[ { "title": "APC/C(Cdh1)-dependent degradation of Cdc20 requires a phosphorylation on CRY-box by Polo-like kinase-1 during somatic cell cycle.", "journal": "Biochemical and biophysical research communications", "date": "2013", "authors": "Hyun SY, Sarantuya B, Lee HJ, Jang YJ", "reference": { "type": "PubMed", "id": "23643811", "url": "https://pubmed.ncbi.nlm.nih.gov/23643811" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q12834-1", "protein_name": "Cell division cycle protein 20 homolog", "gene_name": "CDC20", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q12834", "url": "https://www.uniprot.org/uniprotkb/Q12834" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 170, "end_pos": 170, "kinase_uniprot_canonical_ac": "P53350-1", "kinase_gene_name": "PLK1", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q12834", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q12834" }, { "database": "PubMed", "id": "23643811", "url": "https://pubmed.ncbi.nlm.nih.gov/23643811" } ], "site_lbl": "Ser170", "uniprot_canonical_ac": "Q12834-1" } ], "record_id": "pubmed.23643811", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Phosphoproteomic Profiling Reveals Epstein-Barr Virus Protein Kinase Integration of DNA Damage Response and Mitotic Signaling.", "journal": "PLoS pathogens", "date": "2015", "authors": "Li R, Liao G, Nirujogi RS, Pinto SM, Shaw PG, Huang TC, Wan J, Qian J, Gowda H, Wu X, Lv DW, Zhang K, Manda SS, Pandey A, Hayward SD", "reference": { "type": "PubMed", "id": "26714015", "url": "https://pubmed.ncbi.nlm.nih.gov/26714015" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q12834-1", "protein_name": "Cell division cycle protein 20 homolog", "gene_name": "CDC20", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06493-1", "protein_name": "Cyclin-dependent kinase 1", "gene_name": "CDK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P33981-1", "protein_name": "Dual specificity protein kinase TTK", "gene_name": "TTK", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13315-1", "protein_name": "Serine-protein kinase ATM", "gene_name": "ATM", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q12834", "url": "https://www.uniprot.org/uniprotkb/Q12834" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 70, "end_pos": 70, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine", "evidence": [ { "database": "UniProtKB", "id": "Q12834", "url": "https://www.uniprot.org/uniprotkb/Q12834" }, { "database": "PubMed", "id": "23186163", "url": "https://pubmed.ncbi.nlm.nih.gov/23186163" }, { "database": "PubMed", "id": "14657031", "url": "https://pubmed.ncbi.nlm.nih.gov/14657031" }, { "database": "iPTMnet", "id": "Q12834", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q12834" }, { "database": "PubMed", "id": "18767875", "url": "https://pubmed.ncbi.nlm.nih.gov/18767875" }, { "database": "PubMed", "id": "26714015", "url": "https://pubmed.ncbi.nlm.nih.gov/26714015" }, { "database": "PubMed", "id": "26912231", "url": "https://pubmed.ncbi.nlm.nih.gov/26912231" }, { "database": "PubMed", "id": "26960431", "url": "https://pubmed.ncbi.nlm.nih.gov/26960431" } ], "site_lbl": "Thr70", "uniprot_canonical_ac": "Q12834-1" }, { "start_pos": 14, "end_pos": 14, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine; by PKMYT1", "evidence": [ { "database": "UniProtKB", "id": "P06493", "url": "https://www.uniprot.org/uniprotkb/P06493" }, { "database": "IEDB", "id": "P06493", "url": "https://www.iedb.org/epitope/P06493" }, { "database": "iPTMnet", "id": "P06493", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P06493" }, { "database": "PubMed", "id": "35494241", "url": "https://pubmed.ncbi.nlm.nih.gov/35494241" }, { "database": "PRO", "id": "P06493", "url": "https://proconsortium.org/cgi-bin/entry_pro?id=P06493" }, { "database": "PubMed", "id": "10373560", "url": "https://pubmed.ncbi.nlm.nih.gov/10373560" }, { "database": "PubMed", "id": "10504341", "url": "https://pubmed.ncbi.nlm.nih.gov/10504341" }, { "database": "PubMed", "id": "10564259", "url": "https://pubmed.ncbi.nlm.nih.gov/10564259" }, { "database": "PubMed", "id": "10913154", "url": "https://pubmed.ncbi.nlm.nih.gov/10913154" }, { "database": "PubMed", "id": "11719452", "url": "https://pubmed.ncbi.nlm.nih.gov/11719452" }, { "database": "PubMed", "id": "11782384", "url": "https://pubmed.ncbi.nlm.nih.gov/11782384" }, { "database": "PubMed", "id": "11807090", "url": "https://pubmed.ncbi.nlm.nih.gov/11807090" }, { "database": "PubMed", "id": "12658801", "url": "https://pubmed.ncbi.nlm.nih.gov/12658801" }, { "database": "PubMed", "id": "12697104", "url": "https://pubmed.ncbi.nlm.nih.gov/12697104" }, { "database": "PubMed", "id": "12883482", "url": "https://pubmed.ncbi.nlm.nih.gov/12883482" }, { "database": "PubMed", "id": "1384126", "url": "https://pubmed.ncbi.nlm.nih.gov/1384126" }, { "database": "PubMed", "id": "1483352", "url": "https://pubmed.ncbi.nlm.nih.gov/1483352" }, { "database": "PubMed", "id": "17718912", "url": "https://pubmed.ncbi.nlm.nih.gov/17718912" }, { "database": "PubMed", "id": "17919456", "url": "https://pubmed.ncbi.nlm.nih.gov/17919456" }, { "database": "PubMed", "id": "18193228", "url": "https://pubmed.ncbi.nlm.nih.gov/18193228" }, { "database": "PubMed", "id": "18378775", "url": "https://pubmed.ncbi.nlm.nih.gov/18378775" }, { "database": "PubMed", "id": "19158392", "url": "https://pubmed.ncbi.nlm.nih.gov/19158392" }, { "database": "PubMed", "id": "19233505", "url": "https://pubmed.ncbi.nlm.nih.gov/19233505" }, { "database": "PubMed", "id": "20360007", "url": "https://pubmed.ncbi.nlm.nih.gov/20360007" }, { "database": "PubMed", "id": "20362450", "url": "https://pubmed.ncbi.nlm.nih.gov/20362450" }, { "database": "PubMed", "id": "20367638", "url": "https://pubmed.ncbi.nlm.nih.gov/20367638" }, { "database