36402602", "url": "https://pubmed.ncbi.nlm.nih.gov/36402602" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q01201-1", "protein_name": "Transcription factor RelB", "gene_name": "RELB", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q01201", "url": "https://www.uniprot.org/uniprotkb/Q01201" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.36402602", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "RelB represses miR-193a-5p expression to promote the phenotypic transformation of vascular smooth muscle cells in aortic aneurysm.", "journal": "Biochimica et biophysica acta. Gene regulatory mechanisms", "date": "2023-03-01", "authors": "Liu Yisi, Tian Xiaoxiang, Liu Dan, Zhang Xiaolin, Yan Chenghui, Han Yaling", "reference": { "type": "PubMed", "id": "36863451", "url": "https://pubmed.ncbi.nlm.nih.gov/36863451" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q01201-1", "protein_name": "Transcription factor RelB", "gene_name": "RELB", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q01201", "url": "https://www.uniprot.org/uniprotkb/Q01201" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.36863451", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "NF-\u03baB Signaling Modulates miR-452-5p and miR-335-5p Expression to Functionally Decrease Epithelial Ovarian Cancer Progression in Tumor-Initiating Cells.", "journal": "International journal of molecular sciences", "date": "2023-04-25", "authors": "Kamdar Rahul D, Harrington Brittney S, Attar Emma, Korrapati Soumya, Shetty Jyoti, Zhao Yongmei, Tran Bao, Wong Nathan, House Carrie D, Annunziata Christina M", "reference": { "type": "PubMed", "id": "37175530", "url": "https://pubmed.ncbi.nlm.nih.gov/37175530" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q01201-1", "protein_name": "Transcription factor RelB", "gene_name": "RELB", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q01201", "url": "https://www.uniprot.org/uniprotkb/Q01201" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.37175530", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Inflammation in Hypervolemic Hemodialysis Patients: The Roles of RelB and Caspase-4.", "journal": "International journal of molecular sciences", "date": "2023-12-16", "authors": "Ulrich Christof, Canim Zeynep, Herberger Eva, Girndt Matthias, Fiedler Roman", "reference": { "type": "PubMed", "id": "38139378", "url": "https://pubmed.ncbi.nlm.nih.gov/38139378" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q01201-1", "protein_name": "Transcription factor RelB", "gene_name": "RELB", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49662-1", "protein_name": "Caspase-4", "gene_name": "CASP4", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q01201", "url": "https://www.uniprot.org/uniprotkb/Q01201" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.38139378", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Inherited human RelB deficiency impairs innate and adaptive immunity to infection.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2024-09-10", "authors": "Le Voyer Tom, Maglorius Renkilaraj Majistor Raj Luxman, Moriya Kunihiko, P\u00e9rez Lorenzo Malena, Nguyen Tina, Gao Liwei, Rubin Tamar, Cederholm Axel, Ogishi Masato, Arango-Franco Carlos A, B\u00e9ziat Vivien, L\u00e9vy Romain, Migaud M\u00e9lanie, Rapaport Franck, Itan Yuval, Deenick Elissa K, Cortese Irene, Lisco Andrea, Boztug Kaan, Abel Laurent, Boisson-Dupuis St\u00e9phanie, Boisson Bertrand, Frosk Patrick, Ma Cindy S, Landegren Nils, Celmeli Fatih, Casanova Jean-Laurent, Tangye Stuart G, Puel Anne", "reference": { "type": "PubMed", "id": "39231201", "url": "https://pubmed.ncbi.nlm.nih.gov/39231201" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q01201-1", "protein_name": "Transcription factor RelB", "gene_name": "RELB", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q01201", "url": "https://www.uniprot.org/uniprotkb/Q01201" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.39231201", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Differential interactions of Rel-NF-kappa B complexes with I kappa B alpha determine pools of constitutive and inducible NF-kappa B activity.", "journal": "The EMBO journal", "date": "1994-10-03", "authors": "Dobrzanski P, Ryseck R P, Bravo R", "reference": { "type": "PubMed", "id": "7925301", "url": "https://pubmed.ncbi.nlm.nih.gov/7925301" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q01201-1", "protein_name": "Transcription factor