[ { "title": "Molecular models and mutational analyses of plant specifier proteins suggest active site residues and reaction mechanism.", "journal": "Plant molecular biology", "date": "2014-01", "authors": "Brandt Wolfgang, Backenk\u00f6hler Anita, Schulze Eva, Plock Antje, Herberg Thomas, Roese Elin, Wittstock Ute", "reference": { "type": "PubMed", "id": "23999604", "url": "https://pubmed.ncbi.nlm.nih.gov/23999604" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q8RY71-1", "protein_name": "N-(sulfonatooxy)alkenimidothioic acid sulfate-lyase (epithionitrile-forming)", "gene_name": "ESP", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "Q8RY71", "url": "https://www.uniprot.org/uniprotkb/Q8RY71" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "mutagenesis": [ { "start_pos": 130, "end_pos": 130, "sequence_org": "F", "sequence_mut": "A", "comment": "Lost activity.", "evidence": [ { "database": "UniProtKB", "id": "Q8RY71", "url": "https://www.uniprot.org/uniprotkb/Q8RY71" }, { "database": "PubMed", "id": "23999604", "url": "https://pubmed.ncbi.nlm.nih.gov/23999604" } ], "uniprot_canonical_ac": "Q8RY71-1" }, { "start_pos": 186, "end_pos": 186, "sequence_org": "G", "sequence_mut": "M", "comment": "Strongly reduced activity.", "evidence": [ { "database": "UniProtKB", "id": "Q8RY71", "url": "https://www.uniprot.org/uniprotkb/Q8RY71" }, { "database": "PubMed", "id": "23999604", "url": "https://pubmed.ncbi.nlm.nih.gov/23999604" } ], "uniprot_canonical_ac": "Q8RY71-1" }, { "start_pos": 211, "end_pos": 211, "sequence_org": "K", "sequence_mut": "A", "comment": "Increased ability to hydrolyze benzylglucosinolate but normal activity when allylglucosinolate is used as substrate in the presence of myrosinase. Increased ability to hydrolyze benzylglucosinolate but slightly reduced activity when allylglucosinolate is used as substrate in the presence of myrosinase; when associated with A-94. Strongly reduced activity; when associated with A-46 and A-94.", "evidence": [ { "database": "UniProtKB", "id": "Q8RY71", "url": "https://www.uniprot.org/uniprotkb/Q8RY71" }, { "database": "PubMed", "id": "23999604", "url": "https://pubmed.ncbi.nlm.nih.gov/23999604" } ], "uniprot_canonical_ac": "Q8RY71-1" }, { "start_pos": 244, "end_pos": 244, "sequence_org": "V", "sequence_mut": "C", "comment": "Strongly reduced activity upon benzylglucosinolate but slightly reduced activity when allylglucosinolate is used as substrate in the presence of myrosinase.", "evidence": [ { "database": "UniProtKB", "id": "Q8RY71", "url": "https://www.uniprot.org/uniprotkb/Q8RY71" }, { "database": "PubMed", "id": "23999604", "url": "https://pubmed.ncbi.nlm.nih.gov/23999604" } ], "uniprot_canonical_ac": "Q8RY71-1" }, { "start_pos": 260, "end_pos": 260, "sequence_org": "E", "sequence_mut": "A", "comment": "Lost activity.", "evidence": [ { "database": "UniProtKB", "id": "Q8RY71", "url": "https://www.uniprot.org/uniprotkb/Q8RY71" }, { "database": "PubMed", "id": "23999604", "url": "https://pubmed.ncbi.nlm.nih.gov/23999604" } ], "uniprot_canonical_ac": "Q8RY71-1" }, { "start_pos": 260, "end_pos": 260, "sequence_org": "E", "sequence_mut": "Q", "comment": "Lost activity.", "evidence": [ { "database": "UniProtKB", "id": "Q8RY71", "url": "https://www.uniprot.org/uniprotkb/Q8RY71" }, { "database": "PubMed", "id": "23999604", "url": "https://pubmed.ncbi.nlm.nih.gov/23999604" } ], "uniprot_canonical_ac": "Q8RY71-1" }, { "start_pos": 264, "end_pos": 264, "sequence_org": "D", "sequence_mut": "A", "comment": "Strongly reduced activity.", "evidence": [ { "database": "UniProtKB", "id": "Q8RY71", "url": "https://www.uniprot.org/uniprotkb/Q8RY71" }, { "database": "PubMed", "id": "23999604", "url": "https://pubmed.ncbi.nlm.nih.gov/23999604" } ], "uniprot_canonical_ac": "Q8RY71-1" }, { "start_pos": 264, "end_pos": 264, "sequence_org": "D", "sequence_mut": "N", "comment": "Lost activity.", "evidence": [ { "database": "UniProtKB", "id": "Q8RY71", "url": "https://www.uniprot.org/uniprotkb/Q8RY71" }, { "database": "PubMed", "id": "23999604", "url": "https://pubmed.ncbi.nlm.nih.gov/23999604" } ], "uniprot_canonical_ac": "Q8RY71-1" }, { "start_pos": 300, "end_pos": 300, "sequence_org": "P", "sequence_mut": "N", "comment": "Strongly reduced activity.", "evidence": [ { "database": "UniProtKB", "id": "Q8RY71", "url": "https://www.uniprot.org/uniprotkb/Q8RY71" }, { "database": "PubMed", "id": "23999604", "url": "https://pubmed.ncbi.nlm.nih.gov/23999604" } ], "uniprot_canonical_ac": "Q8RY71-1" }, { "start_pos": 301, "end_pos": 301, "sequence_org": "R", "sequence_mut": "L", "comment": "Strongly reduced activity.", "evidence": [ { "database": "UniProtKB", "id": "Q8RY71", "url": "https://www.uniprot.org/uniprotkb/Q8RY71" }, { "database": "PubMed", "id": "23999604", "url": "https://pubmed.ncbi.nlm.nih.gov/23999604" } ], "uniprot_canonical_ac": "Q8RY71-1" }, { "start_pos": 45, "end_pos": 45, "sequence_org": "N", "sequence_mut": "Y", "comment": "Strongly reduced activity.", "evidence": [ { "database": "UniProtKB", "id": "Q8RY71", "url": "https://www.uniprot.org/uniprotkb/Q8RY71" }, { "database": "PubMed", "id": "23999604", "url": "https://pubmed.ncbi.nlm.nih.gov/23999604" } ], "uniprot_canonical_ac": "Q8RY71-1" }, { "start_pos": 46, "end_pos": 46, "sequence_org": "K", "sequence_mut": "A", "comment": "Reduced activity. Strongly reduced activity; when associated with A-94. Reduced activity; when associated with A-94 and A-211.", "evidence": [ { "database": "UniProtKB", "id": "Q8RY71", "url": "https://www.uniprot.org/uniprotkb/Q8RY71" }, { "database": "PubMed", "id": "23999604", "url": "https://pubmed.ncbi.nlm.nih.gov/23999604" } ], "uniprot_canonical_ac": "Q8RY71-1" }, { "start_pos": 94, "end_pos": 94, "sequence_org": "R", "sequence_mut": "A", "comment": "Strongly increased ability to hydrolyze benzylglucosinolate but slightly enhanced activity when allylglucosinolate is used as substrate in the presence of myrosinase. Increased ability to hydrolyze benzylglucosinolate but slightly reduced activity when allylglucosinolate is used as substrate in the presence of myrosinase; when associated with A-211. Reduced activity; when associated with A-46. Strongly reduced activity; when associated with A-46 and A-211.", "evidence": [ { "database": "UniProtKB", "id": "Q8RY71", "url": "https://www.uniprot.org/uniprotkb/Q8RY71" }, { "database": "PubMed", "id": "23999604", "url": "https://pubmed.ncbi.nlm.nih.gov/23999604" } ], "uniprot_canonical_ac": "Q8RY71-1" }, { "start_pos": 94, "end_pos": 94, "sequence_org": "R", "sequence_mut": "K", "comment": "Reduced activity.", "evidence": [ { "database": "UniProtKB", "id": "Q8RY71", "url": "https://www.uniprot.org/uniprotkb/Q8RY71" }, { "database": "PubMed", "id": "23999604", "url": "https://pubmed.ncbi.nlm.nih.gov/23999604" } ], "uniprot_canonical_ac": "Q8RY71-1" } ], "record_id": "pubmed.23999604", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Crystal structure of the Epithiospecifier Protein, ESP from Arabidopsis thaliana provides insights into its product specificity.", "journal": "Biochemical and biophysical research communications", "date": "2016-09-16", "authors": "Zhang Weiwei, Wang Wenhe, Liu Zihe, Xie Yongchao, Wang Hao, Mu Yajuan, Huang Yao, Feng Yue", "reference": { "type": "PubMed", "id": "27498030", "url": "https://pubmed.ncbi.nlm.nih.gov/27498030" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q8RY71-1", "protein_name": "N-(sulfonatooxy)alkenimidothioic acid sulfate-lyase (epithionitrile-forming)", "gene_name": "ESP", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "Q8RY71", "url": "https://www.uniprot.org/uniprotkb/Q8RY71" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.27498030", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Positional signaling mediated by a receptor-like kinase in Arabidopsis.", "journal": "Science (New York, N.Y.)", "date": "2005-02-18", "authors": "Kwak Su-Hwan, Shen Ronglai, Schiefelbein John", "reference": { "type": "PubMed", "id": "15618487", "url": "https://pubmed.ncbi.nlm.nih.gov/15618487" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q8RWZ1-1", "protein_name": "Protein STRUBBELIG", "gene_name": "SUB", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "Q8RWZ1", "url": "https://www.uniprot.org/uniprotkb/Q8RWZ1" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "mutagenesis": [ { "start_pos": 324, "end_pos": 768, "sequence_org": "QISPPSGSGSGKFWSTQRIILVVSSVAIIVLVSGLCVTLWRCCRSKIYNRYYSGARKDLQRPYFNKPPSQPTPTMGKVSREPMVKPFDGYGAGDRKYGYPMPQRAEESRRAMPPTSYYNKDVNTPQKPLQQPPRQFQSNDTASKRAAHFPPGLNSSSSATVFTIASLQQYTNNFSEENIIGEGSIGNVYRAELRHGKFLAVKKLSNTINRTQSDGEFLNLVSNVLKLKRGHILELLGYCNEFGQRLLVYEYCPNGSLQDALHLDRKLHKKLTWNVRINIALGASKALQFLHEVCQPPVVHQNFKSSKVLLDGKLSVRVADSGLAYMLPPRPTSQMAGYAAPEVEYGSYTCQSDVFSLGVVMLELLTGRRPFDRTRPRGHQTLAQWAIPRLHDIDALTRMVDPSLHGAYPMKSLSRFADIISRSLQMEPGFRPPISEIVQDLQHMI", "sequence_mut": "", "comment": "In scm-1; loss of function.", "evidence": [ { "database": "UniProtKB", "id": "Q8RWZ1", "url": "https://www.uniprot.org/uniprotkb/Q8RWZ1" }, { "database": "PubMed", "id": "15618487", "url": "https://pubmed.ncbi.nlm.nih.gov/15618487" } ], "uniprot_canonical_ac": "Q8RWZ1-1" } ], "record_id": "pubmed.15618487", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "STRUBBELIG defines a receptor kinase-mediated signaling pathway regulating organ development in Arabidopsis.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2005-06-21", "authors": "Chevalier David, Batoux Martine, Fulton Lynette, Pfister Karen, Yadav Ram Kishor, Schellenberg Maja, Schneitz Kay", "reference": { "type": "PubMed", "id": "15951420", "url": "https://pubmed.ncbi.nlm.nih.gov/15951420" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q8RWZ1-1", "protein_name": "Protein STRUBBELIG", "gene_name": "SUB", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "Q8RWZ1", "url": "https://www.uniprot.org/uniprotkb/Q8RWZ1" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "mutagenesis": [ { "start_pos": 288, "end_pos": 768, "sequence_org": "QPQQHPPPSPPLVWSPPSSDNGGGDPWNSVSGQPTLQISPPSGSGSGKFWSTQRIILVVSSVAIIVLVSGLCVTLWRCCRSKIYNRYYSGARKDLQRPYFNKPPSQPTPTMGKVSREPMVKPFDGYGAGDRKYGYPMPQRAEESRRAMPPTSYYNKDVNTPQKPLQQPPRQFQSNDTASKRAAHFPPGLNSSSSATVFTIASLQQYTNNFSEENIIGEGSIGNVYRAELRHGKFLAVKKLSNTINRTQSDGEFLNLVSNVLKLKRGHILELLGYCNEFGQRLLVYEYCPNGSLQDALHLDRKLHKKLTWNVRINIALGASKALQFLHEVCQPPVVHQNFKSSKVLLDGKLSVRVADSGLAYMLPPRPTSQMAGYAAPEVEYGSYTCQSDVFSLGVVMLELLTGRRPFDRTRPRGHQTLAQWAIPRLHDIDALTRMVDPSLHGAYPMKSLSRFADIISRSLQMEPGFRPPISEIVQDLQHMI", "sequence_mut": "", "comment": "In sub-5; loss of function.", "evidence": [ { "database": "UniProtKB", "id": "Q8RWZ1", "url": "https://www.uniprot.org/uniprotkb/Q8RWZ1" }, { "database": "PubMed", "id": "15951420", "url": "https://pubmed.ncbi.nlm.nih.gov/15951420" } ], "uniprot_canonical_ac": "Q8RWZ1-1" }, { "start_pos": 337, "end_pos": 768, "sequence_org": "WSTQRIILVVSSVAIIVLVSGLCVTLWRCCRSKIYNRYYSGARKDLQRPYFNKPPSQPTPTMGKVSREPMVKPFDGYGAGDRKYGYPMPQRAEESRRAMPPTSYYNKDVNTPQKPLQQPPRQFQSNDTASKRAAHFPPGLNSSSSATVFTIASLQQYTNNFSEENIIGEGSIGNVYRAELRHGKFLAVKKLSNTINRTQSDGEFLNLVSNVLKLKRGHILELLGYCNEFGQRLLVYEYCPNGSLQDALHLDRKLHKKLTWNVRINIALGASKALQFLHEVCQPPVVHQNFKSSKVLLDGKLSVRVADSGLAYMLPPRPTSQMAGYAAPEVEYGSYTCQSDVFSLGVVMLELLTGRRPFDRTRPRGHQTLAQWAIPRLHDIDALTRMVDPSLHGAYPMKSLSRFADIISRSLQMEPGFRPPISEIVQDLQHMI", "sequence_mut": "", "comment": "In sub-2; loss of function.", "evidence": [ { "database": "UniProtKB", "id": "Q8RWZ1", "url": "https://www.uniprot.org/uniprotkb/Q8RWZ1" }, { "database": "PubMed", "id": "15951420", "url": "https://pubmed.ncbi.nlm.nih.gov/15951420" } ], "uniprot_canonical_ac": "Q8RWZ1-1" }, { "start_pos": 506, "end_pos": 506, "sequence_org": "G", "sequence_mut": "A", "comment": "No phenotypic effect.", "evidence": [ { "database": "UniProtKB", "id": "Q8RWZ1", "url": "https://www.uniprot.org/uniprotkb/Q8RWZ1" }, { "database": "PubMed", "id": "15951420", "url": "https://pubmed.ncbi.nlm.nih.gov/15951420" } ], "uniprot_canonical_ac": "Q8RWZ1-1" }, { "start_pos": 525, "end_pos": 525, "sequence_org": "K", "sequence_mut": "E", "comment": "No phenotypic effect.", "evidence": [ { "database": "UniProtKB", "id": "Q8RWZ1", "url": "https://www.uniprot.org/uniprotkb/Q8RWZ1" }, { "database": "PubMed", "id": "15951420", "url": "https://pubmed.ncbi.nlm.nih.gov/15951420" } ], "uniprot_canonical_ac": "Q8RWZ1-1" }, { "start_pos": 539, "end_pos": 539, "sequence_org": "E", "sequence_mut": "A", "comment": "No phenotypic effect.", "evidence": [ { "database": "UniProtKB", "id": "Q8RWZ1", "url": "https://www.uniprot.org/uniprotkb/Q8RWZ1" }, { "database": "PubMed", "id": "15951420", "url": "https://pubmed.ncbi.nlm.nih.gov/15951420" } ], "uniprot_canonical_ac": "Q8RWZ1-1" }, { "start_pos": 599, "end_pos": 599, "sequence_org": "R", "sequence_mut": "C", "comment": "In sub-4; loss of function.", "evidence": [ { "database": "UniProtKB", "id": "Q8RWZ1", "url": "https://www.uniprot.org/uniprotkb/Q8RWZ1" }, { "database": "PubMed", "id": "21603601", "url": "https://pubmed.ncbi.nlm.nih.gov/21603601" }, { "database": "PubMed", "id": "15951420", "url": "https://pubmed.ncbi.nlm.nih.gov/15951420" } ], "uniprot_canonical_ac": "Q8RWZ1-1" }, { "start_pos": 