": "PubMed", "id": "20395957", "url": "https://pubmed.ncbi.nlm.nih.gov/20395957" }, { "database": "PubMed", "id": "21275261", "url": "https://pubmed.ncbi.nlm.nih.gov/21275261" }, { "database": "PubMed", "id": "21325631", "url": "https://pubmed.ncbi.nlm.nih.gov/21325631" }, { "database": "PubMed", "id": "21468563", "url": "https://pubmed.ncbi.nlm.nih.gov/21468563" }, { "database": "PubMed", "id": "21900495", "url": "https://pubmed.ncbi.nlm.nih.gov/21900495" }, { "database": "PubMed", "id": "22552812", "url": "https://pubmed.ncbi.nlm.nih.gov/22552812" }, { "database": "PubMed", "id": "22623962", "url": "https://pubmed.ncbi.nlm.nih.gov/22623962" }, { "database": "PubMed", "id": "23471882", "url": "https://pubmed.ncbi.nlm.nih.gov/23471882" }, { "database": "PubMed", "id": "25092827", "url": "https://pubmed.ncbi.nlm.nih.gov/25092827" }, { "database": "PubMed", "id": "25139395", "url": "https://pubmed.ncbi.nlm.nih.gov/25139395" }, { "database": "PubMed", "id": "25143731", "url": "https://pubmed.ncbi.nlm.nih.gov/25143731" }, { "database": "PubMed", "id": "25283841", "url": "https://pubmed.ncbi.nlm.nih.gov/25283841" }, { "database": "PubMed", "id": "25435947", "url": "https://pubmed.ncbi.nlm.nih.gov/25435947" }, { "database": "PubMed", "id": "25483135", "url": "https://pubmed.ncbi.nlm.nih.gov/25483135" }, { "database": "PubMed", "id": "25747583", "url": "https://pubmed.ncbi.nlm.nih.gov/25747583" }, { "database": "PubMed", "id": "26303214", "url": "https://pubmed.ncbi.nlm.nih.gov/26303214" }, { "database": "PubMed", "id": "26445453", "url": "https://pubmed.ncbi.nlm.nih.gov/26445453" }, { "database": "PubMed", "id": "26485758", "url": "https://pubmed.ncbi.nlm.nih.gov/26485758" }, { "database": "PubMed", "id": "26714015", "url": "https://pubmed.ncbi.nlm.nih.gov/26714015" }, { "database": "PubMed", "id": "27383761", "url": "https://pubmed.ncbi.nlm.nih.gov/27383761" }, { "database": "PubMed", "id": "27603133", "url": "https://pubmed.ncbi.nlm.nih.gov/27603133" }, { "database": "PubMed", "id": "27769065", "url": "https://pubmed.ncbi.nlm.nih.gov/27769065" }, { "database": "PubMed", "id": "28264028", "url": "https://pubmed.ncbi.nlm.nih.gov/28264028" }, { "database": "PubMed", "id": "29071385", "url": "https://pubmed.ncbi.nlm.nih.gov/29071385" }, { "database": "PubMed", "id": "29074707", "url": "https://pubmed.ncbi.nlm.nih.gov/29074707" }, { "database": "PubMed", "id": "29088738", "url": "https://pubmed.ncbi.nlm.nih.gov/29088738" }, { "database": "PubMed", "id": "29168755", "url": "https://pubmed.ncbi.nlm.nih.gov/29168755" }, { "database": "PubMed", "id": "29277717", "url": "https://pubmed.ncbi.nlm.nih.gov/29277717" }, { "database": "PubMed", "id": "29321170", "url": "https://pubmed.ncbi.nlm.nih.gov/29321170" }, { "database": "PubMed", "id": "29435156", "url": "https://pubmed.ncbi.nlm.nih.gov/29435156" }, { "database": "PubMed", "id": "29658598", "url": "https://pubmed.ncbi.nlm.nih.gov/29658598" }, { "database": "PubMed", "id": "30190546", "url": "https://pubmed.ncbi.nlm.nih.gov/30190546" }, { "database": "PubMed", "id": "30400903", "url": "https://pubmed.ncbi.nlm.nih.gov/30400903" }, { "database": "PubMed", "id": "30449668", "url": "https://pubmed.ncbi.nlm.nih.gov/30449668" }, { "database": "PubMed", "id": "31836849", "url": "https://pubmed.ncbi.nlm.nih.gov/31836849" }, { "database": "PubMed", "id": "32267835", "url": "https://pubmed.ncbi.nlm.nih.gov/32267835" }, { "database": "PubMed", "id": "33281346", "url": "https://pubmed.ncbi.nlm.nih.gov/33281346" }, { "database": "PubMed", "id": "33574676", "url": "https://pubmed.ncbi.nlm.nih.gov/33574676" }, { "database": "PubMed", "id": "33805672", "url": "https://pubmed.ncbi.nlm.nih.gov/33805672" }, { "database": "PubMed", "id": "33863878", "url": "https://pubmed.ncbi.nlm.nih.gov/33863878" }, { "database": "PubMed", "id": "33918281", "url": "https://pubmed.ncbi.nlm.nih.gov/33918281" }, { "database": "PubMed", "id": "35738066", "url": "https://pubmed.ncbi.nlm.nih.gov/35738066" }, { "database": "PubMed", "id": "7743995", "url": "https://pubmed.ncbi.nlm.nih.gov/7743995" }, { "database": "PubMed", "id": "7841526", "url": "https://pubmed.ncbi.nlm.nih.gov/7841526" }, { "database": "PubMed", "id": "8402895", "url": "https://pubmed.ncbi.nlm.nih.gov/8402895" }, { "database": "PubMed", "id": "8428596", "url": "https://pubmed.ncbi.nlm.nih.gov/8428596" }, { "database": "PubMed", "id": "8440392", "url": "https://pubmed.ncbi.nlm.nih.gov/8440392" }, { "database": "PubMed", "id": "8475101", "url": "https://pubmed.ncbi.nlm.nih.gov/8475101" }, { "database": "PubMed", "id": "8769420", "url": "https://pubmed.ncbi.nlm.nih.gov/8769420" }, { "database": "PubMed", "id": "9001210", "url": "https://pubmed.ncbi.nlm.nih.gov/9001210" }, { "database": "PubMed", "id": "9201712", "url": "https://pubmed.ncbi.nlm.nih.gov/9201712" }, { "database": "PubMed", "id": "9268380", "url": "https://pubmed.ncbi.nlm.nih.gov/9268380" }, { "database": "PubMed", "id": "9371520", "url": "https://pubmed.ncbi.nlm.nih.gov/9371520" }, { "database": "PubMed", "id": "9552418", "url": "https://pubmed.ncbi.nlm.nih.gov/9552418" }, { "database": "PubMed", "id": "9585407", "url": "https://pubmed.ncbi.nlm.nih.gov/9585407" }, { "database": "PubMed", "id": "19690332", "url": "https://pubmed.ncbi.nlm.nih.gov/19690332" }, { "database": "PubMed", "id": "7569953", "url": "https://pubmed.ncbi.nlm.nih.gov/7569953" }, { "database": "PubMed", "id": "18669648", "url": "https://pubmed.ncbi.nlm.nih.gov/18669648" } ], "site_lbl": "Thr14", "uniprot_canonical_ac": "P06493-1" }, { "start_pos": 15, "end_pos": 15, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "Phosphotyrosine; by PKMYT1, WEE1, WEE2 and PKC/PRKCD", "evidence": [ { "database": "UniProtKB", "id": "P06493", "url": "https://www.uniprot.org/uniprotkb/P06493" }, { "database": "PRO", "id": "P06493", "url": "https://proconsortium.org/cgi-bin/entry_pro?id=P06493" }, { "database": "iPTMnet", "id": "P06493", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P06493" }, { "database": "PubMed", "id": "10360785", "url": "https://pubmed.ncbi.nlm.nih.gov/10360785" }, { "database": "PubMed", "id": "10373560", "url": "https://pubmed.ncbi.nlm.nih.gov/10373560" }, { "database": "PubMed", "id": "10504341", "url": "https://pubmed.ncbi.nlm.nih.gov/10504341" }, { "database": "PubMed", "id": "10564259", "url": "https://pubmed.ncbi.nlm.nih.gov/10564259" }, { "database": "PubMed", "id": "10588655", "url": "https://pubmed.ncbi.nlm.nih.gov/10588655" }, { "database": "PubMed", "id": "10637286", "url": "https://pubmed.ncbi.nlm.nih.gov/10637286" }, { "database": "PubMed", "id": "10850458", "url": "https://pubmed.ncbi.nlm.nih.gov/10850458" }, { "database": "PubMed", "id": "10854949", "url": "https://pubmed.ncbi.nlm.nih.gov/10854949" }, { "database": "PubMed", "id": "10913154", "url": "https://pubmed.ncbi.nlm.nih.gov/10913154" }, { "database": "PubMed", "id": "10938379", "url": "https://pubmed.ncbi.nlm.nih.gov/10938379" }, { "database": "PubMed", "id": "10958988", "url": "https://pubmed.ncbi.nlm.nih.gov/10958988" }, { "database": "PubMed", "id": "11098059", "url": "https://pubmed.ncbi.nlm.nih.gov/11098059" }, { "database": "PubMed", "id": "11313957", "url": "https://pubmed.ncbi.nlm.nih.gov/11313957" }, { "database": "PubMed", "id": "11719452", "url": "https://pubmed.ncbi.nlm.nih.gov/11719452" }, { "database": "PubMed", "id": "11719462", "url": "https://pubmed.ncbi.nlm.nih.gov/11719462" }, { "database": "PubMed", "id": "11751453", "url": "https://pubmed.ncbi.nlm.nih.gov/11751453" }, { "database": "PubMed", "id": "11782384", "url": "https://pubmed.ncbi.nlm.nih.gov/11782384" }, { "database": "PubMed", "id": "11807090", "url": "https://pubmed.ncbi.nlm.nih.gov/11807090" }, { "database": "PubMed", "id": "11839095", "url": "https://pubmed.ncbi.nlm.nih.gov/11839095" }, { "database": "PubMed", "id": "11841447", "url": "https://pubmed.ncbi.nlm.nih.gov/11841447" }, { "database": "PubMed", "id": "12049736", "url": "https://pubmed.ncbi.nlm.nih.gov/12049736" }, { "database": "PubMed", "id": "12222840", "url": "https://pubmed.ncbi.nlm.nih.gov/12222840" }, { "database": "PubMed", "id": "12370755", "url": "https://pubmed.ncbi.nlm.nih.gov/12370755" }, { "database": "PubMed", "id": "12384528", "url": "https://pubmed.ncbi.nlm.nih.gov/12384528" }, { "database": "PubMed", "id": "12472573", "url": "https://pubmed.ncbi.nlm.nih.gov/12472573" }, { "database": "PubMed", "id": "12492370", "url": "https://pubmed.ncbi.nlm.nih.gov/12492370" }, { "database": "PubMed", "id": "12514295", "url": "https://pubmed.ncbi.nlm.nih.gov/12514295" }, { "database": "PubMed", "id": "12579337", "url": "https://pubmed.ncbi.nlm.nih.gov/12579337" }, { "database": "PubMed", "id": "12658801", "url": "https://pubmed.ncbi.nlm.nih.gov/12658801" }, { "database": "PubMed", "id": "12669309", "url": "https://pubmed.ncbi.nlm.nih.gov/12669309" }, { "database": "PubMed", "id": "12697104", "url": "https://pubmed.ncbi.nlm.nih.gov/12697104" }, { "database": "PubMed", "id": "12859233", "url": "https://pubmed.ncbi.nlm.nih.gov/12859233" }, { "database": "PubMed", "id": "12883482", "url": "https://pubmed.ncbi.nlm.nih.gov/12883482" }, { "database": "PubMed", "id": "12894503", "url": "https://pubmed.ncbi.nlm.nih.gov/12894503" }, { "database": "PubMed", "id": "12915131", "url": "https://pubmed.ncbi.nlm.nih.gov/12915131" }, { "database": "PubMed", "id": "12973835", "url": "https://pubmed.ncbi.nlm.nih.gov/12973835" }, { "database": "PubMed", "id": "1384126", "url": "https://pubmed.ncbi.nlm.nih.gov/1384126" }, { "database": "PubMed", "id": "14499348", "url": "https://pubmed.ncbi.nlm.nih.gov/14499348" }, { "database": "PubMed", "id": "14517313", "url": "https://pubmed.ncbi.nlm.nih.gov/14517313" }, { "database": "PubMed", "id": "14645578", "url": "https://pubmed.ncbi.nlm.nih.gov/14645578" }, { "database": "PubMed", "id": "14681206", "url": "https://pubmed.ncbi.nlm.nih.gov/14681206" }, { "database": "PubMed", "id": "14744023", "url": "https://pubmed.ncbi.nlm.nih.gov/14744023" }, { "database": "PubMed", "id": "1483352", "url": "https://pubmed.ncbi.nlm.nih.gov/1483352" }, { "database": "PubMed", "id": "14968113", "url": "https://pubmed.ncbi.nlm.nih.gov/14968113" }, { "database": "PubMed", "id": "15073169", "url": "https://pubmed.ncbi.nlm.nih.gov/15073169" }, { "database": "PubMed", "id": "15141014", "url": "https://pubmed.ncbi.nlm.nih.gov/15141014" }, { "database": "PubMed", "id": "15529313", "url": "https://pubmed.ncbi.nlm.nih.gov/15529313" }, { "database": "PubMed", "id": "15618221", "url": "https://pubmed.ncbi.nlm.nih.gov/15618221" }, { "database": "PubMed", "id": "15754328", "url": "https://pubmed.ncbi.nlm.nih.gov/15754328" }, { "database": "PubMed", "id": "15780175", "url": "https://pubmed.ncbi.nlm.nih.gov/15780175" }, { "database": "PubMed", "id": "15798220", "url": "https://pubmed.ncbi.nlm.nih.gov/15798220" }, { "database": "PubMed", "id": "15940258", "url": "https://pubmed.ncbi.nlm.nih.gov/15940258" }, { "database": "PubMed", "id": "15975956", "url": "https://pubmed.ncbi.nlm.nih.gov/15975956" }, { "database": "PubMed", "id": "16142332", "url": "https://pubmed.ncbi.nlm.nih.gov/16142332" }, { "database": "PubMed", "id": "16151644", "url": "https://pubmed.ncbi.nlm.nih.gov/16151644" }, { "database": "PubMed", "id": "16216921", "url": "https://pubmed.ncbi.nlm.nih.gov/16216921" }, { "database": "PubMed", "id": "16614167", "url": "https://pubmed.ncbi.nlm.nih.gov/16614167" }, { "database": "PubMed", "id": "16619491", "url": "https://pubmed.ncbi.nlm.nih.gov/16619491" }, { "database": "PubMed", "id": "1664235", "url": "https://pubmed.ncbi.