RelB", "gene_name": "RELB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q00653-1", "protein_name": "Nuclear factor NF-kappa-B p100 subunit", "gene_name": "NFKB2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q01201", "url": "https://www.uniprot.org/uniprotkb/Q01201" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.7925301", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "HCP5 prevents ubiquitination-mediated UTP3 degradation to inhibit apoptosis by activating c-Myc transcriptional activity.", "journal": "Molecular therapy : the journal of the American Society of Gene Therapy", "date": "2022-10-17", "authors": "Nan Yabing, Luo Qingyu, Wu Xiaowei, Chang Wan, Zhao Pengfei, Liu Shi, Liu Zhihua", "reference": { "type": "PubMed", "id": "36245126", "url": "https://pubmed.ncbi.nlm.nih.gov/36245126" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9NQZ2-1", "protein_name": "Something about silencing protein 10", "gene_name": "UTP3", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9NQZ2", "url": "https://www.uniprot.org/uniprotkb/Q9NQZ2" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.36245126", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Fugu and human sequence comparison identifies novel human genes and conserved non-coding sequences.", "journal": "Gene", "date": "2002", "authors": "Gilligan P, Brenner S, Venkatesh B", "reference": { "type": "PubMed", "id": "12234665", "url": "https://pubmed.ncbi.nlm.nih.gov/12234665" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q8N895-1", "protein_name": "Zinc finger protein 366", "gene_name": "ZNF366", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q7RTV5-1", "protein_name": "Peroxiredoxin-like 2C", "gene_name": "PRXL2C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q7RTV3-1", "protein_name": "Zinc finger protein 367", "gene_name": "ZNF367", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q8N895", "url": "https://www.uniprot.org/uniprotkb/Q8N895" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.12234665", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Identification and characterization of DC-SCRIPT, a novel dendritic cell-expressed member of the zinc finger family of transcriptional regulators.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "2006", "authors": "Triantis V, Trancikova DE, Looman MW, Hartgers FC, Janssen RA, Adema GJ", "reference": { "type": "PubMed", "id": "16393996", "url": "https://pubmed.ncbi.nlm.nih.gov/16393996" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q8N895-1", "protein_name": "Zinc finger protein 366", "gene_name": "ZNF366", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13363-1", "protein_name": "C-terminal-binding protein 1", "gene_name": "CTBP1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q8N895", "url": "https://www.uniprot.org/uniprotkb/Q8N895" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 593, "end_pos": 593, "sequence_org": "L", "sequence_mut": "A", "comment": "Abolishes interaction with CTBP1. Abolishes interaction with CTBP1; when associated with A-648.", "evidence": [ { "database": "UniProtKB", "id": "Q8N895", "url": "https://www.uniprot.org/uniprotkb/Q8N895" }, { "database": "PubMed", "id": "16393996", "url": "https://pubmed.ncbi.nlm.nih.gov/16393996" } ], "uniprot_canonical_ac": "Q8N895-1" }, { "start_pos": 648, "end_pos": 648, "sequence_org": "L", "sequence_mut": "A", "comment": "No effect on interaction with CTBP1. Abolishes interaction with CTBP1; when associated with A-593.", "evidence": [ { "database": "UniProtKB", "id": "Q8N895", "url": "https://www.uniprot.org/uniprotkb/Q8N895" }, { "database": "PubMed", "id": "16393996", "url": "https://pubmed.ncbi.nlm.nih.gov/16393996" } ], "uniprot_canonical_ac": "Q8N895-1" } ], "record_id": "pubmed.16393996", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "ZNF366 is an estrogen receptor corepressor that acts through CtBP and histone deacetylases.", "journal": "Nucleic acids research", "date": "2006", "authors": "Lopez-Garcia J, Periyasamy M, Thomas RS, Christian M, Leao M, Jat P, Kindle KB, Heery DM, Parker MG, Buluwela L, Kamalati T, Ali S", "reference": { "type": "PubMed", "id": "17085477", "url": "https://pubmed.ncbi.nlm.nih.gov/17085477" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q8N895-1", "protein_name": "Zinc finger protein 366", "gene_name": "ZNF366", "tax_name": "Human" }, { "uniprot_canonical_ac": "P48552-1", "protein_name": "Nuclear receptor-interacting protein 