64, "end_pos": 64, "sequence_org": "V", "sequence_mut": "M", "comment": "In sub-3; loss of function.", "evidence": [ { "database": "UniProtKB", "id": "Q8RWZ1", "url": "https://www.uniprot.org/uniprotkb/Q8RWZ1" }, { "database": "PubMed", "id": "21603601", "url": "https://pubmed.ncbi.nlm.nih.gov/21603601" }, { "database": "PubMed", "id": "15951420", "url": "https://pubmed.ncbi.nlm.nih.gov/15951420" } ], "uniprot_canonical_ac": "Q8RWZ1-1" } ], "record_id": "pubmed.15951420", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Positional information and mobile transcriptional regulators determine cell pattern in the Arabidopsis root epidermis.", "journal": "Journal of experimental botany", "date": "2006", "authors": "Dolan Liam", "reference": { "type": "PubMed", "id": "16317033", "url": "https://pubmed.ncbi.nlm.nih.gov/16317033" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q8RWZ1-1", "protein_name": "Protein STRUBBELIG", "gene_name": "SUB", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "Q8RWZ1", "url": "https://www.uniprot.org/uniprotkb/Q8RWZ1" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.16317033", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The Arabidopsis receptor-like kinase STRUBBELIG mediates inter-cell-layer signaling during floral development.", "journal": "Developmental biology", "date": "2008-11-15", "authors": "Yadav Ram Kishor, Fulton Lynette, Batoux Martine, Schneitz Kay", "reference": { "type": "PubMed", "id": "18771664", "url": "https://pubmed.ncbi.nlm.nih.gov/18771664" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q8RWZ1-1", "protein_name": "Protein STRUBBELIG", "gene_name": "SUB", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "Q8RWZ1", "url": "https://www.uniprot.org/uniprotkb/Q8RWZ1" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.18771664", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Structure-function analysis of STRUBBELIG, an Arabidopsis atypical receptor-like kinase involved in tissue morphogenesis.", "journal": "PloS one", "date": "2011", "authors": "Vaddepalli Prasad, Fulton Lynette, Batoux Martine, Yadav Ram Kishor, Schneitz Kay", "reference": { "type": "PubMed", "id": "21603601", "url": "https://pubmed.ncbi.nlm.nih.gov/21603601" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q8RWZ1-1", "protein_name": "Protein STRUBBELIG", "gene_name": "SUB", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "Q8RWZ1", "url": "https://www.uniprot.org/uniprotkb/Q8RWZ1" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "mutagenesis": [ { "start_pos": 222, "end_pos": 222, "sequence_org": "S", "sequence_mut": "L", "comment": "In sub-12; no phenotypic effect.", "evidence": [ { "database": "UniProtKB", "id": "Q8RWZ1", "url": "https://www.uniprot.org/uniprotkb/Q8RWZ1" }, { "database": "PubMed", "id": "21603601", "url": "https://pubmed.ncbi.nlm.nih.gov/21603601" } ], "uniprot_canonical_ac": "Q8RWZ1-1" }, { "start_pos": 258, "end_pos": 258, "sequence_org": "P", "sequence_mut": "L", "comment": "In sub-13; no phenotypic effect.", "evidence": [ { "database": "UniProtKB", "id": "Q8RWZ1", "url": "https://www.uniprot.org/uniprotkb/Q8RWZ1" }, { "database": "PubMed", "id": "21603601", "url": "https://pubmed.ncbi.nlm.nih.gov/21603601" } ], "uniprot_canonical_ac": "Q8RWZ1-1" }, { "start_pos": 272, "end_pos": 272, "sequence_org": "P", "sequence_mut": "S", "comment": "In sub-14; no phenotypic effect.", "evidence": [ { "database": "UniProtKB", "id": "Q8RWZ1", "url": "https://www.uniprot.org/uniprotkb/Q8RWZ1" }, { "database": "PubMed", "id": "21603601", "url": "https://pubmed.ncbi.nlm.nih.gov/21603601" } ], "uniprot_canonical_ac": "Q8RWZ1-1" }, { "start_pos": 304, "end_pos": 304, "sequence_org": "P", "sequence_mut": "L", "comment": "In sub-15; loss of function.", "evidence": [ { "database": "UniProtKB", "id": "Q8RWZ1", "url": "https://www.uniprot.org/uniprotkb/Q8RWZ1" }, { "database": "PubMed", "id": "21603601", "url": "https://pubmed.ncbi.nlm.nih.gov/21603601" } ], "uniprot_canonical_ac": "Q8RWZ1-1" }, { "start_pos": 357, "end_pos": 357, "sequence_org": "G", "sequence_mut": "S", "comment": "In sub-16; no phenotypic effect.", "evidence": [ { "database": "UniProtKB", "id": "Q8RWZ1", "url": "https://www.uniprot.org/uniprotkb/Q8RWZ1" }, { "database": "PubMed", "id": "21603601", "url": "https://pubmed.ncbi.nlm.nih.gov/21603601" } ], "uniprot_canonical_ac": "Q8RWZ1-1" }, { "start_pos": 466, "end_pos": 466, "sequence_org": "S", "sequence_mut": "L", "comment": "In sub-17; no phenotypic effect.", "evidence": [ { "database": "UniProtKB", "id": "Q8RWZ1", "url": "https://www.uniprot.org/uniprotkb/Q8RWZ1" }, { "database": "PubMed", "id": "21603601", "url": "https://pubmed.ncbi.nlm.nih.gov/21603601" } ], "uniprot_canonical_ac": "Q8RWZ1-1" }, { "start_pos": 473, "end_pos": 473, "sequence_org": "P", "sequence_mut": "L", "comment": "In sub-18; no phenotypic effect.", "evidence": [ { "database": "UniProtKB", "id": "Q8RWZ1", "url": "https://www.uniprot.org/uniprotkb/Q8RWZ1" }, { "database": "PubMed", "id": "21603601", "url": "https://pubmed.ncbi.nlm.nih.gov/21603601" } ], "uniprot_canonical_ac": "Q8RWZ1-1" }, { "start_pos": 545, "end_pos": 545, "sequence_org": "S", "sequence_mut": "F", "comment": "In sub-19; loss of function.", "evidence": [ { "database": "UniProtKB", "id": "Q8RWZ1", "url": "https://www.uniprot.org/uniprotkb/Q8RWZ1" }, { "database": "PubMed", "id": "21603601", "url": "https://pubmed.ncbi.nlm.nih.gov/21603601" } ], "uniprot_canonical_ac": "Q8RWZ1-1" }, { "start_pos": 57, "end_pos": 57, "sequence_org": "C", "sequence_mut": "Y", "comment": "In sub-10; loss of function. Loss of function; when associated with Y-66.", "evidence": [ { "database": "UniProtKB", "id": "Q8RWZ1", "url": "https://www.uniprot.org/uniprotkb/Q8RWZ1" }, { "database": "PubMed", "id": "21603601", "url": "https://pubmed.ncbi.nlm.nih.gov/21603601" } ], "uniprot_canonical_ac": "Q8RWZ1-1" }, { "start_pos": 599, "end_pos": 599, "sequence_org": "R", "sequence_mut": "C", "comment": "In sub-4; loss of function.", "evidence": [ { "database": "UniProtKB", "id": "Q8RWZ1", "url": "https://www.uniprot.org/uniprotkb/Q8RWZ1" }, { "database": "PubMed", "id": "21603601", "url": "https://pubmed.ncbi.nlm.nih.gov/21603601" }, { "database": "PubMed", "id": "15951420", "url": "https://pubmed.ncbi.nlm.nih.gov/15951420" } ], "uniprot_canonical_ac": "Q8RWZ1-1" }, { "start_pos": 633, "end_pos": 633, "sequence_org": "L", "sequence_mut": "F", "comment": "In sub-20; no phenotypic effect.", "evidence": [ { "database": "UniProtKB", "id": "Q8RWZ1", "url": "https://www.uniprot.org/uniprotkb/Q8RWZ1" }, { "database": "PubMed", "id": "21603601", "url": "https://pubmed.ncbi.nlm.nih.gov/21603601" } ], "uniprot_canonical_ac": "Q8RWZ1-1" }, { "start_pos": 64, "end_pos": 64, "sequence_org": "V", "sequence_mut": "M", "comment": "In sub-3; loss of function.", "evidence": [ { "database": "UniProtKB", "id": "Q8RWZ1", "url": "https://www.uniprot.org/uniprotkb/Q8RWZ1" }, { "database": "PubMed", "id": "21603601", "url": "https://pubmed.ncbi.nlm.nih.gov/21603601" }, { "database": "PubMed", "id": "15951420", "url": "https://pubmed.ncbi.nlm.nih.gov/15951420" } ], "uniprot_canonical_ac": "Q8RWZ1-1" }, { "start_pos": 66, "end_pos": 66, "sequence_org": "C", "sequence_mut": "Y", "comment": "Loss of function. Loss of function; when associated with Y-57.", "evidence": [ { "database": "UniProtKB", "id": "Q8RWZ1", "url": "https://www.uniprot.org/uniprotkb/Q8RWZ1" }, { "database": "PubMed", "id": "21603601", "url": "https://pubmed.ncbi.nlm.nih.gov/21603601" } ], "uniprot_canonical_ac": "Q8RWZ1-1" }, { "start_pos": 69, "end_pos": 69, "sequence_org": "S", "sequence_mut": "L", "comment": "In sub-11; no phenotypic effect.", "evidence": [ { "database": "UniProtKB", "id": "Q8RWZ1", "url": "https://www.uniprot.org/uniprotkb/Q8RWZ1" }, { "database": "PubMed", "id": "21603601", "url": "https://pubmed.ncbi.nlm.nih.gov/21603601" } ], "uniprot_canonical_ac": "Q8RWZ1-1" } ], "record_id": "pubmed.21603601", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Arabidopsis SHY2/IAA3 inhibits auxin-regulated gene expression.", "journal": "The Plant cell", "date": "2002-02", "authors": "Tian Qing, Uhlir Nicholas J, Reed Jason W", "reference": { "type": "PubMed", "id": "11884676", "url": "https://pubmed.ncbi.nlm.nih.gov/11884676" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q38822-1", "protein_name": "Auxin-responsive protein IAA3", "gene_name": "IAA3; SHY2", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "Q38822", "url": "https://www.uniprot.org/uniprotkb/Q38822" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.11884676", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "AXR3 and SHY2 interact to regulate root hair development.", "journal": "Development", "date": "2003", "authors": "Knox Kirsten, Grierson Claire S, Leyser Ottoline", "reference": { "type": "PubMed", "id": "14534134", "url": "https://pubmed.ncbi.nlm.nih.gov/14534134" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q38822-1", "protein_name": "Auxin-responsive protein IAA3", "gene_name": "IAA3; SHY2", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "Q38822", "url": "https://www.uniprot.org/uniprotkb/Q38822" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.14534134", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Spatio-temporal sequence of cross-regulatory events in root meristem growth.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2010-12-28", "authors": "Scacchi Emanuele, Salinas Paula, Gujas Bojan, Santuari Luca, Krogan Naden, Ragni Laura, Berleth Thomas, Hardtke Christian S", "reference": { "type": "PubMed", "id": "21149702", "url": "https://pubmed.ncbi.nlm.nih.gov/21149702" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q38822-1", "protein_name": "Auxin-responsive protein IAA3", "gene_name": "IAA3; SHY2", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q17TI5-1", "protein_name": "Protein BREVIS RADIX", "gene_name": "BRX", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "Q38822", "url": "https://www.uniprot.org/uniprotkb/Q38822" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.21149702", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Strigolactone signaling in the endodermis is sufficient to restore root responses and involves SHORT HYPOCOTYL 2 (SHY2) activity.", "journal": "The New phytologist", "date": "2013-05", "authors": "Koren Dikla, Resnick Nathalie, Gati Einav Mayzlish, Belausov Eduard, Weininger Smadar, Kapulnik Yoram, Koltai Hinanit", "reference": { "type": "PubMed", "id": "23425316", "url": "https://pubmed.ncbi.nlm.nih.gov/23425316" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q38822-1", "protein_name": "Auxin-responsive protein IAA3", "gene_name": "IAA3; SHY2", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "Q38822", "url": "https://www.uniprot.org/uniprotkb/Q38822" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.23425316", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Control of auxin-regulated root development by the Arabidopsis thaliana SHY2/IAA3 gene.", "journal": "Development (Cambridge, England)", "date": "1999-02", "authors": "Tian Q, Reed J W", "reference": { "type": "PubMed", "id": "9895319", "url": "https://pubmed.ncbi.nlm.nih.gov/9895319" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q38822-1", "protein_name": "Auxin-responsive protein IAA3", "gene_name": "IAA3; SHY2", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "Q38822", "url": "https://www.uniprot.org/uniprotkb/Q38822" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "mutagenesis": [ { "start_pos": 67, "end_pos": 67, "sequence_org": "G", "sequence_mut": "E", "comment": "In shy2-3; gain of function. Affects auxin-related developmental processes. Affects photomorphogenesis.", "evidence": [ { "database": "UniProtKB", "id": "Q38822", "url": "https://www.uniprot.org/uniprotkb/Q38822" }, { "database": "PubMed", "id": "9895319", "url": "https://pubmed.ncbi.nlm.nih.gov/9895319" } ], "uniprot_canonical_ac": "Q38822-1" }, { "start_pos": 69, "end_pos": 69, "sequence_org": "P", "sequence_mut": "S", "comment": "In shy2-2; gain of function. Affects auxin-related developmental processes. Affects photomorphogenesis.", "evidence": [ { "database": "UniProtKB", "id": "Q38822", "url": "https://www.uniprot.org/uniprotkb/Q38822" }, { "database": "PubMed", "id": "9895319", "url": "https://pubmed.ncbi.nlm.nih.gov/9895319" } ], "uniprot_canonical_ac": "Q38822-1" } ], "record_id": "pubmed.9895319", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Arabidopsis HY8 locus encodes phytochrome A.", "journal": "The Plant cell", "date": "1993-09", "authors": "Dehesh K, Franci C, Parks B M, Seeley K A, Short T W, Tepperman J M, Quail P H", "reference": { "type": "PubMed", "id": "8400877", "url": "https://pubmed.ncbi.nlm.nih.gov/8400877" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P14712-1", "protein_name": "Phytochrome