nlm.nih.gov/1664235" }, { "database": "PubMed", "id": "16783362", "url": "https://pubmed.ncbi.nlm.nih.gov/16783362" }, { "database": "PubMed", "id": "16840322", "url": "https://pubmed.ncbi.nlm.nih.gov/16840322" }, { "database": "PubMed", "id": "16847100", "url": "https://pubmed.ncbi.nlm.nih.gov/16847100" }, { "database": "PubMed", "id": "16857806", "url": "https://pubmed.ncbi.nlm.nih.gov/16857806" }, { "database": "PubMed", "id": "16861886", "url": "https://pubmed.ncbi.nlm.nih.gov/16861886" }, { "database": "PubMed", "id": "17172433", "url": "https://pubmed.ncbi.nlm.nih.gov/17172433" }, { "database": "PubMed", "id": "17210576", "url": "https://pubmed.ncbi.nlm.nih.gov/17210576" }, { "database": "PubMed", "id": "1731250", "url": "https://pubmed.ncbi.nlm.nih.gov/1731250" }, { "database": "PubMed", "id": "17340628", "url": "https://pubmed.ncbi.nlm.nih.gov/17340628" }, { "database": "PubMed", "id": "17457042", "url": "https://pubmed.ncbi.nlm.nih.gov/17457042" }, { "database": "PubMed", "id": "17472438", "url": "https://pubmed.ncbi.nlm.nih.gov/17472438" }, { "database": "PubMed", "id": "17619824", "url": "https://pubmed.ncbi.nlm.nih.gov/17619824" }, { "database": "PubMed", "id": "17636382", "url": "https://pubmed.ncbi.nlm.nih.gov/17636382" }, { "database": "PubMed", "id": "17718912", "url": "https://pubmed.ncbi.nlm.nih.gov/17718912" }, { "database": "PubMed", "id": "17764157", "url": "https://pubmed.ncbi.nlm.nih.gov/17764157" }, { "database": "PubMed", "id": "17869387", "url": "https://pubmed.ncbi.nlm.nih.gov/17869387" }, { "database": "PubMed", "id": "17919456", "url": "https://pubmed.ncbi.nlm.nih.gov/17919456" }, { "database": "PubMed", "id": "17964538", "url": "https://pubmed.ncbi.nlm.nih.gov/17964538" }, { "database": "PubMed", "id": "17971903", "url": "https://pubmed.ncbi.nlm.nih.gov/17971903" }, { "database": "PubMed", "id": "17989878", "url": "https://pubmed.ncbi.nlm.nih.gov/17989878" }, { "database": "PubMed", "id": "18193228", "url": "https://pubmed.ncbi.nlm.nih.gov/18193228" }, { "database": "PubMed", "id": "18225552", "url": "https://pubmed.ncbi.nlm.nih.gov/18225552" }, { "database": "PubMed", "id": "18247328", "url": "https://pubmed.ncbi.nlm.nih.gov/18247328" }, { "database": "PubMed", "id": "18378775", "url": "https://pubmed.ncbi.nlm.nih.gov/18378775" }, { "database": "PubMed", "id": "18385244", "url": "https://pubmed.ncbi.nlm.nih.gov/18385244" }, { "database": "PubMed", "id": "18425394", "url": "https://pubmed.ncbi.nlm.nih.gov/18425394" }, { "database": "PubMed", "id": "18469858", "url": "https://pubmed.ncbi.nlm.nih.gov/18469858" }, { "database": "PubMed", "id": "18800351", "url": "https://pubmed.ncbi.nlm.nih.gov/18800351" }, { "database": "PubMed", "id": "19003581", "url": "https://pubmed.ncbi.nlm.nih.gov/19003581" }, { "database": "PubMed", "id": "19074854", "url": "https://pubmed.ncbi.nlm.nih.gov/19074854" }, { "database": "PubMed", "id": "19158392", "url": "https://pubmed.ncbi.nlm.nih.gov/19158392" }, { "database": "PubMed", "id": "19259937", "url": "https://pubmed.ncbi.nlm.nih.gov/19259937" }, { "database": "PubMed", "id": "19459175", "url": "https://pubmed.ncbi.nlm.nih.gov/19459175" }, { "database": "PubMed", "id": "19500427", "url": "https://pubmed.ncbi.nlm.nih.gov/19500427" }, { "database": "PubMed", "id": "19530246", "url": "https://pubmed.ncbi.nlm.nih.gov/19530246" }, { "database": "PubMed", "id": "19548270", "url": "https://pubmed.ncbi.nlm.nih.gov/19548270" }, { "database": "PubMed", "id": "19730430", "url": "https://pubmed.ncbi.nlm.nih.gov/19730430" }, { "database": "PubMed", "id": "19795419", "url": "https://pubmed.ncbi.nlm.nih.gov/19795419" }, { "database": "PubMed", "id": "19858290", "url": "https://pubmed.ncbi.nlm.nih.gov/19858290" }, { "database": "PubMed", "id": "19887545", "url": "https://pubmed.ncbi.nlm.nih.gov/19887545" }, { "database": "PubMed", "id": "19917613", "url": "https://pubmed.ncbi.nlm.nih.gov/19917613" }, { "database": "PubMed", "id": "20053762", "url": "https://pubmed.ncbi.nlm.nih.gov/20053762" }, { "database": "PubMed", "id": "20089605", "url": "https://pubmed.ncbi.nlm.nih.gov/20089605" }, { "database": "PubMed", "id": "20107315", "url": "https://pubmed.ncbi.nlm.nih.gov/20107315" }, { "database": "PubMed", "id": "20195506", "url": "https://pubmed.ncbi.nlm.nih.gov/20195506" }, { "database": "PubMed", "id": "20360007", "url": "https://pubmed.ncbi.nlm.nih.gov/20360007" }, { "database": "PubMed", "id": "20362450", "url": "https://pubmed.ncbi.nlm.nih.gov/20362450" }, { "database": "PubMed", "id": "20367638", "url": "https://pubmed.ncbi.nlm.nih.gov/20367638" }, { "database": "PubMed", "id": "20372791", "url": "https://pubmed.ncbi.nlm.nih.gov/20372791" }, { "database": "PubMed", "id": "20395957", "url": "https://pubmed.ncbi.nlm.nih.gov/20395957" }, { "database": "PubMed", "id": "20406171", "url": "https://pubmed.ncbi.nlm.nih.gov/20406171" }, { "database": "PubMed", "id": "20679434", "url": "https://pubmed.ncbi.nlm.nih.gov/20679434" }, { "database": "PubMed", "id": "20840867", "url": "https://pubmed.ncbi.nlm.nih.gov/20840867" }, { "database": "PubMed", "id": "21152033", "url": "https://pubmed.ncbi.nlm.nih.gov/21152033" }, { "database": "PubMed", "id": "21275261", "url": "https://pubmed.ncbi.nlm.nih.gov/21275261" }, { "database": "PubMed", "id": "21325631", "url": "https://pubmed.ncbi.nlm.nih.gov/21325631" }, { "database": "PubMed", "id": "21468563", "url": "https://pubmed.ncbi.nlm.nih.gov/21468563" }, { "database": "PubMed", "id": "21624128", "url": "https://pubmed.ncbi.nlm.nih.gov/21624128" }, { "database": "PubMed", "id": "21660227", "url": "https://pubmed.ncbi.nlm.nih.gov/21660227" }, { "database": "PubMed", "id": "21695150", "url": "https://pubmed.ncbi.nlm.nih.gov/21695150" }, { "database": "PubMed", "id": "21734451", "url": "https://pubmed