1", "gene_name": "NRIP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P03372-1", "protein_name": "Estrogen receptor", "gene_name": "ESR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13363-1", "protein_name": "C-terminal-binding protein 1", "gene_name": "CTBP1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q8N895", "url": "https://www.uniprot.org/uniprotkb/Q8N895" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 590, "end_pos": 590, "sequence_org": "P", "sequence_mut": "A", "comment": "Abolishes interaction with CTBP1 and in part relieves transcription repression; when associated with A-592.", "evidence": [ { "database": "UniProtKB", "id": "Q8N895", "url": "https://www.uniprot.org/uniprotkb/Q8N895" }, { "database": "PubMed", "id": "17085477", "url": "https://pubmed.ncbi.nlm.nih.gov/17085477" } ], "uniprot_canonical_ac": "Q8N895-1" }, { "start_pos": 592, "end_pos": 592, "sequence_org": "D", "sequence_mut": "A", "comment": "Abolishes interaction with CTBP1 and in part relieves transcription repression; when associated with A-590.", "evidence": [ { "database": "UniProtKB", "id": "Q8N895", "url": "https://www.uniprot.org/uniprotkb/Q8N895" }, { "database": "PubMed", "id": "17085477", "url": "https://pubmed.ncbi.nlm.nih.gov/17085477" } ], "uniprot_canonical_ac": "Q8N895-1" }, { "start_pos": 645, "end_pos": 645, "sequence_org": "P", "sequence_mut": "A", "comment": "Decreases interaction with CTBP1; when associated with A-647.", "evidence": [ { "database": "UniProtKB", "id": "Q8N895", "url": "https://www.uniprot.org/uniprotkb/Q8N895" }, { "database": "PubMed", "id": "17085477", "url": "https://pubmed.ncbi.nlm.nih.gov/17085477" } ], "uniprot_canonical_ac": "Q8N895-1" }, { "start_pos": 647, "end_pos": 647, "sequence_org": "D", "sequence_mut": "A", "comment": "Decreases interaction with CTBP1; when associated with A-645.", "evidence": [ { "database": "UniProtKB", "id": "Q8N895", "url": "https://www.uniprot.org/uniprotkb/Q8N895" }, { "database": "PubMed", "id": "17085477", "url": "https://pubmed.ncbi.nlm.nih.gov/17085477" } ], "uniprot_canonical_ac": "Q8N895-1" } ], "record_id": "pubmed.17085477", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 4 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Identification of ZNF366 and PTPRD as novel determinants of plasma homocysteine in a family-based genome-wide association study.", "journal": "Blood", "date": "2009", "authors": "Malarstig A, Buil A, Souto JC, Clarke R, Blanco-Vaca F, Fontcuberta J, Peden J, Andersen M, Silveira A, Barlera S, Seedorf U, Watkins H, Almasy L, Hamsten A, Soria JM", "reference": { "type": "PubMed", "id": "19525478", "url": "https://pubmed.ncbi.nlm.nih.gov/19525478" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q8N895-1", "protein_name": "Zinc finger protein 366", "gene_name": "ZNF366", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q8N895", "url": "https://www.uniprot.org/uniprotkb/Q8N895" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.19525478", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Crosstalk and DC-SCRIPT: expanding nuclear receptor modulation.", "journal": "Biochimica et biophysica acta", "date": "2010", "authors": "Ansems M, Hontelez S, Karthaus N, Span PN, Adema GJ", "reference": { "type": "PubMed", "id": "20478364", "url": "https://pubmed.ncbi.nlm.nih.gov/20478364" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q8N895-1", "protein_name": "Zinc finger protein 366", "gene_name": "ZNF366", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q8N895", "url": "https://www.uniprot.org/uniprotkb/Q8N895" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.20478364", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "DC-SCRIPT Regulates IL-10 Production in Human Dendritic Cells by Modulating NF-kappaBp65 Activation.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "2015", "authors": "Sondergaard JN, Poghosyan S, Hontelez S, Louche P, Looman MW, Ansems M, Adema GJ", "reference": { "type": "PubMed", "id": "26170389", "url": "https://pubmed.ncbi.nlm.nih.gov/26170389" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q8N895-1", "protein_name": "Zinc finger protein 366", "gene_name": "ZNF366", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q8N895", "url": "https://www.uniprot.org/uniprotkb/Q8N895" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.26170389", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Expression and regulation of CReMM, a chromodomain helicase-DNA-binding (CHD), in marrow stroma derived