A", "gene_name": "PHYA", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "P14712", "url": "https://www.uniprot.org/uniprotkb/P14712" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "mutagenesis": [ { "start_pos": 727, "end_pos": 727, "sequence_org": "G", "sequence_mut": "E", "comment": "In HY8-3; no regulatory activity.", "evidence": [ { "database": "UniProtKB", "id": "P14712", "url": "https://www.uniprot.org/uniprotkb/P14712" }, { "database": "PubMed", "id": "8400877", "url": "https://pubmed.ncbi.nlm.nih.gov/8400877" } ], "uniprot_canonical_ac": "P14712-1" } ], "record_id": "pubmed.8400877", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "An Arabidopsis mitogen-activated protein kinase kinase kinase gene family encodes essential positive regulators of cytokinesis.", "journal": "The Plant cell", "date": "2002-05", "authors": "Krysan Patrick J, Jester Peter J, Gottwald Jennifer R, Sussman Michael R", "reference": { "type": "PubMed", "id": "12034900", "url": "https://pubmed.ncbi.nlm.nih.gov/12034900" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O22040-1", "protein_name": "Mitogen-activated protein kinase kinase kinase ANP1", "gene_name": "ANP1; NP1", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "O22040", "url": "https://www.uniprot.org/uniprotkb/O22040" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.12034900", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "BRX mediates feedback between brassinosteroid levels and auxin signalling in root growth.", "journal": "Nature", "date": "2006", "authors": "Mouchel C\u00e9line F, Osmont Karen S, Hardtke Christian S", "reference": { "type": "PubMed", "id": "17006513", "url": "https://pubmed.ncbi.nlm.nih.gov/17006513" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q17TI5-1", "protein_name": "Protein BREVIS RADIX", "gene_name": "BRX", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "Q17TI5", "url": "https://www.uniprot.org/uniprotkb/Q17TI5" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.17006513", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "BREVIS RADIX is involved in cytokinin-mediated inhibition of lateral root initiation in Arabidopsis.", "journal": "Planta", "date": "2009", "authors": "Li Jing, Mo Xiaorong, Wang Jirong, Chen Nannan, Fan Huan, Dai Chunyan, Wu Ping", "reference": { "type": "PubMed", "id": "19037657", "url": "https://pubmed.ncbi.nlm.nih.gov/19037657" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q17TI5-1", "protein_name": "Protein BREVIS RADIX", "gene_name": "BRX", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "Q17TI5", "url": "https://www.uniprot.org/uniprotkb/Q17TI5" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.19037657", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The short-rooted phenotype of the brevis radix mutant partly reflects root abscisic acid hypersensitivity.", "journal": "Plant physiology", "date": "2009-04", "authors": "Rodrigues Americo, Santiago Julia, Rubio Silvia, Saez Angela, Osmont Karen S, Gadea Jose, Hardtke Christian S, Rodriguez Pedro L", "reference": { "type": "PubMed", "id": "19201913", "url": "https://pubmed.ncbi.nlm.nih.gov/19201913" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q17TI5-1", "protein_name": "Protein BREVIS RADIX", "gene_name": "BRX", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "Q17TI5", "url": "https://www.uniprot.org/uniprotkb/Q17TI5" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.19201913", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "BRX promotes Arabidopsis shoot growth.", "journal": "The New phytologist", "date": "2010-10", "authors": "Beuchat Julien, Scacchi Emanuele, Tarkowska Danuse, Ragni Laura, Strnad Miroslav, Hardtke Christian S", "reference": { "type": "PubMed", "id": "20649916", "url": "https://pubmed.ncbi.nlm.nih.gov/20649916" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q17TI5-1", "protein_name": "Protein BREVIS RADIX", "gene_name": "BRX", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "Q17TI5", "url": "https://www.uniprot.org/uniprotkb/Q17TI5" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.20649916", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "FILAMENTOUS FLOWER, a meristem and organ identity gene of Arabidopsis, encodes a protein with a zinc finger and HMG-related domains.", "journal": "Genes & development", "date": "1999-05-01", "authors": "Sawa S, Watanabe K, Goto K, Liu Y G, Shibata D, Kanaya E, Morita E H, Okada K", "reference": { "type": "PubMed", "id": "10323860", "url": "https://pubmed.ncbi.nlm.nih.gov/10323860" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O22152-1", "protein_name": "Axial regulator YABBY 1", "gene_name": "AFO; YAB1", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "O22152", "url": "https://www.uniprot.org/uniprotkb/O22152" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "mutagenesis": [ { "start_pos": 30, "end_pos": 30, "sequence_org": "C", "sequence_mut": "Y", "comment": "In fil-2; abnormal abaxial determination during embryogenesis and organogenesis, filamentous flowers.", "evidence": [ { "database": "UniProtKB", "id": "O22152", "url": "https://www.uniprot.org/uniprotkb/O22152" }, { "database": "PubMed", "id": "10457020", "url": "https://pubmed.ncbi.nlm.nih.gov/10457020" }, { "database": "PubMed", "id": "10323860", "url": "https://pubmed.ncbi.nlm.nih.gov/10323860" } ], "uniprot_canonical_ac": "O22152-1" } ], "record_id": "pubmed.10323860", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The Arabidopsis FILAMENTOUS FLOWER gene is required for flower formation.", "journal": "Development (Cambridge, England)", "date": "1999-06", "authors": "Chen Q, Atkinson A, Otsuga D, Christensen T, Reynolds L, Drews G N", "reference": { "type": "PubMed", "id": "10331982", "url": "https://pubmed.ncbi.nlm.nih.gov/10331982" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O22152-1", "protein_name": "Axial regulator YABBY 1", "gene_name": "AFO; YAB1", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "O22152", "url": "https://www.uniprot.org/uniprotkb/O22152" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.10331982", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Zinc release from the CH2C6 zinc finger domain of FILAMENTOUS FLOWER protein from Arabidopsis thaliana induces self-assembly.", "journal": "The Journal of biological chemistry", "date": "2001-03-09", "authors": "Kanaya E, Watanabe K, Nakajima N, Okada K, Shimura Y", "reference": { "type": "PubMed", "id": "11092895", "url": "https://pubmed.ncbi.nlm.nih.gov/11092895" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O22152-1", "protein_name": "Axial regulator YABBY 1", "gene_name": "AFO; YAB1", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "O22152", "url": "https://www.uniprot.org/uniprotkb/O22152" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "mutagenesis": [ { "start_pos": 56, "end_pos": 56, "sequence_org": "C", "sequence_mut": "A", "comment": "Loss of zinc release and reduction of multimerization.", "evidence": [ { "database": "UniProtKB", "id": "O22152", "url": "https://www.uniprot.org/uniprotkb/O22152" }, { "database": "PubMed", "id": "11092895", "url": "https://pubmed.ncbi.nlm.nih.gov/11092895" } ], "uniprot_canonical_ac": "O22152-1" } ], "record_id": "pubmed.11092895", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Non-sequence-specific DNA binding by the FILAMENTOUS FLOWER protein from Arabidopsis thaliana is reduced by EDTA.", "journal": "The Journal of biological chemistry", "date": "2002-04-05", "authors": "Kanaya Eiko, Nakajima Noboru, Okada Kiyotaka", "reference": { "type": "PubMed", "id": "11812777", "url": "https://pubmed.ncbi.nlm.nih.gov/11812777" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O22152-1", "protein_name": "Axial regulator YABBY 1", "gene_name": "AFO; YAB1", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "O22152", "url": "https://www.uniprot.org/uniprotkb/O22152" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.11812777", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Two discrete cis elements control the abaxial side-specific expression of the FILAMENTOUS FLOWER gene in Arabidopsis.", "journal": "Plant Cell", "date": "2003", "authors": "Watanabe Keiro, Okada Kiyotaka", "reference": { "type": "PubMed", "id": "14555697", "url": "https://pubmed.ncbi.nlm.nih.gov/14555697" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O22152-1", "protein_name": "Axial regulator YABBY 1", "gene_name": "AFO; YAB1", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "O22152", "url": "https://www.uniprot.org/uniprotkb/O22152" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.14555697", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "FILAMENTOUS FLOWER controls the formation and development of arabidopsis inflorescences and floral meristems.", "journal": "The Plant cell", "date": "1999-01", "authors": "Sawa S, Ito T, Shimura Y, Okada K", "reference": { "type": "PubMed", "id": "9878633", "url": "https://pubmed.ncbi.nlm.nih.gov/9878633" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O22152-1", "protein_name": "Axial regulator YABBY 1", "gene_name": "AFO; YAB1", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "O22152", "url": "https://www.uniprot.org/uniprotkb/O22152" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.9878633", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Mutations in the Arabidopsis VAR2 locus cause leaf variegation due to the loss of a chloroplast FtsH protease.", "journal": "The Plant journal : for cell and molecular biology", "date": "2000-05", "authors": "Chen M, Choi Y, Voytas D F, Rodermel S", "reference": { "type": "PubMed", "id": "10849347", "url": "https://pubmed.ncbi.nlm.nih.gov/10849347" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O80860-1", "protein_name": "ATP-dependent zinc metalloprotease FTSH 2, chloroplastic", "gene_name": "FTSH2; VAR2", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "O80860", "url": "https://www.uniprot.org/uniprotkb/O80860" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.10849347", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The ACA4 gene of Arabidopsis encodes a vacuolar membrane calcium pump that improves salt tolerance in yeast.", "journal": "Plant Physiol.", "date": "2000", "authors": "Geisler M, Frangne N, Gom\u00e8s E, Martinoia E, Palmgren M G", "reference": { "type": "PubMed", "id": "11115896", "url": "https://pubmed.ncbi.nlm.nih.gov/11115896" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O22218-1", "protein_name": "Calcium-transporting ATPase 4, plasma membrane-type", "gene_name": "ACA4", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "O22218", "url": "https://www.uniprot.org/uniprotkb/O22218" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.11115896", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "BEN1, a gene encoding a dihydroflavonol 4-reductase (DFR)-like protein, regulates the levels of brassinosteroids in Arabidopsis thaliana.", "journal": "The Plant journal : for cell and molecular biology", "date": "2007-07", "authors": "Yuan Tong, Fujioka Shozo, Takatsuto Suguru, Matsumoto Shogo, Gou Xiaoping, He Kai, Russell Scott D, Li Jia", "reference": { "type": "PubMed", "id": "17521414", "url": "https://pubmed.ncbi.nlm.nih.gov/17521414" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O22133-1", "protein_name": "Protein BRI1-5 ENHANCED 1", "gene_name": "BEN1", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "O22133", "url": "https://www.uniprot.org/uniprotkb/O22133" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.17521414", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The ben1-1 brassinosteroid-catabolism mutation is unstable due to epigenetic modifications of the intronic T-DNA insertion.", "journal": "G3 (Bethesda, Md.)", "date": "2013-09-04", "authors": "Sandhu Kulbir Singh, Koirala Pushpa Sharma, Neff Michael M", "reference": { "type": "PubMed", "id": "23893742", "url": "https://pubmed.ncbi.nlm.nih.gov/23893742" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O22133-1", "protein_name": "Protein BRI1-5 ENHANCED 1", "gene_name": "BEN1", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "O22133", "url": "https://www.uniprot.org/uniprotkb/O22133" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.23893742", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Analysis of sequence, map position, and gene expression reveals conserved essential genes for iron uptake in Arabidopsis and tomato.", "journal": "Plant Physiol.", "date": "2004", "authors": "Bauer Petra, Thiel Thomas, Klatte Marco, Bereczky Zsolt, Brumbarova Tzvetina, Hell R\u00fcdiger, Grosse Ivo", "reference": { "type": "PubMed", "id": "15531708", "url": "https://pubmed.ncbi.nlm.nih.gov/15531708" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q0V7X4-1", "protein_name": "Transcription factor FER-LIKE IRON DEFICIENCY-INDUCED TRANSCRIPTION FACTOR", "gene_name": "FIT", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "Q0V7X4", "url": "https://www.uniprot.org/uniprotkb/Q0V7X4" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.15531708", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "FRU (BHLH029) is required for induction of iron mobilization genes in Arabidopsis thaliana.", "journal": "FEBS letters", "date": "2004-11-19", "authors": "Jakoby Marc, Wang Hong-Yu, Reidt Wim, Weisshaar Bernd, Bauer Petra", "reference": { "type": "PubMed", "id": "15556641", "url": "https://pubmed.ncbi.nlm.nih.gov/15556641" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q0V7X4-1", "protein_name": "Transcription factor FER-LIKE IRON DEFICIENCY-INDUCED TRANSCRIPTION FACTOR", "gene_name": "FIT", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "Q0V7X4", "url": "https://www.uniprot.org/uniprotkb/Q0V7X4" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.15556641", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "AtbHLH29 of Arabidopsis thaliana is a functional ortholog of tomato FER involved in controlling iron acquisition in strategy I plants.", "journal": "Cell research", "date": "2005-08", "authors": "Yuan You Xi, Zhang Juan, Wang Dao Wen, Ling Hong Qing", "reference": { "type": "PubMed", "id": "16117851", "url": "https://pubmed.ncbi.nlm.nih.gov/16117851" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q0V7X4-1", "protein_name": "Transcription factor FER-LIKE IRON DEFICIENCY-INDUCED TRANSCRIPTION FACTOR", "gene_name": "FIT", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "Q0V7X4", "url": "https://www.uniprot.org/uniprotkb/Q0V7X4" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.16117851", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "FIT, the FER-LIKE IRON DEFICIENCY INDUCED TRANSCRIPTION FACTOR in Arabidopsis.", "journal": "Plant Physiol. Biochem.", "date": "2007", "authors": "Bauer Petra, Ling Hong-Qing, Guerinot Mary Lou", "reference": { "type": "PubMed", "id": "17466530", "url": "https://pubmed.ncbi.nlm.nih.gov/17466530" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q0V7X4-1", "protein_name": "Transcription factor FER-LIKE IRON DEFICIENCY-INDUCED TRANSCRIPTION FACTOR", "gene_name": "FIT", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "Q0V7X4", "url": "https://www.uniprot.org/uniprotkb/Q0V7X4" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.17466530", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Molecular cloning and sequence of cDNA encoding the plasma membrane proton pump (H+-ATPase) of Arabidopsis thaliana.", "journal": "Proc. Natl. Acad. Sci. U.S.A.", "date": "1989", "authors": "Harper J F, Surowy T K, Sussman M R", "reference": { "type": "PubMed", "id": "2521951", "url": "https://pubmed.ncbi.nlm.nih.gov/2521951" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P20649-1", "protein_name": "ATPase 1, plasma membrane-type", "gene_name": "AHA1; HA1", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "P20649", "url": "https://www.uniprot.org/uniprotkb/P20649" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.2521951", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Nuclear and chloroplast poly(A) polymerases from plants share a novel biochemical property.", "journal": "Biochemical and biophysical research communications", "date": "2000-05-27", "authors": "Hunt A G, Meeks L R, Forbes K P, Das Gupta J, Mogen B D", "reference": { "type": "PubMed", "id": "10872823", "url": "https://pubmed.ncbi.nlm.nih.gov/10872823" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O82312-1", "protein_name": "Nuclear poly(A) polymerase 2", "gene_name": "PAPS2", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "O82312", "url": "https://www.uniprot.org/uniprotkb/O82312" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.10872823", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Regulation of plant growth by cytokinin.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2001-08-28", "authors": "Werner T, Motyka V, Strnad M, Schm\u00fclling T", "reference": { "type": "PubMed", "id": "11504909", "url": "https://pubmed.ncbi.nlm.nih.gov/11504909" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O22213-1", "protein_name": "Cytokinin dehydrogenase 1", "gene_name": "CKX1", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "O22213", "url": "https://www.uniprot.org/uniprotkb/O22213" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.11504909", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Jasmonate inhibits adventitious root initiation through repression of CKX1 and activation of RAP2.6L transcription factor in Arabidopsis.", "journal": "Journal of experimental botany", "date": "2021-10-26", "authors": "Dob Asma, Lakehal Abdellah, Novak Ondrej, Bellini Catherine", "reference": { "type": "PubMed", "id": "34329421", "url": "https://pubmed.ncbi.nlm.nih.gov/34329421" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O22213-1", "protein_name": "Cytokinin dehydrogenase 1", "gene_name": "CKX1", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "O22213", "url": "https://www.uniprot.org/uniprotkb/O22213" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.34329421", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Cytokinin regulates female gametophyte development by cell cycle modulation in Arabidopsis thaliana.", "journal": "Plant science : an international journal of experimental plant biology", "date": "2022-11", "authors": "Zhang Jinghua, Pai Qiaofeng, Yue Ling, Wu Xiaolin, Liu Hui, Wang Wei", "reference": { "type": "PubMed", "id": "35995110", "url": "https://pubmed.ncbi.nlm.nih.gov/35995110" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O22213-1", "protein_name": "Cytokinin dehydrogenase 1", "gene_name": "CKX1", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "O22213", "url": "https://www.uniprot.org/uniprotkb/O22213" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.35995110", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The critical role of Arabidopsis electron-transfer flavoprotein:ubiquinone oxidoreductase during dark-induced starvation.", "journal": "The Plant cell", "date": "2005-09", "authors": "Ishizaki Kimitsune, Larson Tony R, Schauer Nicolas, Fernie Alisdair R, Graham Ian A, Leaver Christopher J", "reference": { "type": "PubMed", "id": "16055629", "url": "https://pubmed.ncbi.nlm.nih.gov/16055629" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O22854-1", "protein_name": "Electron transfer flavoprotein-ubiquinone oxidoreductase, mitochondrial", "gene_name": "ETFQO", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "O22854", "url": "https://www.uniprot.org/uniprotkb/O22854" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.16055629", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Genetic analysis of incurvata mutants reveals three independent genetic operations at work in Arabidopsis leaf morphogenesis.", "journal": "Genetics", "date": "2000-11", "authors": "Serrano-Cartagena J, Candela H, Robles P, Ponce M R, P\u00e9rez-P\u00e9rez J M, Piqueras P, Micol J L", "reference": { "type": "PubMed", "id": "11063708", "url": "https://pubmed.ncbi.nlm.nih.gov/11063708" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P93831-1", "protein_name": "Histone-lysine N-methyltransferase CLF", "gene_name": "CLF", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "P93831", "url": "https://www.uniprot.org/uniprotkb/P93831" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.11063708", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "A Polycomb-group gene regulates homeotic gene expression in Arabidopsis.", "journal": "Nature", "date": "1997-03-06", "authors": "Goodrich J, Puangsomlee P, Martin M, Long D, Meyerowitz E M, Coupland G", "reference": { "type": "PubMed", "id": "9052779", "url": "https://pubmed.ncbi.nlm.nih.gov/9052779" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P93831-1", "protein_name": "Histone-lysine N-methyltransferase CLF", "gene_name": "CLF", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "P93831", "url": "https://www.uniprot.org/uniprotkb/P93831" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.9052779", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Arabidopsis CER8 encodes LONG-CHAIN ACYL-COA SYNTHETASE 1 (LACS1) that has overlapping functions with LACS2 in plant wax and cutin synthesis.", "journal": "The Plant journal : for cell and molecular biology", "date": "2009-08", "authors": "L\u00fc Shiyou, Song Tao, Kosma Dylan K, Parsons Eugene P, Rowland Owen, Jenks Matthew A", "reference": { "type": "PubMed", "id": "19392700", "url": "https://pubmed.ncbi.nlm.nih.gov/19392700" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O22898-1", "protein_name": "Long chain acyl-CoA synthetase 1", "gene_name": "LACS1", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9XIA9-1", "protein_name": "Long chain acyl-CoA synthetase 2", "gene_name": "LACS2", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "O22898", "url": "https://www.uniprot.org/uniprotkb/O22898" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.19392700", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Organ fusion and defective cuticle function in a lacs1 lacs2 double mutant of Arabidopsis.", "journal": "Planta", "date": "2010-04", "authors": "Weng Hua, Molina Isabel, Shockey Jay, Browse John", "reference": { "type": "PubMed", "id": "20237894", "url": "https://pubmed.ncbi.nlm.nih.gov/20237894" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O22898-1", "protein_name": "Long chain acyl-CoA synthetase 1", "gene_name": "LACS1", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9XIA9-1", "protein_name": "Long chain acyl-CoA synthetase 2", "gene_name": "LACS2", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "O22898", "url": "https://www.uniprot.org/uniprotkb/O22898" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.20237894", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Discrete domains mediate the light-responsive nuclear and cytoplasmic localization of Arabidopsis COP1.", "journal": "The Plant cell", "date": "1999-03", "authors": "Stacey M G, Hicks S N, von Arnim A G", "reference": { "type": "PubMed", "id": "10072396", "url": "https://pubmed.ncbi.nlm.nih.gov/10072396" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P43254-1", "protein_name": "E3 ubiquitin-protein ligase COP1", "gene_name": "COP1", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "P43254", "url": "https://www.uniprot.org/uniprotkb/P43254" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "mutagenesis": [ { "start_pos": 294, "end_pos": 296, "sequence_org": "RKK", "sequence_mut": "SKT", "comment": "Abolishes localization to the nucleus.", "evidence": [ { "database": "UniProtKB", "id": "P43254", "url": "https://www.uniprot.org/uniprotkb/P43254" }, { "database": "PubMed", "id": "10072396", "url": "https://pubmed.ncbi.nlm.nih.gov/10072396" } ], "uniprot_canonical_ac": "P43254-1" }, { "start_pos": 312, "end_pos": 314, "sequence_org": "KRR", "sequence_mut": "TRS", "comment": "Abolishes localization to the nucleus.", "evidence": [ { "database": "UniProtKB", "id": "P43254", "url": "https://www.uniprot.org/uniprotkb/P43254" }, { "database": "PubMed", "id": "10072396", "url": "https://pubmed.ncbi.nlm.nih.gov/10072396" } ], "uniprot_canonical_ac": "P43254-1" } ], "record_id": "pubmed.10072396", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "A novel motif mediates the targeting of the Arabidopsis COP1 protein to subnuclear foci.", "journal": "J. Biol. Chem.", "date": "1999", "authors": "Stacey M G, von Arnim A G", "reference": { "type": "PubMed", "id": "10480941", "url": "https://pubmed.ncbi.nlm.nih.gov/10480941" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P43254-1", "protein_name": "E3 ubiquitin-protein ligase COP1", "gene_name": "COP1", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "P43254", "url": "https://www.uniprot.org/uniprotkb/P43254" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.10480941", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "COP1, an Arabidopsis regulatory gene, encodes a protein with both a zinc-binding motif and a G beta homologous domain.", "journal": "Cell", "date": "1992", "authors": "Deng X W, Matsui M, Wei N, Wagner D, Chu A M, Feldmann K A, Quail P H", "reference": { "type": "PubMed", "id": "1423630", "url": "https://pubmed.ncbi.nlm.nih.gov/1423630" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P43254-1", "protein_name": "E3 ubiquitin-protein ligase COP1", "gene_name": "COP1", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "P43254", "url": "https://www.uniprot.org/uniprotkb/P43254" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.1423630", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Genetic and molecular analysis of an allelic series of cop1 mutants suggests functional roles for the multiple protein domains.", "journal": "Plant Cell", "date": "1994", "authors": "McNellis T W, von Arnim A G, Araki T, Komeda Y, Mis\u00e9ra S, Deng X W", "reference": { "type": "PubMed", "id": "8205001", "url": "https://pubmed.ncbi.nlm.nih.gov/8205001" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P43254-1", "protein_name": "E3 ubiquitin-protein