.ncbi.nlm.nih.gov/21734451" }, { "database": "PubMed", "id": "21887332", "url": "https://pubmed.ncbi.nlm.nih.gov/21887332" }, { "database": "PubMed", "id": "21900495", "url": "https://pubmed.ncbi.nlm.nih.gov/21900495" }, { "database": "PubMed", "id": "22012316", "url": "https://pubmed.ncbi.nlm.nih.gov/22012316" }, { "database": "PubMed", "id": "22204398", "url": "https://pubmed.ncbi.nlm.nih.gov/22204398" }, { "database": "PubMed", "id": "22300067", "url": "https://pubmed.ncbi.nlm.nih.gov/22300067" }, { "database": "PubMed", "id": "22494620", "url": "https://pubmed.ncbi.nlm.nih.gov/22494620" }, { "database": "PubMed", "id": "22552812", "url": "https://pubmed.ncbi.nlm.nih.gov/22552812" }, { "database": "PubMed", "id": "22623962", "url": "https://pubmed.ncbi.nlm.nih.gov/22623962" }, { "database": "PubMed", "id": "22686412", "url": "https://pubmed.ncbi.nlm.nih.gov/22686412" }, { "database": "PubMed", "id": "22719872", "url": "https://pubmed.ncbi.nlm.nih.gov/22719872" }, { "database": "PubMed", "id": "22730174", "url": "https://pubmed.ncbi.nlm.nih.gov/22730174" }, { "database": "PubMed", "id": "22761740", "url": "https://pubmed.ncbi.nlm.nih.gov/22761740" }, { "database": "PubMed", "id": "22850745", "url": "https://pubmed.ncbi.nlm.nih.gov/22850745" }, { "database": "PubMed", "id": "23051732", "url": "https://pubmed.ncbi.nlm.nih.gov/23051732" }, { "database": "PubMed", "id": "23251470", "url": "https://pubmed.ncbi.nlm.nih.gov/23251470" }, { "database": "PubMed", "id": "23397083", "url": "https://pubmed.ncbi.nlm.nih.gov/23397083" }, { "database": "PubMed", "id": "23520471", "url": "https://pubmed.ncbi.nlm.nih.gov/23520471" }, { "database": "PubMed", "id": "23560058", "url": "https://pubmed.ncbi.nlm.nih.gov/23560058" }, { "database": "PubMed", "id": "23562365", "url": "https://pubmed.ncbi.nlm.nih.gov/23562365" }, { "database": "PubMed", "id": "23570421", "url": "https://pubmed.ncbi.nlm.nih.gov/23570421" }, { "database": "PubMed", "id": "23775190", "url": "https://pubmed.ncbi.nlm.nih.gov/23775190" }, { "database": "PubMed", "id": "23778472", "url": "https://pubmed.ncbi.nlm.nih.gov/23778472" }, { "database": "PubMed", "id": "24053672", "url": "https://pubmed.ncbi.nlm.nih.gov/24053672" }, { "database": "PubMed", "id": "24098799", "url": "https://pubmed.ncbi.nlm.nih.gov/24098799" }, { "database": "PubMed", "id": "24391510", "url": "https://pubmed.ncbi.nlm.nih.gov/24391510" }, { "database": "PubMed", "id": "24391984", "url": "https://pubmed.ncbi.nlm.nih.gov/24391984" }, { "database": "PubMed", "id": "24626186", "url": "https://pubmed.ncbi.nlm.nih.gov/24626186" }, { "database": "PubMed", "id": "24643073", "url": "https://pubmed.ncbi.nlm.nih.gov/24643073" }, { "database": "PubMed", "id": "24798733", "url": "https://pubmed.ncbi.nlm.nih.gov/24798733" }, { "database": "PubMed", "id": "24872417", "url": "https://pubmed.ncbi.nlm.nih.gov/24872417" }, { "database": "PubMed", "id": "24913641", "url": "https://pubmed.ncbi.nlm.nih.gov/24913641" }, { "database": "PubMed", "id": "24960176", "url": "https://pubmed.ncbi.nlm.nih.gov/24960176" }, { "database": "PubMed", "id": "24962331", "url": "https://pubmed.ncbi.nlm.nih.gov/24962331" }, { "database": "PubMed", "id": "25002257", "url": "https://pubmed.ncbi.nlm.nih.gov/25002257" }, { "database": "PubMed", "id": "25084614", "url": "https://pubmed.ncbi.nlm.nih.gov/25084614" }, { "database": "PubMed", "id": "25092827", "url": "https://pubmed.ncbi.nlm.nih.gov/25092827" }, { "database": "PubMed", "id": "25139395", "url": "https://pubmed.ncbi.nlm.nih.gov/25139395" }, { "database": "PubMed", "id": "25143731", "url": "https://pubmed.ncbi.nlm.nih.gov/25143731" }, { "database": "PubMed", "id": "25204801", "url": "https://pubmed.ncbi.nlm.nih.gov/25204801" }, { "database": "PubMed", "id": "25283841", "url": "https://pubmed.ncbi.nlm.nih.gov/25283841" }, { "database": "PubMed", "id": "25301449", "url": "https://pubmed.ncbi.nlm.nih.gov/25301449" }, { "database": "PubMed", "id": "25393739", "url": "https://pubmed.ncbi.nlm.nih.gov/25393739" }, { "database": "PubMed", "id": "25435947", "url": "https://pubmed.ncbi.nlm.nih.gov/25435947" }, { "database": "PubMed", "id": "25483135", "url": "https://pubmed.ncbi.nlm.nih.gov/25483135" }, { "database": "PubMed", "id": "25547487", "url": "https://pubmed.ncbi.nlm.nih.gov/25547487" }, { "database": "PubMed", "id": "25563361", "url": "https://pubmed.ncbi.nlm.nih.gov/25563361" }, { "database": "PubMed", "id": "25625243", "url": "https://pubmed.ncbi.nlm.nih.gov/25625243" }, { "database": "PubMed", "id": "25747583", "url": "https://pubmed.ncbi.nlm.nih.gov/25747583" }, { "database": "PubMed", "id": "25925375", "url": "https://pubmed.ncbi.nlm.nih.gov/25925375" }, { "database": "PubMed", "id": "25938491", "url": "https://pubmed.ncbi.nlm.nih.gov/25938491" }, { "database": "PubMed", "id": "25964244", "url": "https://pubmed.ncbi.nlm.nih.gov/25964244" }, { "database": "PubMed", "id": "25994054", "url": "https://pubmed.ncbi.nlm.nih.gov/25994054" }, { "database": "PubMed", "id": "25994202", "url": "https://pubmed.ncbi.nlm.nih.gov/25994202" }, { "database": "PubMed", "id": "26183396", "url": "https://pubmed.ncbi.nlm.nih.gov/26183396" }, { "database": "PubMed", "id": "26303214", "url": "https://pubmed.ncbi.nlm.nih.gov/26303214" }, { "database": "PubMed", "id": "26304716", "url": "https://pubmed.ncbi.nlm.nih.gov/26304716" }, { "database": "PubMed", "id": "26445453", "url": "https://pubmed.ncbi.nlm.nih.gov/26445453" }, { "database": "PubMed", "id": "26485758", "url": "https://pubmed.ncbi.nlm.nih.gov/26485758" }, { "database": "PubMed", "id": "26612002", "url": "https://pubmed.ncbi.nlm.nih.gov/26612002" }, { "database": "PubMed", "id": "26714015", "url": "https://pubmed.ncbi.nlm.nih.gov/26714015" }, { "database": "PubMed", "id": "26733491", "url": "https