osteoprogenitors.", "journal": "Journal of cellular physiology", "date": "2006", "authors": "Marom R, Shur I, Hager GL, Benayahu D", "reference": { "type": "PubMed", "id": "16523501", "url": "https://pubmed.ncbi.nlm.nih.gov/16523501" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q3L8U1-1", "protein_name": "ATP-dependent chromatin remodeler CHD9", "gene_name": "CHD9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8BYH8-1", "protein_name": "ATP-dependent chromatin remodeler CHD9", "gene_name": "Chd9", "tax_name": "Mouse" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q3L8U1", "url": "https://www.uniprot.org/uniprotkb/Q3L8U1" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.16523501", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "PRIC320, a transcription coactivator, isolated from peroxisome proliferator-binding protein complex.", "journal": "Biochemical and biophysical research communications", "date": "2006", "authors": "Surapureddi S, Viswakarma N, Yu S, Guo D, Rao MS, Reddy JK", "reference": { "type": "PubMed", "id": "16554032", "url": "https://pubmed.ncbi.nlm.nih.gov/16554032" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q3L8U1-1", "protein_name": "ATP-dependent chromatin remodeler CHD9", "gene_name": "CHD9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8BYH8-1", "protein_name": "ATP-dependent chromatin remodeler CHD9", "gene_name": "Chd9", "tax_name": "Mouse" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q3L8U1", "url": "https://www.uniprot.org/uniprotkb/Q3L8U1" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.16554032", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Dynamic interactions of chromatin-related mesenchymal modulator, a chromodomain helicase-DNA-binding protein, with promoters in osteoprogenitors.", "journal": "Stem cells (Dayton, Ohio)", "date": "2006", "authors": "Shur I, Solomon R, Benayahu D", "reference": { "type": "PubMed", "id": "16705189", "url": "https://pubmed.ncbi.nlm.nih.gov/16705189" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q3L8U1-1", "protein_name": "ATP-dependent chromatin remodeler CHD9", "gene_name": "CHD9", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q3L8U1", "url": "https://www.uniprot.org/uniprotkb/Q3L8U1" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.16705189", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Gene expression regulation by the Chromodomain helicase DNA-binding protein 9 (CHD9) chromatin remodeler is dispensable for murine development.", "journal": "PloS one", "date": "2020", "authors": "Alendar A, Lambooij JP, Bhaskaran R, Lancini C, Song JY, van Vugt H, Snoek M, Berns A", "reference": { "type": "PubMed", "id": "32453735", "url": "https://pubmed.ncbi.nlm.nih.gov/32453735" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q3L8U1-1", "protein_name": "ATP-dependent chromatin remodeler CHD9", "gene_name": "CHD9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8BYH8-1", "protein_name": "ATP-dependent chromatin remodeler CHD9", "gene_name": "Chd9", "tax_name": "Mouse" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q3L8U1", "url": "https://www.uniprot.org/uniprotkb/Q3L8U1" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.32453735", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Distinct clinical phenotypes associated with a mutation in the mitochondrial translation elongation factor EFTs.", "journal": "American journal of human genetics", "date": "2006", "authors": "Smeitink JA, Elpeleg O, Antonicka H, Diepstra H, Saada A, Smits P, Sasarman F, Vriend G, Jacob-Hirsch J, Shaag A, Rechavi G, Welling B, Horst J, Rodenburg RJ, van den Heuvel B, Shoubridge EA", "reference": { "type": "PubMed", "id": "17033963", "url": "https://pubmed.ncbi.nlm.nih.gov/17033963" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P43897-1", "protein_name": "Elongation factor Ts, mitochondrial", "gene_name": "TSFM", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P43897", "url": "https://www.uniprot.org/uniprotkb/P43897" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.17033963", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Mutation in the mitochondrial translation elongation factor EFTs results in severe infantile liver failure.", "journal": "Journal of hepatology", "date": "2012", "authors": "Vedrenne V, Galmiche L, Chretien D, de Lonlay P, Munnich A, Rotig A", "reference": { "type": "PubMed", "id": "21741925", "url": "https://pubmed.ncbi.nlm.nih.gov/21741925" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P43897-1", "protein_name": "Elongation