ligase COP1", "gene_name": "COP1", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "P43254", "url": "https://www.uniprot.org/uniprotkb/P43254" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.8205001", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Characterisation of exon skipping mutants of the COP1 gene from Arabidopsis.", "journal": "Plant J.", "date": "1998", "authors": "Simpson C G, McQuade C, Lyon J, Brown J W", "reference": { "type": "PubMed", "id": "9744100", "url": "https://pubmed.ncbi.nlm.nih.gov/9744100" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P43254-1", "protein_name": "E3 ubiquitin-protein ligase COP1", "gene_name": "COP1", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "P43254", "url": "https://www.uniprot.org/uniprotkb/P43254" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.9744100", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Functional dissection of Arabidopsis COP1 reveals specific roles of its three structural modules in light control of seedling development.", "journal": "EMBO J.", "date": "1998", "authors": "Torii K U, McNellis T W, Deng X W", "reference": { "type": "PubMed", "id": "9755158", "url": "https://pubmed.ncbi.nlm.nih.gov/9755158" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P43254-1", "protein_name": "E3 ubiquitin-protein ligase COP1", "gene_name": "COP1", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "P43254", "url": "https://www.uniprot.org/uniprotkb/P43254" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.9755158", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "An importin alpha homolog, MOS6, plays an important role in plant innate immunity.", "journal": "Current biology : CB", "date": "2005-06-21", "authors": "Palma Kristoffer, Zhang Yuelin, Li Xin", "reference": { "type": "PubMed", "id": "15964279", "url": "https://pubmed.ncbi.nlm.nih.gov/15964279" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O04294-1", "protein_name": "Importin subunit alpha-3", "gene_name": "IMPA3; MOS6", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "O04294", "url": "https://www.uniprot.org/uniprotkb/O04294" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.15964279", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "HUA1 and HUA2 are two members of the floral homeotic AGAMOUS pathway.", "journal": "Mol. Cell", "date": "1999", "authors": "Chen X, Meyerowitz E M", "reference": { "type": "PubMed", "id": "10198637", "url": "https://pubmed.ncbi.nlm.nih.gov/10198637" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P17839-1", "protein_name": "Floral homeotic protein AGAMOUS", "gene_name": "AG", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9XER9-1", "protein_name": "ENHANCER OF AG-4 protein 2", "gene_name": "HUA2", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "P17839", "url": "https://www.uniprot.org/uniprotkb/P17839" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.10198637", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The protein encoded by the Arabidopsis homeotic gene agamous resembles transcription factors.", "journal": "Nature", "date": "1990", "authors": "Yanofsky M F, Ma H, Bowman J L, Drews G N, Feldmann K A, Meyerowitz E M", "reference": { "type": "PubMed", "id": "1973265", "url": "https://pubmed.ncbi.nlm.nih.gov/1973265" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P17839-1", "protein_name": "Floral homeotic protein AGAMOUS", "gene_name": "AG", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "P17839", "url": "https://www.uniprot.org/uniprotkb/P17839" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.1973265", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The ABCs of floral homeotic genes.", "journal": "Cell", "date": "1994", "authors": "Weigel D, Meyerowitz E M", "reference": { "type": "PubMed", "id": "7913881", "url": "https://pubmed.ncbi.nlm.nih.gov/7913881" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P17839-1", "protein_name": "Floral homeotic protein AGAMOUS", "gene_name": "AG", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "P17839", "url": "https://www.uniprot.org/uniprotkb/P17839" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.7913881", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Mutations in LIKE HETEROCHROMATIN PROTEIN 1 affect flowering time and plant architecture in Arabidopsis.", "journal": "Development (Cambridge, England)", "date": "2001-12", "authors": "Gaudin V, Libault M, Pouteau S, Juul T, Zhao G, Lefebvre D, Grandjean O", "reference": { "type": "PubMed", "id": "11731464", "url": "https://pubmed.ncbi.nlm.nih.gov/11731464" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q946J8-1", "protein_name": "Chromo domain-containing protein LHP1", "gene_name": "LHP1; TFL2", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "Q946J8", "url": "https://www.uniprot.org/uniprotkb/Q946J8" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.11731464", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Arabidopsis TERMINAL FLOWER 2 gene encodes a heterochromatin protein 1 homolog and represses both FLOWERING LOCUS T to regulate flowering time and several floral homeotic genes.", "journal": "Plant & cell physiology", "date": "2003-06", "authors": "Kotake Toshihisa, Takada Shinobu, Nakahigashi Kenji, Ohto Masaaki, Goto Koji", "reference": { "type": "PubMed", "id": "12826620", "url": "https://pubmed.ncbi.nlm.nih.gov/12826620" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q946J8-1", "protein_name": "Chromo domain-containing protein LHP1", "gene_name": "LHP1; TFL2", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "Q946J8", "url": "https://www.uniprot.org/uniprotkb/Q946J8" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.12826620", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Characterization of the Arabidopsis TU8 glucosinolate mutation, an allele of TERMINAL FLOWER2.", "journal": "Plant molecular biology", "date": "2004-03", "authors": "Kim Jae Hak, Durrett Timothy P, Last Robert L, Jander Georg", "reference": { "type": "PubMed", "id": "15356387", "url": "https://pubmed.ncbi.nlm.nih.gov/15356387" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q946J8-1", "protein_name": "Chromo domain-containing protein LHP1", "gene_name": "LHP1; TFL2", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "Q946J8", "url": "https://www.uniprot.org/uniprotkb/Q946J8" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.15356387", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Molecular characterization of the tobacco SET domain protein NtSET1 unravels its role in histone methylation, chromatin binding, and segregation.", "journal": "Plant J.", "date": "2004", "authors": "Yu Yu, Dong Aiwu, Shen Wen-Hui", "reference": { "type": "PubMed", "id": "15546353", "url": "https://pubmed.ncbi.nlm.nih.gov/15546353" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q946J8-1", "protein_name": "Chromo domain-containing protein LHP1", "gene_name": "LHP1; TFL2", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "Q946J8", "url": "https://www.uniprot.org/uniprotkb/Q946J8" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.15546353", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The Arabidopsis LHP1 protein is a component of euchromatin.", "journal": "Planta", "date": "2005", "authors": "Libault Marc, Tessadori Federico, Germann Sophie, Snijder Berend, Fransz Paul, Gaudin Val\u00e9rie", "reference": { "type": "PubMed", "id": "16244868", "url": "https://pubmed.ncbi.nlm.nih.gov/16244868" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q946J8-1", "protein_name": "Chromo domain-containing protein LHP1", "gene_name": "LHP1; TFL2", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "Q946J8", "url": "https://www.uniprot.org/uniprotkb/Q946J8" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.16244868", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Different domains control the localization and mobility of LIKE HETEROCHROMATIN PROTEIN1 in Arabidopsis nuclei.", "journal": "The Plant cell", "date": "2006-01", "authors": "Zemach Assaf, Li Yan, Ben-Meir Hagit, Oliva Moran, Mosquna Assaf, Kiss Vladimir, Avivi Yigal, Ohad Nir, Grafi Gideon", "reference": { "type": "PubMed", "id": "16361394", "url": "https://pubmed.ncbi.nlm.nih.gov/16361394" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q946J8-1", "protein_name": "Chromo domain-containing protein LHP1", "gene_name": "LHP1; TFL2", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "Q946J8", "url": "https://www.uniprot.org/uniprotkb/Q946J8" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "mutagenesis": [ { "start_pos": 132, "end_pos": 132, "sequence_org": "W", "sequence_mut": "G", "comment": "Loss of interaction with 'K-9' of H3 and loss of chromocenter localization and punctuated distribution inside the nucleus.", "evidence": [ { "database": "UniProtKB", "id": "Q946J8", "url": "https://www.uniprot.org/uniprotkb/Q946J8" }, { "database": "PubMed", "id": "16361394", "url": "https://pubmed.ncbi.nlm.nih.gov/16361394" } ], "uniprot_canonical_ac": "Q946J8-1" } ], "record_id": "pubmed.16361394", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "LHP1, the Arabidopsis homologue of HETEROCHROMATIN PROTEIN1, is required for epigenetic silencing of FLC.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2006-03-28", "authors": "Mylne Joshua S, Barrett Lynne, Tessadori Federico, Mesnage St\u00e9phane, Johnson Lianna, Bernatavichute Yana V, Jacobsen Steven E, Fransz Paul, Dean Caroline", "reference": { "type": "PubMed", "id": "16549797", "url": "https://pubmed.ncbi.nlm.nih.gov/16549797" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q946J8-1", "protein_name": "Chromo domain-containing protein LHP1", "gene_name": "LHP1; TFL2", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "Q946J8", "url": "https://www.uniprot.org/uniprotkb/Q946J8" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.16549797", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Epigenetic maintenance of the vernalized state in Arabidopsis thaliana requires LIKE HETEROCHROMATIN PROTEIN 1.", "journal": "Nature genetics", "date": "2006-06", "authors": "Sung Sibum, He Yuehui, Eshoo Tifani W, Tamada Yosuke, Johnson Lianna, Nakahigashi Kenji, Goto Koji, Jacobsen Steve E, Amasino Richard M", "reference": { "type": "PubMed", "id": "16682972", "url": "https://pubmed.ncbi.nlm.nih.gov/16682972" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q946J8-1", "protein_name": "Chromo domain-containing protein LHP1", "gene_name": "LHP1; TFL2", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "Q946J8", "url": "https://www.uniprot.org/uniprotkb/Q946J8" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.16682972", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The TERMINAL FLOWER2 (TFL2) gene controls the reproductive transition and meristem identity in Arabidopsis thaliana.", "journal": "Genetics", "date": "1998-06", "authors": "Larsson A S, Landberg K, Meeks-Wagner D R", "reference": { "type": "PubMed", "id": "9611176", "url": "https://pubmed.ncbi.nlm.nih.gov/9611176" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q946J8-1", "protein_name": "Chromo domain-containing protein LHP1", "gene_name": "LHP1; TFL2", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "Q946J8", "url": "https://www.uniprot.org/uniprotkb/Q946J8" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.9611176", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Characterisation of a plant 3-phosphoinositide-dependent protein kinase-1 homologue which contains a pleckstrin homology domain.", "journal": "FEBS letters", "date": "1999-05-28", "authors": "Deak M, Casamayor A, Currie R A, Downes C P, Alessi D R", "reference": { "type": "PubMed", "id": "10371193", "url": "https://pubmed.ncbi.nlm.nih.gov/10371193" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9XF67-1", "protein_name": "3-phosphoinositide-dependent protein kinase 1", "gene_name": "PDK1; PDPK1", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "Q9XF67", "url": "https://www.uniprot.org/uniprotkb/Q9XF67" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.10371193", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Phosphoinositide-dependent kinase-1 orthologues from five eukaryotes are activated by the hydrophobic motif in AGC kinases.", "journal": "Biochem. Biophys. Res. Commun.", "date": "2004", "authors": "Silber Joachim, Antal Torben L, Gammeltoft Steen, Rasmussen Thomas E", "reference": { "type": "PubMed", "id": "15358101", "url": "https://pubmed.ncbi.nlm.nih.gov/15358101" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9XF67-1", "protein_name": "3-phosphoinositide-dependent protein kinase 1", "gene_name": "PDK1; PDPK1", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "Q9XF67", "url": "https://www.uniprot.org/uniprotkb/Q9XF67" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.15358101", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Function and regulation of the Arabidopsis floral homeotic gene PISTILLATA.", "journal": "Genes