://pubmed.ncbi.nlm.nih.gov/26733491" }, { "database": "PubMed", "id": "26815740", "url": "https://pubmed.ncbi.nlm.nih.gov/26815740" }, { "database": "PubMed", "id": "26835157", "url": "https://pubmed.ncbi.nlm.nih.gov/26835157" }, { "database": "PubMed", "id": "26871414", "url": "https://pubmed.ncbi.nlm.nih.gov/26871414" }, { "database": "PubMed", "id": "26913578", "url": "https://pubmed.ncbi.nlm.nih.gov/26913578" }, { "database": "PubMed", "id": "26946228", "url": "https://pubmed.ncbi.nlm.nih.gov/26946228" }, { "database": "PubMed", "id": "27028622", "url": "https://pubmed.ncbi.nlm.nih.gov/27028622" }, { "database": "PubMed", "id": "27029528", "url": "https://pubmed.ncbi.nlm.nih.gov/27029528" }, { "database": "PubMed", "id": "27043646", "url": "https://pubmed.ncbi.nlm.nih.gov/27043646" }, { "database": "PubMed", "id": "27123550", "url": "https://pubmed.ncbi.nlm.nih.gov/27123550" }, { "database": "PubMed", "id": "27138035", "url": "https://pubmed.ncbi.nlm.nih.gov/27138035" }, { "database": "PubMed", "id": "27198502", "url": "https://pubmed.ncbi.nlm.nih.gov/27198502" }, { "database": "PubMed", "id": "27322682", "url": "https://pubmed.ncbi.nlm.nih.gov/27322682" }, { "database": "PubMed", "id": "27383761", "url": "https://pubmed.ncbi.nlm.nih.gov/27383761" }, { "database": "PubMed", "id": "27390173", "url": "https://pubmed.ncbi.nlm.nih.gov/27390173" }, { "database": "PubMed", "id": "27603133", "url": "https://pubmed.ncbi.nlm.nih.gov/27603133" }, { "database": "PubMed", "id": "27726420", "url": "https://pubmed.ncbi.nlm.nih.gov/27726420" }, { "database": "PubMed", "id": "27767095", "url": "https://pubmed.ncbi.nlm.nih.gov/27767095" }, { "database": "PubMed", "id": "27889260", "url": "https://pubmed.ncbi.nlm.nih.gov/27889260" }, { "database": "PubMed", "id": "28117030", "url": "https://pubmed.ncbi.nlm.nih.gov/28117030" }, { "database": "PubMed", "id": "28239299", "url": "https://pubmed.ncbi.nlm.nih.gov/28239299" }, { "database": "PubMed", "id": "28264028", "url": "https://pubmed.ncbi.nlm.nih.gov/28264028" }, { "database": "PubMed", "id": "28335434", "url": "https://pubmed.ncbi.nlm.nih.gov/28335434" }, { "database": "PubMed", "id": "28502659", "url": "https://pubmed.ncbi.nlm.nih.gov/28502659" }, { "database": "PubMed", "id": "28815566", "url": "https://pubmed.ncbi.nlm.nih.gov/28815566" }, { "database": "PubMed", "id": "28977909", "url": "https://pubmed.ncbi.nlm.nih.gov/28977909" }, { "database": "PubMed", "id": "29044141", "url": "https://pubmed.ncbi.nlm.nih.gov/29044141" }, { "database": "PubMed", "id": "29071385", "url": "https://pubmed.ncbi.nlm.nih.gov/29071385" }, { "database": "PubMed", "id": "29074707", "url": "https://pubmed.ncbi.nlm.nih.gov/29074707" }, { "database": "PubMed", "id": "29088738", "url": "https://pubmed.ncbi.nlm.nih.gov/29088738" }, { "database": "PubMed", "id": "29154753", "url": "https://pubmed.ncbi.nlm.nih.gov/29154753" }, { "database": "PubMed", "id": "29163782", "url": "https://pubmed.ncbi.nlm.nih.gov/29163782" }, { "database": "PubMed", "id": "29168755", "url": "https://pubmed.ncbi.nlm.nih.gov/29168755" }, { "database": "PubMed", "id": "29221175", "url": "https://pubmed.ncbi.nlm.nih.gov/29221175" }, { "database": "PubMed", "id": "29277717", "url": "https://pubmed.ncbi.nlm.nih.gov/29277717" }, { "database": "PubMed", "id": "29321170", "url": "https://pubmed.ncbi.nlm.nih.gov/29321170" }, { "database": "PubMed", "id": "29435156", "url": "https://pubmed.ncbi.nlm.nih.gov/29435156" }, { "database": "PubMed", "id": "29515122", "url": "https://pubmed.ncbi.nlm.nih.gov/29515122" }, { "database": "PubMed", "id": "29606300", "url": "https://pubmed.ncbi.nlm.nih.gov/29606300" }, { "database": "PubMed", "id": "29658598", "url": "https://pubmed.ncbi.nlm.nih.gov/29658598" }, { "database": "PubMed", "id": "29680228", "url": "https://pubmed.ncbi.nlm.nih.gov/29680228" }, { "database": "PubMed", "id": "29754473", "url": "https://pubmed.ncbi.nlm.nih.gov/29754473" }, { "database": "PubMed", "id": "29783721", "url": "https://pubmed.ncbi.nlm.nih.gov/29783721" }, { "database": "PubMed", "id": "29876001", "url": "https://pubmed.ncbi.nlm.nih.gov/29876001" }, { "database": "PubMed", "id": "29881774", "url": "https://pubmed.ncbi.nlm.nih.gov/29881774" }, { "database": "PubMed", "id": "29930204", "url": "https://pubmed.ncbi.nlm.nih.gov/29930204" }, { "database": "PubMed", "id": "30089874", "url": "https://pubmed.ncbi.nlm.nih.gov/30089874" }, { "database": "PubMed", "id": "30135207", "url": "https://pubmed.ncbi.nlm.nih.gov/30135207" }, { "database": "PubMed", "id": "30158520", "url": "https://pubmed.ncbi.nlm.nih.gov/30158520" }, { "database": "PubMed", "id": "30190546", "url": "https://pubmed.ncbi.nlm.nih.gov/30190546" }, { "database": "PubMed", "id": "30273361", "url": "https://pubmed.ncbi.nlm.nih.gov/30273361" }, { "database": "PubMed", "id": "30361064", "url": "https://pubmed.ncbi.nlm.nih.gov/30361064" }, { "database": "PubMed", "id": "30400903", "url": "https://pubmed.ncbi.nlm.nih.gov/30400903" }, { "database": "PubMed", "id": "30449668", "url": "https://pubmed.ncbi.nlm.nih.gov/30449668" }, { "database": "PubMed", "id": "30538118", "url": "https://pubmed.ncbi.nlm.nih.gov/30538118" }, { "database": "PubMed", "id": "31015476", "url": "https://pubmed.ncbi.nlm.nih.gov/31015476" }, { "database": "PubMed", "id": "31200459", "url": "https://pubmed.ncbi.nlm.nih.gov/31200459" }, { "database": "PubMed", "id": "31285938", "url": "https://pubmed.ncbi.nlm.nih.gov/31285938" }, { "database": "PubMed", "id": "31303767", "url": "https://pubmed.ncbi.nlm.nih.gov/31303767" }, { "database": "PubMed", "id": "31836849", "url": "https://pubmed.ncbi.nlm.nih.gov/31836849" }, { "database": "PubMed", "id": "31922221", "url": "https://pubmed.ncbi.nlm.nih.gov/31922221" }, { "database": "PubMed", "id": "32251461", "url