factor Ts, mitochondrial", "gene_name": "TSFM", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P43897", "url": "https://www.uniprot.org/uniprotkb/P43897" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.21741925", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Mitochondrial EFTs defects in juvenile-onset Leigh disease, ataxia, neuropathy, and optic atrophy.", "journal": "Neurology", "date": "2014", "authors": "Ahola S, Isohanni P, Euro L, Brilhante V, Palotie A, Pihko H, Lonnqvist T, Lehtonen T, Laine J, Tyynismaa H, Suomalainen A", "reference": { "type": "PubMed", "id": "25037205", "url": "https://pubmed.ncbi.nlm.nih.gov/25037205" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P43897-1", "protein_name": "Elongation factor Ts, mitochondrial", "gene_name": "TSFM", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P43897", "url": "https://www.uniprot.org/uniprotkb/P43897" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.25037205", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Molecular-genetic characterization and rescue of a TSFM mutation causing childhood-onset ataxia and nonobstructive cardiomyopathy.", "journal": "European journal of human genetics : EJHG", "date": "2016", "authors": "Emperador S, Bayona-Bafaluy MP, Fernandez-Marmiesse A, Pineda M, Felgueroso B, Lopez-Gallardo E, Artuch R, Roca I, Ruiz-Pesini E, Couce ML, Montoya J", "reference": { "type": "PubMed", "id": "27677415", "url": "https://pubmed.ncbi.nlm.nih.gov/27677415" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P43897-1", "protein_name": "Elongation factor Ts, mitochondrial", "gene_name": "TSFM", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P43897", "url": "https://www.uniprot.org/uniprotkb/P43897" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.27677415", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Novel compound mutations in the mitochondrial translation elongation factor (TSFM) gene cause severe cardiomyopathy with myocardial fibro-adipose replacement.", "journal": "Scientific reports", "date": "2019-03-25", "authors": "Perli Elena, Pisano Annalinda, Glasgow Ruth I C, Carbo Miriam, Hardy Steven A, Falkous Gavin, He Langping, Cerbelli Bruna, Pignataro Maria Gemma, Zacara Elisabetta, Re Federica, Della Monica Paola Lilla, Morea Veronica, Bonnen Penelope E, Taylor Robert W, d'Amati Giulia, Giordano Carla", "reference": { "type": "PubMed", "id": "30911037", "url": "https://pubmed.ncbi.nlm.nih.gov/30911037" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P43897-1", "protein_name": "Elongation factor Ts, mitochondrial", "gene_name": "TSFM", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P43897", "url": "https://www.uniprot.org/uniprotkb/P43897" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.30911037", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Short-term regulation of TSFM level does not alter amyloidogenesis and mitochondrial function in type-specific cells.", "journal": "Molecular biology reports", "date": "2024-04-05", "authors": "Li Xiao-Yun, Zhou Gui-Feng, Xie Xiong-Yong, Pu Ya-Lan, -Chen Xue, Li Chen-Lu, Yang Jie, Wang Lu, Chen Guo-Jun", "reference": { "type": "PubMed", "id": "38578353", "url": "https://pubmed.ncbi.nlm.nih.gov/38578353" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P43897-1", "protein_name": "Elongation factor Ts, mitochondrial", "gene_name": "TSFM", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P43897", "url": "https://www.uniprot.org/uniprotkb/P43897" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.38578353", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Cloning and expression of mitochondrial translational elongation factor Ts from bovine and human liver.", "journal": "J. Biol. Chem.", "date": "1995", "authors": "Xin H, Woriax V, Burkhart W, Spremulli LL", "reference": { "type": "PubMed", "id": "7615523", "url": "https://pubmed.ncbi.nlm.nih.gov/7615523" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P43897-1", "protein_name": "Elongation factor Ts, mitochondrial", "gene_name": "TSFM", "tax_name": "Human" }, { "uniprot_canonical_ac": "P43896-1", "protein_name": "Elongation factor Ts, mitochondrial", "gene_name": "TSFM", "tax_name": "Bovine" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P43897", "url": "https://www.uniprot.org/uniprotkb/P43897" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.7615523", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Regulation