Dev.", "date": "1994", "authors": "Goto K, Meyerowitz E M", "reference": { "type": "PubMed", "id": "7958839", "url": "https://pubmed.ncbi.nlm.nih.gov/7958839" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P48007-1", "protein_name": "Floral homeotic protein PISTILLATA", "gene_name": "PI", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "P48007", "url": "https://www.uniprot.org/uniprotkb/P48007" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.7958839", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The Arabidopsis H3K27me3 demethylase JUMONJI 13 is a temperature and photoperiod dependent flowering repressor.", "journal": "Nature communications", "date": "2019-03-21", "authors": "Zheng Shuzhi, Hu Hongmiao, Ren Huimin, Yang Zhenlin, Qiu Qi, Qi Weiwei, Liu Xinye, Chen Xiaomei, Cui Xiekui, Li Sisi, Zhou Bing, Sun Daye, Cao Xiaofeng, Du Jiamu", "reference": { "type": "PubMed", "id": "30899015", "url": "https://pubmed.ncbi.nlm.nih.gov/30899015" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "F4KIX0-1", "protein_name": "Lysine-specific demethylase JMJ13", "gene_name": "JMJ13", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "F4KIX0", "url": "https://www.uniprot.org/uniprotkb/F4KIX0" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "mutagenesis": [ { "start_pos": 179, "end_pos": 179, "sequence_org": "F", "sequence_mut": "N", "comment": "Strongly reduced demethylase activity.", "evidence": [ { "database": "UniProtKB", "id": "F4KIX0", "url": "https://www.uniprot.org/uniprotkb/F4KIX0" }, { "database": "PubMed", "id": "30899015", "url": "https://pubmed.ncbi.nlm.nih.gov/30899015" } ], "uniprot_canonical_ac": "F4KIX0-1" }, { "start_pos": 179, "end_pos": 179, "sequence_org": "F", "sequence_mut": "S", "comment": "Slightly reduced demethylase activity.", "evidence": [ { "database": "UniProtKB", "id": "F4KIX0", "url": "https://www.uniprot.org/uniprotkb/F4KIX0" }, { "database": "PubMed", "id": "30899015", "url": "https://pubmed.ncbi.nlm.nih.gov/30899015" } ], "uniprot_canonical_ac": "F4KIX0-1" }, { "start_pos": 236, "end_pos": 236, "sequence_org": "D", "sequence_mut": "A", "comment": "Impaired demethylase activity.", "evidence": [ { "database": "UniProtKB", "id": "F4KIX0", "url": "https://www.uniprot.org/uniprotkb/F4KIX0" }, { "database": "PubMed", "id": "30899015", "url": "https://pubmed.ncbi.nlm.nih.gov/30899015" } ], "uniprot_canonical_ac": "F4KIX0-1" }, { "start_pos": 282, "end_pos": 282, "sequence_org": "Y", "sequence_mut": "A", "comment": "Impaired demethylase activity.", "evidence": [ { "database": "UniProtKB", "id": "F4KIX0", "url": "https://www.uniprot.org/uniprotkb/F4KIX0" }, { "database": "PubMed", "id": "30899015", "url": "https://pubmed.ncbi.nlm.nih.gov/30899015" } ], "uniprot_canonical_ac": "F4KIX0-1" }, { "start_pos": 295, "end_pos": 295, "sequence_org": "E", "sequence_mut": "A", "comment": "Impaired demethylase activity.", "evidence": [ { "database": "UniProtKB", "id": "F4KIX0", "url": "https://www.uniprot.org/uniprotkb/F4KIX0" }, { "database": "PubMed", "id": "30899015", "url": "https://pubmed.ncbi.nlm.nih.gov/30899015" } ], "uniprot_canonical_ac": "F4KIX0-1" }, { "start_pos": 296, "end_pos": 296, "sequence_org": "D", "sequence_mut": "A", "comment": "Impaired demethylase activity.", "evidence": [ { "database": "UniProtKB", "id": "F4KIX0", "url": "https://www.uniprot.org/uniprotkb/F4KIX0" }, { "database": "PubMed", "id": "30899015", "url": "https://pubmed.ncbi.nlm.nih.gov/30899015" } ], "uniprot_canonical_ac": "F4KIX0-1" }, { "start_pos": 388, "end_pos": 388, "sequence_org": "H", "sequence_mut": "A", "comment": "Impaired demethylase activity.", "evidence": [ { "database": "UniProtKB", "id": "F4KIX0", "url": "https://www.uniprot.org/uniprotkb/F4KIX0" }, { "database": "PubMed", "id": "30899015", "url": "https://pubmed.ncbi.nlm.nih.gov/30899015" } ], "uniprot_canonical_ac": "F4KIX0-1" }, { "start_pos": 402, "end_pos": 402, "sequence_org": "N", "sequence_mut": "A", "comment": "Impaired demethylase activity.", "evidence": [ { "database": "UniProtKB", "id": "F4KIX0", "url": "https://www.uniprot.org/uniprotkb/F4KIX0" }, { "database": "PubMed", "id": "30899015", "url": "https://pubmed.ncbi.nlm.nih.gov/30899015" } ], "uniprot_canonical_ac": "F4KIX0-1" } ], "record_id": "pubmed.30899015", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "BRASSINOSTEROID-SIGNALING KINASE1 Phosphorylates MAPKKK5 to Regulate Immunity in Arabidopsis.", "journal": "Plant physiology", "date": "2018-04", "authors": "Yan Haojie, Zhao Yaofei, Shi Hua, Li Juan, Wang Yingchun, Tang Dingzhong", "reference": { "type": "PubMed", "id": "29440595", "url": "https://pubmed.ncbi.nlm.nih.gov/29440595" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9C5H5-1", "protein_name": "Mitogen-activated protein kinase kinase kinase 5", "gene_name": "MAPKKK5", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "Q9C5H5", "url": "https://www.uniprot.org/uniprotkb/Q9C5H5" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "phosphorylation": [ { "start_pos": 289, "end_pos": 289, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q9C5H5", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9C5H5" }, { "database": "PubMed", "id": "25561503", "url": "https://pubmed.ncbi.nlm.nih.gov/25561503" }, { "database": "PubMed", "id": "29440595", "url": "https://pubmed.ncbi.nlm.nih.gov/29440595" } ], "site_lbl": "Ser289", "uniprot_canonical_ac": "Q9C5H5-1" } ], "record_id": "pubmed.29440595", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "An O-acetylserine(thiol)lyase homolog with L-cysteine desulfhydrase activity regulates cysteine homeostasis in Arabidopsis.", "journal": "Plant physiology", "date": "2010-02", "authors": "Alvarez Consolaci\u00f3n, Calo Leticia, Romero Luis C, Garc\u00eda Irene, Gotor Cecilia", "reference": { "type": "PubMed", "id": "19955263", "url": "https://pubmed.ncbi.nlm.nih.gov/19955263" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "F4K5T2-1", "protein_name": "Bifunctional cystathionine gamma-lyase/cysteine synthase", "gene_name": "DES1", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "F4K5T2", "url": "https://www.uniprot.org/uniprotkb/F4K5T2" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.19955263", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Cysteine homeostasis plays an essential role in plant immunity.", "journal": "New Phytol.", "date": "2012", "authors": "\u00c1lvarez Consolaci\u00f3n, \u00c1ngeles Berm\u00fadez M, Romero Luis C, Gotor Cecilia, Garc\u00eda Irene", "reference": { "type": "PubMed", "id": "21988475", "url": "https://pubmed.ncbi.nlm.nih.gov/21988475" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "F4K5T2-1", "protein_name": "Bifunctional cystathionine gamma-lyase/cysteine synthase", "gene_name": "DES1", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "F4K5T2", "url": "https://www.uniprot.org/uniprotkb/F4K5T2" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.21988475", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "L-Cysteine Desulfhydrase 1 modulates the generation of the signaling molecule sulfide in plant cytosol.", "journal": "Plant signaling & behavior", "date": "2013-05", "authors": "Romero Luis C, Garc\u00eda Irene, Gotor Cecilia", "reference": { "type": "PubMed", "id": "23428891", "url": "https://pubmed.ncbi.nlm.nih.gov/23428891" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "F4K5T2-1", "protein_name": "Bifunctional cystathionine gamma-lyase/cysteine synthase", "gene_name": "DES1", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "F4K5T2", "url": "https://www.uniprot.org/uniprotkb/F4K5T2" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.23428891", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "SET DOMAIN GROUP25 encodes a histone methyltransferase and is involved in FLOWERING LOCUS C activation and repression of flowering.", "journal": "Plant physiology", "date": "2009-11", "authors": "Berr Alexandre, Xu Lin, Gao Juan, Cognat Val\u00e9rie, Steinmetz Andre, Dong Aiwu, Shen Wen-Hui", "reference": { "type": "PubMed", "id": "19726574", "url": "https://pubmed.ncbi.nlm.nih.gov/19726574" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "F4K1J4-1", "protein_name": "Histone-lysine N-methyltransferase ATXR7", "gene_name": "ATXR7; SDG25", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "F4K1J4", "url": "https://www.uniprot.org/uniprotkb/F4K1J4" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.19726574", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "ARABIDOPSIS TRITHORAX-RELATED7 is required for methylation of lysine 4 of histone H3 and for transcriptional activation of FLOWERING LOCUS C.", "journal": "The Plant cell", "date": "2009-10", "authors": "Tamada Yosuke, Yun Jae-Young, Woo Seung Chul, Amasino Richard M", "reference": { "type": "PubMed", "id": "19855050", "url": "https://pubmed.ncbi.nlm.nih.gov/19855050" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "F4K1J4-1", "protein_name": "Histone-lysine N-methyltransferase ATXR7", "gene_name": "ATXR7; SDG25", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "F4K1J4", "url": "https://www.uniprot.org/uniprotkb/F4K1J4" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.19855050", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The calcium sensor calcineurin B-like 9 modulates abscisic acid sensitivity and biosynthesis in Arabidopsis.", "journal": "The Plant cell", "date": "2004-07", "authors": "Pandey Girdhar K, Cheong Yong Hwa, Kim Kyung-Nam, Grant John J, Li Legong, Hung Wendy, D'Angelo Cecilia, Weinl Stefan, Kudla J\u00f6rg, Luan Sheng", "reference": { "type": "PubMed", "id": "15208400", "url": "https://pubmed.ncbi.nlm.nih.gov/15208400" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9LTB8-1", "protein_name": "Calcineurin B-like protein 9", "gene_name": "CBL9", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "Q9LTB8", "url": "https://www.uniprot.org/uniprotkb/Q9LTB8" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.15208400", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The Arabidopsis dwarf mutant shi exhibits reduced gibberellin responses conferred by overexpression of a new putative zinc finger protein.", "journal": "The Plant cell", "date": "1999-06", "authors": "Fridborg I, Kuusk S, Moritz T, Sundberg E", "reference": { "type": "PubMed", "id": "10368174", "url": "https://pubmed.ncbi.nlm.nih.gov/10368174" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9XGX0-1", "protein_name": "Protein SHORT INTERNODES", "gene_name": "SHI", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "Q9XGX0", "url": "https://www.uniprot.org/uniprotkb/Q9XGX0" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.10368174", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The Arabidopsis protein SHI represses gibberellin responses in Arabidopsis and barley.", "journal": "Plant physiology", "date": "2001-11", "authors": "Fridborg I, Kuusk S, Robertson M, Sundberg E", "reference": { "type": "PubMed", "id": "11706176", "url": "https://pubmed.ncbi.nlm.nih.gov/11706176" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9XGX0-1", "protein_name": "Protein SHORT INTERNODES", "gene_name": "SHI", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "Q9XGX0", "url": "https://www.uniprot.org/uniprotkb/Q9XGX0" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.11706176", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Global expression analysis of nucleotide binding site-leucine rich repeat-encoding and related genes in Arabidopsis.", "journal": "BMC Plant Biol.", "date": "2007", "authors": "Tan Xiaoping, Meyers Blake C, Kozik Alexander, West Marilyn A L, Morgante Michele, St Clair Dina A, Bent Andrew F, Michelmore Richard W", "reference": { "type": "PubMed", "id": "17956627", "url": "https://pubmed.ncbi.nlm.nih.gov/17956627" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "F4KHI3-1", "protein_name": "Protein VARIATION IN COMPOUND TRIGGERED ROOT growth response", "gene_name": "VICTR", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "F4KHI3", "url": "https://www.uniprot.org/uniprotkb/F4KHI3" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.17956627", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Arabidopsis thaliana myosin XIK is involved in root hair as well as trichome morphogenesis on stems and leaves.", "journal": "Protoplasma", "date": "2007", "authors": "Ojangu E-L, J\u00e4rve K, Paves H, Truve E", "reference": { "type": "PubMed", "id": "17458634", "url": "https://pubmed.ncbi.nlm.nih.gov/17458634" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "F4K5J1-1", "protein_name": "Myosin-17", "gene_name": "XI-K; XIK", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "F4K5J1", "url": "https://www.uniprot.org/uniprotkb/F4K5J1" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.17458634", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Myosin-dependent endoplasmic reticulum motility and F-actin organization in plant cells.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2010-04-13", "authors": "Ueda Haruko, Yokota Etsuo, Kutsuna Natsumaro, Shimada Tomoo, Tamura Kentaro, Shimmen Teruo, Hasezawa Seiichiro, Dolja Valerian V, Hara-Nishimura Ikuko", "reference": { "type": "PubMed", "id": "20351265", "url": "https://pubmed.ncbi.nlm.nih.gov/20351265" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "F4K5J1-1", "protein_name": "Myosin-17", "gene_name": "XI-K; XIK", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "F4K5J1", "url": "https://www.uniprot.org/uniprotkb/F4K5J1" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.20351265", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Arabidopsis Myosin XI-K localizes to the motile endomembrane vesicles associated with F-actin.", "journal": "Front. Plant Sci.", "date": "2012", "authors": "Peremyslov Valera V, Klocko Amy L, Fowler John E, Dolja Valerian V", "reference": { "type": "PubMed", "id": "22969781", "url": "https://pubmed.ncbi.nlm.nih.gov/22969781" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "F4K5J1-1", "protein_name": "Myosin-17", "gene_name": "XI-K; XIK", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "F4K5J1", "url": "https://www.uniprot.org/uniprotkb/F4K5J1" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.22969781", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "LEAFY controls floral meristem identity in Arabidopsis.", "journal": "Cell", "date": "1992", "authors": "Weigel D, Alvarez J, Smyth D R, Yanofsky M F, Meyerowitz E M", "reference": { "type": "PubMed", "id": "1350515", "url": "https://pubmed.ncbi.nlm.nih.gov/1350515" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q00958-1", "protein_name": "Protein LEAFY", "gene_name": "LFY", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "Q00958", "url": "https://www.uniprot.org/uniprotkb/Q00958" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.1350515", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Structural basis for LEAFY floral switch function and similarity with helix-turn-helix proteins.", "journal": "The EMBO journal", "date": "2008-10-08", "authors": "Ham\u00e8s C\u00e9cile, Ptchelkine Denis, Grimm Clemens, Thevenon Emmanuel, Moyroud Edwige, G\u00e9rard Francine, Martiel Jean-Louis, Benlloch Reyes, Parcy Fran\u00e7ois, M\u00fcller Christoph W", "reference": { "type": "PubMed", "id": "18784751", "url": "https://pubmed.ncbi.nlm.nih.gov/18784751" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q00958-1", "protein_name": "Protein LEAFY", "gene_name": "LFY", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "Q00958", "url": "https://www.uniprot.org/uniprotkb/Q00958" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "mutagenesis": [ { "start_pos": 233, "end_pos": 233, "sequence_org": "R", "sequence_mut": "A", "comment": "Impaired DNA-binding.", "evidence": [ { "database": "UniProtKB", "id": "Q00958", "url": "https://www.uniprot.org/uniprotkb/Q00958" }, { "database": "PubMed", "id": "18784751", "url": "https://pubmed.ncbi.nlm.nih.gov/18784751" } ], "uniprot_canonical_ac": "Q00958-1" }, { "start_pos": 234, "end_pos": 234, "sequence_org": "E", "sequence_mut": "K", "comment": "In lfy-4; decreased in vitro DNA-binding affinities and leafy phenotype.", "evidence": [ { "database": "UniProtKB", "id": "Q00958", "url": "https://www.uniprot.org/uniprotkb/Q00958" }, { "database": "PubMed", "id": "18784751", "url": "https://pubmed.ncbi.nlm.nih.gov/18784751" } ], "uniprot_canonical_ac": "Q00958-1" }, { "start_pos": 236, "end_pos": 236, "sequence_org": "P", "sequence_mut": "L", "comment": "In lfy-5; decreased in vitro DNA-binding affinities and leafy phenotype.", "evidence": [ { "database": "UniProtKB", "id": "Q00958", "url": "https://www.uniprot.org/uniprotkb/Q00958" }, { "database": "PubMed", "id": "18784751", "url": "https://pubmed.ncbi.nlm.nih.gov/18784751" } ], "uniprot_canonical_ac": "Q00958-1" }, { "start_pos": 240, "end_pos": 240, "sequence_org": "T", "sequence_mut": "M", "comment": "In lfy-3; leafy phenotype.", "evidence": [ { "database": "UniProtKB", "id": "Q00958", "url": "https://www.uniprot.org/uniprotkb/Q00958" }, { "database": "PubMed", "id": "18784751", "url": "https://pubmed.ncbi.nlm.nih.gov/18784751" } ], "uniprot_canonical_ac": "Q00958-1" }, { "start_pos": 287, "end_pos": 287, "sequence_org": "N", "sequence_mut": "A", "comment": "Impaired DNA-binding.", "evidence": [ { "database": "UniProtKB", "id": "Q00958", "url": "https://www.uniprot.org/uniprotkb/Q00958" }, { "database": "PubMed", "id": "18784751", "url": "https://pubmed.ncbi.nlm.nih.gov/18784751" } ], "uniprot_canonical_ac": "Q00958-1" }, { "start_pos": 302, "end_pos": 302, "sequence_org": "N", "sequence_mut": "D", "comment": "In lfy-20; reduced DNA-binding affinity with a weak leafy phenotype.", "evidence": [ { "database": "UniProtKB", "id": "Q00958", "url": "https://www.uniprot.org/uniprotkb/Q00958" }, { "database": "PubMed", "id": "18784751", "url": "https://pubmed.ncbi.nlm.nih.gov/18784751" } ], "uniprot_canonical_ac": "Q00958-1" }, { "start_pos": 303, "end_pos": 303, "sequence_org": "K", "sequence_mut": "A", "comment": "Impaired DNA-binding.", "evidence": [ { "database": "UniProtKB", "id": "Q00958", "url": "https://www.uniprot.org/uniprotkb/Q00958" }, { "database": "PubMed", "id": "18784751", "url": "https://pubmed.ncbi.nlm.nih.gov/18784751" } ], "uniprot_canonical_ac": "Q00958-1" }, { "start_pos": 304, "end_pos": 304, "sequence_org": "P", "sequence_mut": "L", "comment": "In lfy-28; impaired DNA-binding and strong leafy phenotype.", "evidence": [ { "database": "UniProtKB", "id": "Q00958", "url": "https://www.uniprot.org/uniprotkb/Q00958" }, { "database": "PubMed", "id": "18784751", "url": "https://pubmed.ncbi.nlm.nih.gov/18784751" } ], "uniprot_canonical_ac": "Q00958-1" }, { "start_pos": 327, "end_pos": 327, "sequence_org": "R", "sequence_mut": "K", "comment": "In lfy-9; leafy phenotype.", "evidence": [ { "database": "UniProtKB", "id": "Q00958", "url": "https://www.uniprot.org/uniprotkb/Q00958" }, { "database": "PubMed", "id": "18784751", "url": "https://pubmed.ncbi.nlm.nih.gov/18784751" } ], "uniprot_canonical_ac": "Q00958-1" } ], "record_id": "pubmed.18784751", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Arabidopsis CaM binding protein CBP60g contributes to MAMP-induced SA accumulation and is involved in disease resistance against Pseudomonas syringae.", "journal": "PLoS pathogens", "date": "2009-02", "authors": "Wang Lin, Tsuda Kenichi, Sato Masanao, Cohen Jerry D, Katagiri Fumiaki, Glazebrook Jane", "reference": { "type": "PubMed", "id": "19214217", "url": "https://pubmed.ncbi.nlm.nih.gov/19214217" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "F4K2R6-1", "protein_name": "Calmodulin-binding protein 60 G", "gene_name": "CBP60G", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "F4K2R6", "url": "https://www.uniprot.org/uniprotkb/F4K2R6" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "mutagenesis": [ { "start_pos": 25, "end_pos": 25, "sequence_org": "F", "sequence_mut": "K", "comment": "Impaired calmodulin-binding.", "evidence": [ { "database": "UniProtKB", "id": "F4K2R6", "url": "https://www.uniprot.org/uniprotkb/F4K2R6" }, { "database": "PubMed", "id": "19214217", "url": "https://pubmed.ncbi.nlm.nih.gov/19214217" } ], "uniprot_canonical_ac": "F4K2R6-1" }, { "start_pos": 28, "end_pos": 28, "sequence_org": "V", "sequence_mut": "K", "comment": "Impaired calmodulin-binding and reduced resistance to Pseudomonas syringae associated with loss of salicylic acid (SA) accumulation.", "evidence": [ { "database": "UniProtKB", "id": "F4K2R6", "url": "https://www.uniprot.org/uniprotkb/F4K2R6" }, { "database": "PubMed", "id": "19214217", "url": "https://pubmed.ncbi.nlm.nih.gov/19214217" } ], "uniprot_canonical_ac": "F4K2R6-1" }, { "start_pos": 29, "end_pos": 29, "sequence_org": "V", "sequence_mut": "R", "comment": "Impaired calmodulin-binding and reduced resistance to Pseudomonas syringae associated with loss of salicylic acid (SA) accumulation.", "evidence": [ { "database": "UniProtKB", "id": "F4K2R6", "url": "https://www.uniprot.org/uniprotkb/F4K2R6" }, { "database": "PubMed", "id": "19214217", "url": "https://pubmed.ncbi.nlm.nih.gov/19214217" } ], "uniprot_canonical_ac": "F4K2R6-1" }, { "start_pos": 32, "end_pos": 32, "sequence_org": "V", "sequence_mut": "K", "comment": "Impaired calmodulin-binding.", "evidence": [ { "database": "UniProtKB", "id": "F4K2R6", "url": "https://www.uniprot.org/uniprotkb/F4K2R6" }, { "database": "PubMed", "id": "19214217", "url": "https://pubmed.ncbi.nlm.nih.gov/19214217" } ], "uniprot_canonical_ac": "F4K2R6-1" } ], "record_id": "pubmed.19214217", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Calmodulin-binding protein CBP60g is a positive regulator of both disease resistance and drought tolerance in Arabidopsis.", "journal": "Plant cell reports", "date": "2012-07", "authors": "Wan Dongli, Li Ruili, Zou Bo, Zhang Xin, Cong Jingyu, Wang Ruigang, Xia Yiji, Li Guojing", "reference": { "type": "PubMed", "id": "22466450", "url": "https://pubmed.ncbi.nlm.nih.gov/22466450" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "F4K2R6-1", "protein_name": "Calmodulin-binding protein 60 G", "gene_name": "CBP60G", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "F4K2R6", "url": "https://www.uniprot.org/uniprotkb/F4K2R6" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.22466450", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The sensitivity of ABI2 to hydrogen peroxide links the abscisic acid-response regulator to redox signalling.", "journal": "Planta", "date": "2002", "authors": "Meinhard Michael, Rodriguez Pedro L, Grill Erwin", "reference": { "type": "PubMed", "id": "11882947", "url": "https://pubmed.ncbi.nlm.nih.gov/11882947" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O04719-1", "protein_name": "Protein phosphatase 2C 77", "gene_name": "ABI2", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "O04719", "url": "https://www.uniprot.org/uniprotkb/O04719" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.11882947", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Hypersensitivity of abscisic acid-induced cytosolic calcium increases in the Arabidopsis farnesyltransferase mutant era1-2.", "journal": "The Plant cell", "date": "2002-07", "authors": "Allen Gethyn J, Murata Yoshiyuki, Chu Sarah P, Nafisi Majse, Schroeder Julian I", "reference": { "type": "PubMed", "id": "12119381", "url": "https://pubmed.ncbi.nlm.nih.gov/12119381" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O04719-1", "protein_name": "Protein phosphatase 2C 77", "gene_name": "ABI2", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "O04719", "url": "https://www.uniprot.org/uniprotkb/O04719" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.12119381", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "A novel domain in the protein kinase SOS2 mediates interaction with the protein phosphatase 2C ABI2.", "journal": "Proc. Natl. Acad. Sci. U.S.A.", "date": "2003", "authors": "Ohta Masaru, Guo Yan, Halfter Ursula, Zhu Jian-Kang", "reference": { "type": "PubMed", "id": "14504388", "url": "https://pubmed.ncbi.nlm.nih.gov/14504388" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O04719-1", "protein_name": "Protein phosphatase 2C 77", "gene_name": "ABI2", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9LDI3-1", "protein_name": "CBL-interacting serine/threonine-protein kinase 24", "gene_name": "CIPK24; SOS2", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "O04719", "url": "https://www.uniprot.org/uniprotkb/O04719" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.14504388", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The ABI2-dependent abscisic acid signalling controls HrpN-induced drought tolerance in Arabidopsis.", "journal": "Planta", "date": "2005-06", "authors": "Dong Hong-Ping, Yu Haiqin, Bao Zhilong, Guo Xiaojing, Peng Jianling, Yao Zhen, Chen Guangyong, Qu Shuping, Dong Hansong", "reference": { "type": "PubMed", "id": "15599761", "url": "https://pubmed.ncbi.nlm.nih.gov/15599761" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O04719-1", "protein_name": "Protein phosphatase 2C 77", "gene_name": "ABI2", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "O04719", "url": "https://www.uniprot.org/uniprotkb/O04719" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.15599761", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Arabidopsis ERF4 is a transcriptional repressor capable of modulating ethylene and abscisic acid responses.", "journal": "Plant Mol. Biol.", "date": "2005", "authors": "Yang Zhen, Tian Lining, Latoszek-Green Marysia, Brown Daniel, Wu Keqiang", "reference": { "type": "PubMed", "id": "16021341", "url": "https://pubmed.ncbi.nlm.nih.gov/16021341" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O04719-1", "protein_name": "Protein phosphatase 2C 77", "gene_name": "ABI2", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "O04719", "url": "https://www.uniprot.org/uniprotkb/O04719" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.16021341", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Interaction between sugar