of intracellular trafficking of human CD1d by association with MHC class II molecules.", "journal": "EMBO J.", "date": "2002", "authors": "Kang Suk-Jo, Cresswell Peter", "reference": { "type": "PubMed", "id": "11927549", "url": "https://pubmed.ncbi.nlm.nih.gov/11927549" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P15813-1", "protein_name": "Antigen-presenting glycoprotein CD1d", "gene_name": "CD1D", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P15813", "url": "https://www.uniprot.org/uniprotkb/P15813" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.11927549", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The crystal structure of human CD1d with and without alpha-galactosylceramide.", "journal": "Nat. Immunol.", "date": "2005", "authors": "Koch M, Stronge VS, Shepherd D, Gadola SD, Mathew B, Ritter G, Fersht AR, Besra GS, Schmidt RR, Jones EY, Cerundolo V", "reference": { "type": "PubMed", "id": "16007090", "url": "https://pubmed.ncbi.nlm.nih.gov/16007090" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P15813-1", "protein_name": "Antigen-presenting glycoprotein CD1d", "gene_name": "CD1D", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P15813", "url": "https://www.uniprot.org/uniprotkb/P15813" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.16007090", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "CD1d ligands: the good, the bad, and the ugly.", "journal": "J. Immunol.", "date": "2006", "authors": "Brutkiewicz Randy R", "reference": { "type": "PubMed", "id": "16818729", "url": "https://pubmed.ncbi.nlm.nih.gov/16818729" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P15813-1", "protein_name": "Antigen-presenting glycoprotein CD1d", "gene_name": "CD1D", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P15813", "url": "https://www.uniprot.org/uniprotkb/P15813" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.16818729", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Distinct endosomal trafficking requirements for presentation of autoantigens and exogenous lipids by human CD1d molecules.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "2007-05-15", "authors": "Chen Xiuxu, Wang Xiaohua, Keaton Jason M, Reddington Faye, Illarionov Petr A, Besra Gurdyal S, Gumperz Jenny E", "reference": { "type": "PubMed", "id": "17475845", "url": "https://pubmed.ncbi.nlm.nih.gov/17475845" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P15813-1", "protein_name": "Antigen-presenting glycoprotein CD1d", "gene_name": "CD1D", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P15813", "url": "https://www.uniprot.org/uniprotkb/P15813" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.17475845", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "CD1d-lipid-antigen recognition by the semi-invariant NKT T-cell receptor.", "journal": "Nature", "date": "2007", "authors": "Borg NA, Wun KS, Kjer-Nielsen L, Wilce MC, Pellicci DG, Koh R, Besra GS, Bharadwaj M, Godfrey DI, McCluskey J, Rossjohn J", "reference": { "type": "PubMed", "id": "17581592", "url": "https://pubmed.ncbi.nlm.nih.gov/17581592" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P15813-1", "protein_name": "Antigen-presenting glycoprotein CD1d", "gene_name": "CD1D", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P15813", "url": "https://www.uniprot.org/uniprotkb/P15813" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "glycosylation": [ { "glytoucan_ac": "", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "icn3d_view": { "label": "iCn3D", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?bcifid=2PO6&bu=0&command=select+.A:20;+center+selection;+zoom+selection" }, "start_pos": 38, "start_aa": "Asn", "end_pos": 38, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn38", "evidence": [ { "id": "P15813", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P15813#ptm_processing" }, { "id": "17581592", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/17581592" }, { "id": "24190977", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24190977" }, { "id": "GLY_000143", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000143" }, { "id": "2PO6", "database": "PDB", "url": "https://www.rcsb.org/structure/2PO6" }, { "id": "3VWJ", "database": "PDB", "url": "https://www.rcsb.org/structure/3VWJ" }, { "id": "3VWK", "database": "PDB", "url": "https://www.rcsb.org/structure/3VWK" }, { "id": "3HUJ", "database": "PDB", "url": "https://www.rcsb.org/structure/3HUJ" }, { "id": "4MNG", "database": "PDB", "url": "https://www.rcsb.org/structure/4MNG" }, { "id": "4WW2", "database": "PDB", "url": "https://www.rcsb.org/structure/4WW2" }, { "id": "4WWK", "database": "PDB", "url": "https://www.rcsb.org/structure/4WWK" }, { "id": "6V80", "database": "PDB", "url": "https://www.rcsb.org/structure/6V80" }, { "id": "8SGB", "database": "PDB", "url": "https://www.rcsb.org/structure/8SGB" }, { "id": "8SGM", "database": "PDB", "url": "https://www.rcsb.org/structure/8SGM" }, { "id": "8SOS", "database": "PDB", "url": "https://www.rcsb.org/structure/8SOS" } ], "filter_code": "001000000000000000000.00010000000000.00.01001", "uniprot_canonical_ac": "P15813-1" }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "icn3d_view": { "label": "iCn3D", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?bcifid=2PO6&bu=0&command=select+.A:42;+center+selection;+zoom+selection" }, "start_pos": 60, "start_aa": "Asn", "end_pos": 60, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn60", "evidence": [ { "id": "P15813", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P15813#ptm_processing" }, { "id": "19349973", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19349973" }, { "id": "17581592", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/17581592" }, { "id": "24190977", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24190977" }, { "id": "GLY_000143", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000143" }, { "id": "2PO6", "database": "PDB", "url": "https://www.rcsb.org/structure/2PO6" }, { "id": "3VWJ", "database": "PDB", "url": "https://www.rcsb.org/structure/3VWJ" }, { "id": "3VWK", "database": "PDB", "url": "https://www.rcsb.org/structure/3VWK" }, { "id": "4MNG", "database": "PDB", "url": "https://www.rcsb.org/structure/4MNG" }, { "id": "4MQ7", "database": "PDB", "url": "https://www.rcsb.org/structure/4MQ7" }, { "id": "4WW2", "database": "PDB", "url": "https://www.rcsb.org/structure/4WW2" }, { "id": "4WWK", "database": "PDB", "url": "https://www.rcsb.org/structure/4WWK" }, { "id": "8SGB", "database": "PDB", "url": "https://www.rcsb.org/structure/8SGB" }, { "id": "8SOS", "database": "PDB", "url": "https://www.rcsb.org/structure/8SOS" } ], "filter_code": "001000000000000000000.00010000000000.00.01001", "uniprot_canonical_ac": "P15813-1" } ], "record_id": "pubmed.17581592", "abstract": "", "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 }, { "field": "n_linked_sites", "count": 2 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "exact_sites", "count": 2 }, { "field": "exact_n_linked_sites", "count": 2 }, { "field": "fuzzy_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "icn3d_view.label", "icn3d_view.url", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl", "filter_code", "uniprot_canonical_ac" ] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 }, { "field": "n_linked_sites", "count": 2 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "exact_sites", "count": 2 }, { "field": "exact_n_linked_sites", "count": 2 }, { "field": "fuzzy_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "icn3d_view.label", "icn3d_view.url", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl", "filter_code", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "A threonine-based targeting signal in the human CD1d cytoplasmic tail controls its functional expression.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "2010", "authors": "Liu J, Shaji D, Cho S, Du W, Gervay-Hague J, Brutkiewicz RR", "reference": { "type": "PubMed", "id": "20368272", "url": "https://pubmed.ncbi.nlm.nih.gov/20368272" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P15813-1", "protein_name": "Antigen-presenting glycoprotein CD1d", "gene_name": "CD1D", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P15813", "url": "https://www.uniprot.org/uniprotkb/P15813" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 322, "end_pos": 322, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P15813", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P15813" }, { "database": "PubMed", "id": "20368272", "url": "https://pubmed.ncbi.nlm.nih.gov/20368272" } ], "site_lbl": "Thr322", "uniprot_canonical_ac": "P15813-1" } ], "record_id": "pubmed.20368272", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Isolation and characterization of a cDNA and gene coding for a fourth CD1 molecule.", "journal": "Proc. Natl. Acad. Sci. U.S.A.", "date": "1989", "authors": "Balk S P, Bleicher P A, Terhorst C", "reference": { "type": "PubMed", "id": "2463622", "url": "https://pubmed.ncbi.nlm.nih.gov/2463622" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P15813-1", "protein_name": "Antigen-presenting glycoprotein CD1d", "gene_name": "CD1D", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P15813", "url": "https://www.uniprot.org/uniprotkb/P15813" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.2463622", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Two classes of CD1 genes.", "journal": "Eur. J. Immunol.", "date": "1989", "authors": "Calabi F, Jarvis J M, Martin L, Milstein C", "reference": { "type": "PubMed", "id": "2467814", "url": "https://pubmed.ncbi.nlm.nih.gov/2467814" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P15813-1", "protein_name": "Antigen-presenting glycoprotein CD1d", "gene_name": "CD1D", "tax_name": "Human" }, { "uniprot_canonical_ac": "P15812-1", "protein_name": "T-cell surface glycoprotein CD1e, membrane-associated", "gene_name": "CD1E", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P15813", "url": "https://www.uniprot.org/uniprotkb/P15813" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.2467814", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Low oxygen saturation during sleep reduces CD1D and RAB20 expressions that are reversed by CPAP therapy.", "journal": "EBioMedicine", "date": "2020", "authors": "Sofer T, Li R, Joehanes R, Lin H, Gower AC, Wang H, Kurniansyah N, Cade BE, Lee J, Williams S, Mehra R, Patel SR, Quan SF, Liu Y, Rotter JI, Rich SS, Spira A, Levy D, Gharib SA, Redline S, Gottlieb DJ", "reference": { "type": "PubMed", "id": "32512511", "url": "https://pubmed.ncbi.nlm.nih.gov/32512511" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P15813-1", "protein_name": "Antigen-presenting glycoprotein CD1d", "gene_name": "CD1D", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NX57-1", "protein_name": "Ras-related protein Rab-20", "gene_name": "RAB20", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P15813", "url": "https://www.uniprot.org/uniprotkb/P15813" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.32512511", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "CD1d expression in glioblastoma is a promising target for NKT cell-based cancer immunotherapy.", "journal": "Cancer immunology, immunotherapy : CII", "date": "2021", "authors": "Hara A, Koyama-Nasu R, Takami M, Toyoda T, Aoki T, Ihara F, Kobayashi M, Hirono S, Matsutani T, Nakayama T, Iwadate Y, Motohashi S", "reference": { "type": "PubMed", "id": "33128583", "url": "https://pubmed.ncbi.nlm.nih.gov/33128583" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P15813-1", "protein_name": "Antigen-presenting glycoprotein CD1d", "gene_name": "CD1D", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P15813", "url": "https://www.uniprot.org/uniprotkb/P15813" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.33128583", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Epigenetic control of CD1D expression as a mechanism of resistance to immune checkpoint therapy in poorly immunogenic melanomas.", "journal": "Frontiers in immunology", "date": "2023", "authors": "Wang Mona Meng, Koskela Saara A, Mehmood Arfa, Langguth Miriam, Maranou Eleftheria, Figueiredo Carlos R", "reference": { "type": "PubMed", "id": "37077920", "url": "https://pubmed.ncbi.nlm.nih.gov/37077920" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P15813-1", "protein_name": "Antigen-presenting glycoprotein CD1d", "gene_name": "CD1D", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P15813", "url": "https://www.uniprot.org/uniprotkb/P15813" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.37077920", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Cancer-associated fibroblasts express CD1d and activate invariant natural killer T cells under cellular stress.", "journal": "Cellular & molecular immunology", "date": "2024-01", "authors": "Pei Shengduo, Sj\u00f6lund Jonas, Pan Yueyun, Pietras Kristian, Karlsson Mikael C I", "reference": { "type": "PubMed", "id": "37735500", "url": "https://pubmed.ncbi.nlm.nih.gov/37735500" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P15813-1", "protein_name": "Antigen-presenting glycoprotein CD1d", "gene_name": "CD1D", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P15813", "url": "https://www.uniprot.org/uniprotkb/P15813" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.37735500", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] } ]