and abscisic acid signalling during early seedling development in Arabidopsis.", "journal": "Plant molecular biology", "date": "2008-05", "authors": "Dekkers Bas J W, Schuurmans Jolanda A M J, Smeekens Sjef C M", "reference": { "type": "PubMed", "id": "18278579", "url": "https://pubmed.ncbi.nlm.nih.gov/18278579" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O04719-1", "protein_name": "Protein phosphatase 2C 77", "gene_name": "ABI2", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "O04719", "url": "https://www.uniprot.org/uniprotkb/O04719" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.18278579", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "ABI2, a second protein phosphatase 2C involved in abscisic acid signal transduction in Arabidopsis.", "journal": "FEBS Lett.", "date": "1998", "authors": "Rodriguez P L, Benning G, Grill E", "reference": { "type": "PubMed", "id": "9468303", "url": "https://pubmed.ncbi.nlm.nih.gov/9468303" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O04719-1", "protein_name": "Protein phosphatase 2C 77", "gene_name": "ABI2", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "O04719", "url": "https://www.uniprot.org/uniprotkb/O04719" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.9468303", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The greening after extended darkness1 is an N-end rule pathway mutant with high tolerance to submergence and starvation.", "journal": "Plant Physiol.", "date": "2015", "authors": "Riber Willi, M\u00fcller Jana T, Visser Eric J W, Sasidharan Rashmi, Voesenek Laurentius A C J, Mustroph Angelika", "reference": { "type": "PubMed", "id": "25667318", "url": "https://pubmed.ncbi.nlm.nih.gov/25667318" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "F4KCC2-1", "protein_name": "E3 ubiquitin-protein ligase PRT6", "gene_name": "PRT6", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "F4KCC2", "url": "https://www.uniprot.org/uniprotkb/F4KCC2" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.25667318", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "N-terminomics reveals control of Arabidopsis seed storage proteins and proteases by the Arg/N-end rule pathway.", "journal": "The New phytologist", "date": "2018-05", "authors": "Zhang Hongtao, Gannon Lucy, Hassall Kirsty L, Deery Michael J, Gibbs Daniel J, Holdsworth Michael J, van der Hoorn Renier A L, Lilley Kathryn S, Theodoulou Frederica L", "reference": { "type": "PubMed", "id": "29168982", "url": "https://pubmed.ncbi.nlm.nih.gov/29168982" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "F4KCC2-1", "protein_name": "E3 ubiquitin-protein ligase PRT6", "gene_name": "PRT6", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "F4KCC2", "url": "https://www.uniprot.org/uniprotkb/F4KCC2" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.29168982", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The CER3 gene of Arabidopsis thaliana is expressed in leaves, stems, roots, flowers and apical meristems.", "journal": "Plant J.", "date": "1996", "authors": "Hannoufa A, Negruk V, Eisner G, Lemieux B", "reference": { "type": "PubMed", "id": "8811860", "url": "https://pubmed.ncbi.nlm.nih.gov/8811860" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "F4KCC2-1", "protein_name": "E3 ubiquitin-protein ligase PRT6", "gene_name": "PRT6", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "F4KCC2", "url": "https://www.uniprot.org/uniprotkb/F4KCC2" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.8811860", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The Arabidopsis thaliana SOS2 gene encodes a protein kinase that is required for salt tolerance.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2000-03-28", "authors": "Liu J, Ishitani M, Halfter U, Kim C S, Zhu J K", "reference": { "type": "PubMed", "id": "10725382", "url": "https://pubmed.ncbi.nlm.nih.gov/10725382" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9LDI3-1", "protein_name": "CBL-interacting serine/threonine-protein kinase 24", "gene_name": "CIPK24; SOS2", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "Q9LDI3", "url": "https://www.uniprot.org/uniprotkb/Q9LDI3" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "mutagenesis": [ { "start_pos": 197, "end_pos": 197, "sequence_org": "G", "sequence_mut": "E", "comment": "Abolishes autophosphorylation.", "evidence": [ { "database": "UniProtKB", "id": "Q9LDI3", "url": "https://www.uniprot.org/uniprotkb/Q9LDI3" }, { "database": "PubMed", "id": "10725382", "url": "https://pubmed.ncbi.nlm.nih.gov/10725382" } ], "uniprot_canonical_ac": "Q9LDI3-1" }, { "start_pos": 40, "end_pos": 40, "sequence_org": "K", "sequence_mut": "N", "comment": "Abolishes autophosphorylation.", "evidence": [ { "database": "UniProtKB", "id": "Q9LDI3", "url": "https://www.uniprot.org/uniprotkb/Q9LDI3" }, { "database": "PubMed", "id": "10725382", "url": "https://pubmed.ncbi.nlm.nih.gov/10725382" } ], "uniprot_canonical_ac": "Q9LDI3-1" } ], "record_id": "pubmed.10725382", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Biochemical characterization of the Arabidopsis protein kinase SOS2 that functions in salt tolerance.", "journal": "Plant physiology", "date": "2002-09", "authors": "Gong Deming, Guo Yan, Jagendorf Andre T, Zhu Jian-Kang", "reference": { "type": "PubMed", "id": "12226505", "url": "https://pubmed.ncbi.nlm.nih.gov/12226505" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9LDI3-1", "protein_name": "CBL-interacting serine/threonine-protein kinase 24", "gene_name": "CIPK24; SOS2", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "Q9LDI3", "url": "https://www.uniprot.org/uniprotkb/Q9LDI3" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "mutagenesis": [ { "start_pos": 156, "end_pos": 156, "sequence_org": "S", "sequence_mut": "D", "comment": "Increases kinase activity.", "evidence": [ { "database": "UniProtKB", "id": "Q9LDI3", "url": "https://www.uniprot.org/uniprotkb/Q9LDI3" }, { "database": "PubMed", "id": "12226505", "url": "https://pubmed.ncbi.nlm.nih.gov/12226505" } ], "uniprot_canonical_ac": "Q9LDI3-1" }, { "start_pos": 175, "end_pos": 175, "sequence_org": "Y", "sequence_mut": "D", "comment": "Increases kinase activity.", "evidence": [ { "database": "UniProtKB", "id": "Q9LDI3", "url": "https://www.uniprot.org/uniprotkb/Q9LDI3" }, { "database": "PubMed", "id": "12226505", "url": "https://pubmed.ncbi.nlm.nih.gov/12226505" } ], "uniprot_canonical_ac": "Q9LDI3-1" } ], "record_id": "pubmed.12226505", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The protein kinase SOS2 activates the Arabidopsis H(+)/Ca(2+) antiporter CAX1 to integrate calcium transport and salt tolerance.", "journal": "The Journal of biological chemistry", "date": "2004-01-23", "authors": "Cheng Ning-Hui, Pittman Jon K, Zhu Jian-Kang, Hirschi Kendal D", "reference": { "type": "PubMed", "id": "14583601", "url": "https://pubmed.ncbi.nlm.nih.gov/14583601" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9LDI3-1", "protein_name": "CBL-interacting serine/threonine-protein kinase 24", "gene_name": "CIPK24; SOS2", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "Q9LDI3", "url": "https://www.uniprot.org/uniprotkb/Q9LDI3" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.14583601", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "An autophosphorylation site of the protein kinase SOS2 is important for salt tolerance in Arabidopsis.", "journal": "Molecular plant", "date": "2009-01", "authors": "Fujii Hiroaki, Zhu Jian-Kang", "reference": { "type": "PubMed", "id": "19529820", "url": "https://pubmed.ncbi.nlm.nih.gov/19529820" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9LDI3-1", "protein_name": "CBL-interacting serine/threonine-protein kinase 24", "gene_name": "CIPK24; SOS2", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "Q9LDI3", "url": "https://www.uniprot.org/uniprotkb/Q9LDI3" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "phosphorylation": [ { "start_pos": 168, "end_pos": 168, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine", "evidence": [ { "database": "UniProtKB", "id": "Q9LDI3", "url": "https://www.uniprot.org/uniprotkb/Q9LDI3" }, { "database": "PRO", "id": "Q9LDI3", "url": "https://proconsortium.org/cgi-bin/entry_pro?id=Q9LDI3" }, { "database": "iPTMnet", "id": "Q9LDI3", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9LDI3" }, { "database": "PubMed", "id": "19529820", "url": "https://pubmed.ncbi.nlm.nih.gov/19529820" } ], "site_lbl": "Thr168", "uniprot_canonical_ac": "Q9LDI3-1" }, { "start_pos": 228, "end_pos": 228, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "PRO", "id": "Q9LDI3", "url": "https://proconsortium.org/cgi-bin/entry_pro?id=Q9LDI3" }, { "database": "iPTMnet", "id": "Q9LDI3", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9LDI3" }, { "database": "PubMed", "id": "19529820", "url": "https://pubmed.ncbi.nlm.nih.gov/19529820" } ], "site_lbl": "Ser228", "uniprot_canonical_ac": "Q9LDI3-1" } ], "record_id": "pubmed.19529820", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Inhibition of the Arabidopsis salt overly sensitive pathway by 14-3-3 proteins.", "journal": "The Plant cell", "date": "2014-03", "authors": "Zhou Huapeng, Lin Huixin, Chen She, Becker Katia, Yang Yongqing, Zhao Jinfeng, Kudla J\u00f6rg, Schumaker Karen S, Guo Yan", "reference": { "type": "PubMed", "id": "24659330", "url": "https://pubmed.ncbi.nlm.nih.gov/24659330" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9LDI3-1", "protein_name": "CBL-interacting serine/threonine-protein kinase 24", "gene_name": "CIPK24; SOS2", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "Q9LDI3", "url": "https://www.uniprot.org/uniprotkb/Q9LDI3" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "phosphorylation": [ { "start_pos": 294, "end_pos": 294, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q9LDI3", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9LDI3" }, { "database": "PubMed", "id": "24659330", "url": "https://pubmed.ncbi.nlm.nih.gov/24659330" }, { "database": "PubMed", "id": "30867421", "url": "https://pubmed.ncbi.nlm.nih.gov/30867421" } ], "site_lbl": "Ser294", "uniprot_canonical_ac": "Q9LDI3-1" } ], "record_id": "pubmed.24659330", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Calcium-activated 14-3-3 proteins as a molecular switch in salt stress tolerance.", "journal": "Nature communications", "date": "2019-03-13", "authors": "Yang Zhijia, Wang Chongwu, Xue Yuan, Liu Xiao, Chen She, Song ChunPeng, Yang Yongqing, Guo Yan", "reference": { "type": "PubMed", "id": "30867421", "url": "https://pubmed.ncbi.nlm.nih.gov/30867421" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9LDI3-1", "protein_name": "CBL-interacting serine/threonine-protein kinase 24", "gene_name": "CIPK24; SOS2", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "Q9LDI3", "url": "https://www.uniprot.org/uniprotkb/Q9LDI3" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "phosphorylation": [ { "start_pos": 294, "end_pos": 294, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q9LDI3", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9LDI3" }, { "database": "PubMed", "id": "24659330", "url": "https://pubmed.ncbi.nlm.nih.gov/24659330" }, { "database": "PubMed", "id": "30867421", "url": "https://pubmed.ncbi.nlm.nih.gov/30867421" } ], "site_lbl": "Ser294", "uniprot_canonical_ac": "Q9LDI3-1" } ], "record_id": "pubmed.30867421", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "AtIREG2 encodes a tonoplast transport protein involved in iron-dependent nickel detoxification in Arabidopsis thaliana roots.", "journal": "The Journal of biological chemistry", "date": "2006-09-01", "authors": "Schaaf Gabriel, Honsbein Annegret, Meda Anderson R, Kirchner Silvia, Wipf Daniel, von Wir\u00e9n Nicolaus", "reference": { "type": "PubMed", "id": "16790430", "url": "https://pubmed.ncbi.nlm.nih.gov/16790430" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "F4KGN5-1", "protein_name": "Solute carrier family 40 member 2", "gene_name": "IREG2", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "F4KGN5", "url": "https://www.uniprot.org/uniprotkb/F4KGN5" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.16790430", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Arabidopsis kinetochore null2 is an upstream component for centromeric histone H3 variant cenH3 deposition at centromeres.", "journal": "The Plant cell", "date": "2013-09", "authors": "Lermontova Inna, Kuhlmann Markus, Friedel Swetlana, Rutten Twan, Heckmann Stefan, Sandmann Michael, Demidov Dmitri, Schubert Veit, Schubert Ingo", "reference": { "type": "PubMed", "id": "24014547", "url": "https://pubmed.ncbi.nlm.nih.gov/24014547" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "F4KCE9-1", "protein_name": "Kinetochore-associated protein KNL-2 homolog", "gene_name": "KNL2", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "F4KCE9", "url": "https://www.uniprot.org/uniprotkb/F4KCE9" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.24014547", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] } ]