": "https://pubmed.ncbi.nlm.nih.gov/32251461" }, { "database": "PubMed", "id": "32267835", "url": "https://pubmed.ncbi.nlm.nih.gov/32267835" }, { "database": "PubMed", "id": "32410646", "url": "https://pubmed.ncbi.nlm.nih.gov/32410646" }, { "database": "PubMed", "id": "32647134", "url": "https://pubmed.ncbi.nlm.nih.gov/32647134" }, { "database": "PubMed", "id": "32802407", "url": "https://pubmed.ncbi.nlm.nih.gov/32802407" }, { "database": "PubMed", "id": "32945472", "url": "https://pubmed.ncbi.nlm.nih.gov/32945472" }, { "database": "PubMed", "id": "33020398", "url": "https://pubmed.ncbi.nlm.nih.gov/33020398" }, { "database": "PubMed", "id": "33168930", "url": "https://pubmed.ncbi.nlm.nih.gov/33168930" }, { "database": "PubMed", "id": "33262323", "url": "https://pubmed.ncbi.nlm.nih.gov/33262323" }, { "database": "PubMed", "id": "33281346", "url": "https://pubmed.ncbi.nlm.nih.gov/33281346" }, { "database": "PubMed", "id": "33445784", "url": "https://pubmed.ncbi.nlm.nih.gov/33445784" }, { "database": "PubMed", "id": "33574676", "url": "https://pubmed.ncbi.nlm.nih.gov/33574676" }, { "database": "PubMed", "id": "33628174", "url": "https://pubmed.ncbi.nlm.nih.gov/33628174" }, { "database": "PubMed", "id": "33718142", "url": "https://pubmed.ncbi.nlm.nih.gov/33718142" }, { "database": "PubMed", "id": "33771996", "url": "https://pubmed.ncbi.nlm.nih.gov/33771996" }, { "database": "PubMed", "id": "33796458", "url": "https://pubmed.ncbi.nlm.nih.gov/33796458" }, { "database": "PubMed", "id": "33805672", "url": "https://pubmed.ncbi.nlm.nih.gov/33805672" }, { "database": "PubMed", "id": "33863878", "url": "https://pubmed.ncbi.nlm.nih.gov/33863878" }, { "database": "PubMed", "id": "33918281", "url": "https://pubmed.ncbi.nlm.nih.gov/33918281" }, { "database": "PubMed", "id": "33971703", "url": "https://pubmed.ncbi.nlm.nih.gov/33971703" }, { "database": "PubMed", "id": "35056723", "url": "https://pubmed.ncbi.nlm.nih.gov/35056723" }, { "database": "PubMed", "id": "35738066", "url": "https://pubmed.ncbi.nlm.nih.gov/35738066" }, { "database": "PubMed", "id": "36116740", "url": "https://pubmed.ncbi.nlm.nih.gov/36116740" }, { "database": "PubMed", "id": "7530044", "url": "https://pubmed.ncbi.nlm.nih.gov/7530044" }, { "database": "PubMed", "id": "7543054", "url": "https://pubmed.ncbi.nlm.nih.gov/7543054" }, { "database": "PubMed", "id": "7568188", "url": "https://pubmed.ncbi.nlm.nih.gov/7568188" }, { "database": "PubMed", "id": "7743995", "url": "https://pubmed.ncbi.nlm.nih.gov/7743995" }, { "database": "PubMed", "id": "7841526", "url": "https://pubmed.ncbi.nlm.nih.gov/7841526" }, { "database": "PubMed", "id": "8084605", "url": "https://pubmed.ncbi.nlm.nih.gov/8084605" }, { "database": "PubMed", "id": "8402895", "url": "https://pubmed.ncbi.nlm.nih.gov/8402895" }, { "database": "PubMed", "id": "8428596", "url": "https://pubmed.ncbi.nlm.nih.gov/8428596" }, { "database": "PubMed", "id": "8440392", "url": "https://pubmed.ncbi.nlm.nih.gov/8440392" }, { "database": "PubMed", "id": "8441405", "url": "https://pubmed.ncbi.nlm.nih.gov/8441405" }, { "database": "PubMed", "id": "8475101", "url": "https://pubmed.ncbi.nlm.nih.gov/8475101" }, { "database": "PubMed", "id": "8622943", "url": "https://pubmed.ncbi.nlm.nih.gov/8622943" }, { "database": "PubMed", "id": "8662825", "url": "https://pubmed.ncbi.nlm.nih.gov/8662825" }, { "database": "PubMed", "id": "8670863", "url": "https://pubmed.ncbi.nlm.nih.gov/8670863" }, { "database": "PubMed", "id": "8769420", "url": "https://pubmed.ncbi.nlm.nih.gov/8769420" }, { "database": "PubMed", "id": "9001210", "url": "https://pubmed.ncbi.nlm.nih.gov/9001210" }, { "database": "PubMed", "id": "9034337", "url": "https://pubmed.ncbi.nlm.nih.gov/9034337" }, { "database": "PubMed", "id": "9174049", "url": "https://pubmed.ncbi.nlm.nih.gov/9174049" }, { "database": "PubMed", "id": "9201712", "url": "https://pubmed.ncbi.nlm.nih.gov/9201712" }, { "database": "PubMed", "id": "9230211", "url": "https://pubmed.ncbi.nlm.nih.gov/9230211" }, { "database": "PubMed", "id": "9268380", "url": "https://pubmed.ncbi.nlm.nih.gov/9268380" }, { "database": "PubMed", "id": "9371520", "url": "https://pubmed.ncbi.nlm.nih.gov/9371520" }, { "database": "PubMed", "id": "9492343", "url": "https://pubmed.ncbi.nlm.nih.gov/9492343" }, { "database": "PubMed", "id": "9552418", "url": "https://pubmed.ncbi.nlm.nih.gov/9552418" }, { "database": "PubMed", "id": "9585407", "url": "https://pubmed.ncbi.nlm.nih.gov/9585407" }, { "database": "PubMed", "id": "19690332", "url": "https://pubmed.ncbi.nlm.nih.gov/19690332" }, { "database": "PubMed", "id": "7569953", "url": "https://pubmed.ncbi.nlm.nih.gov/7569953" }, { "database": "PubMed", "id": "18669648", "url": "https://pubmed.ncbi.nlm.nih.gov/18669648" } ], "site_lbl": "Tyr15", "uniprot_canonical_ac": "P06493-1" }, { "start_pos": 161, "end_pos": 161, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine; by CAK", "evidence": [ { "database": "UniProtKB", "id": "P06493", "url": "https://www.uniprot.org/uniprotkb/P06493" }, { "database": "iPTMnet", "id": "P06493", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P06493" }, { "database": "PubMed", "id": "16565220", "url": "https://pubmed.ncbi.nlm.nih.gov/16565220" }, { "database": "PubMed", "id": "17924679", "url": "https://pubmed.ncbi.nlm.nih.gov/17924679" }, { "database": "PubMed", "id": "18452278", "url": "https://pubmed.ncbi.nlm.nih.gov/18452278" }, { "database": "PubMed", "id": "18669648", "url": "https://pubmed.ncbi.nlm.nih.gov/18669648" }, { "database": "PubMed", "id": "18691976", "url": "https://pubmed.ncbi.nlm.nih.gov/18691976" }, { "database": "PubMed", "id": "18767875", "url": "https://pubmed.ncbi.nlm.nih.gov/18767875" }, { "database": "PubMed", "id": "19651622", "url": "https://pubmed.ncbi.nlm.nih.gov/19651622" }, { "database": "PubMed", "id": "19664995", "url": "https://pubmed.ncbi.nlm.nih.gov/19664995" }, { "database": "PubMed", "id": "20068231", "url": "https://pubmed.ncbi.nlm.nih.gov/20068231" }, { "database": "PubMed", "id": "7944411", "url": "https://pubmed.ncbi.nlm.nih.gov/7944411" }, { "database": "PRO", "id": "P06493", "url": "https://proconsortium.org/cgi-bin/entry_pro?id=P06493" }, { "database": "PubMed", "id": "10564259", "url": "https://pubmed.ncbi.nlm.nih.gov/10564259" }, { "database": "PubMed", "id": "10913154", "url": "https://pubmed.ncbi.nlm.nih.gov/10913154" }, { "database": "PubMed", "id": "12222840", "url": "https://pubmed.ncbi.nlm.nih.gov/12222840" }, { "database": "PubMed", "id": "1483349", "url": "https://pubmed.ncbi.nlm.nih.gov/1483349" }, { "database": "PubMed", "id": "1483352", "url": "https://pubmed.ncbi.nlm.nih.gov/1483352" }, { "database": "PubMed", "id": "1535244", "url": "https://pubmed.ncbi.nlm.nih.gov/1535244" }, { "database": "PubMed", "id": "15798220", "url": "https://pubmed.ncbi.nlm.nih.gov/15798220" }, { "database": "PubMed", "id": "16024801", "url": "https://pubmed.ncbi.nlm.nih.gov/16024801" }, { "database": "PubMed", "id": "16847100", "url": "https://pubmed.ncbi.nlm.nih.gov/16847100" }, { "database": "PubMed", "id": "17012222", "url": "https://pubmed.ncbi.nlm.nih.gov/17012222" }, { "database": "PubMed", "id": "17013563", "url": "https://pubmed.ncbi.nlm.nih.gov/17013563" }, { "database": "PubMed", "id": "17015169", "url": "https://pubmed.ncbi.nlm.nih.gov/17015169" }, { "database": "PubMed", "id": "17102938", "url": "https://pubmed.ncbi.nlm.nih.gov/17102938" }, { "database": "PubMed", "id": "17340628", "url": "https://pubmed.ncbi.nlm.nih.gov/17340628" }, { "database": "PubMed", "id": "17374997", "url": "https://pubmed.ncbi.nlm.nih.gov/17374997" }, { "database": "PubMed", "id": "18025287", "url": "https://pubmed.ncbi.nlm.nih.gov/18025287" }, { "database": "PubMed", "id": "18193228", "url": "https://pubmed.ncbi.nlm.nih.gov/18193228" }, { "database": "PubMed", "id": "18501396", "url": "https://pubmed.ncbi.nlm.nih.gov/18501396" }, { "database": "PubMed", "id": "18603276", "url": "https://pubmed.ncbi.nlm.nih.gov/18603276" }, { "database": "PubMed", "id": "19450678", "url": "https://pubmed.ncbi.nlm.nih.gov/19450678" }, { "database": "PubMed", "id": "19735649", "url": "https://pubmed.ncbi.nlm.nih.gov/19735649" }, { "database": "PubMed", "id": "19781537", "url": "https://pubmed.ncbi.nlm.nih.gov/19781537" }, { "database": "PubMed", "id": "20360007", "url": "https://pubmed.ncbi.nlm.nih.gov/20360007" }, { "database": "PubMed", "id": "20367638", "url": "https://pubmed.ncbi.nlm.nih.gov/20367638" }, { "database": "PubMed", "id": "20395957", "url": "https://pubmed.ncbi.nlm.nih.gov/20395957" }, { "database": "PubMed", "id": "21468563", "url": "https://pubmed.ncbi.nlm.nih.gov/21468563" }, { "database": "PubMed", "id": "21900495", "url": "https://pubmed.ncbi.nlm.nih.gov/21900495" }, { "database": "PubMed", "id": "22204398", "url": "https://pubmed.ncbi.nlm.nih.gov/22204398" }, { "database": "PubMed", "id": "22563433", "url": "https://pubmed.ncbi.nlm.nih.gov/22563433" }, { "database": "PubMed", "id": "22580740", "url": "https://pubmed.ncbi.nlm.nih.gov/22580740" }, { "database": "PubMed", "id": "23397083", "url": "https://pubmed.ncbi.nlm.nih.gov/23397083" }, { "database": "PubMed", "id": "23471882", "url": "https://pubmed.ncbi.nlm.nih.gov/23471882" }, { "database": "PubMed", "id": "23775190", "url": "https://pubmed.ncbi.nlm.nih.gov/23775190" }, { "database": "PubMed", "id": "23802687", "url": "https://pubmed.ncbi.nlm.nih.gov/23802687" }, { "database": "PubMed", "id": "24042231", "url": "https://pubmed.ncbi.nlm.nih.gov/24042231" }, { "database": "PubMed", "id": "25092827", "url": "https://pubmed.ncbi.nlm.nih.gov/25092827" }, { "database": "PubMed", "id": "25483135", "url": "https://pubmed.ncbi.nlm.nih.gov/25483135" }, { "database": "PubMed", "id": "25563361", "url": "https://pubmed.ncbi.nlm.nih.gov/25563361" }, { "database": "PubMed", "id": "25864384", "url": "https://pubmed.ncbi.nlm.nih.gov/25864384" }, { "database": "PubMed", "id": "26354852", "url": "https://pubmed.ncbi.nlm.nih.gov/26354852" }, { "database": "PubMed", "id": "26714015", "url": "https://pubmed.ncbi.nlm.nih.gov/26714015" }, { "database": "PubMed", "id": "26815740", "url": "https://pubmed.ncbi.nlm.nih.gov/26815740" }, { "database": "PubMed", "id": "26881434", "url": "https://pubmed.ncbi.nlm.nih.gov/26881434" }, { "database": "PubMed", "id": "26913578", "url": "https://pubmed.ncbi.nlm.nih.gov/26913578" }, { "database": "PubMed", "id": "27819344", "url": "https://pubmed.ncbi.nlm.nih.gov/27819344" }, { "database": "PubMed", "id": "28062857", "url": "https://pubmed.ncbi.nlm.nih.gov/28062857" }, { "database": "PubMed", "id": "28534969", "url": "https://pubmed.ncbi.nlm.nih.gov/28534969" }, { "database": "PubMed", "id": "29071385", "url": "https://pubmed.ncbi.nlm.nih.gov/29071385" }, { "database": "PubMed", "id": "29277717", "url": "https://pubmed.ncbi.nlm.nih.gov/29277717" }, { "database": "PubMed", "id": "29435156", "url": "https://pubmed.ncbi.nlm.nih.gov/29435156" }, { "database": "PubMed", "id": "29515122", "url": "https://pubmed.ncbi.nlm.nih.gov/29515122" }, { "database": "PubMed", "id": "30190546", "url": "https://pubmed.ncbi.nlm.nih.gov/30190546" }, { "database": "PubMed", "id": "30273361", "url": "https://pubmed.ncbi.nlm.nih.gov/30273361" }, { "database": "PubMed", "id": "30538118", "url": "https://pubmed.ncbi.nlm.nih.gov/30538118" }, { "database": "PubMed", "id": "31035650", "url": "https://pubmed.ncbi.nlm.nih.gov/31035650" }, { "database": "PubMed", "id": "31836849", "url": "https://pubmed.ncbi.nlm.nih.gov/31836849" }, { "database": "PubMed", "id": "32231646", "url": "https://pubmed.ncbi.nlm.nih.gov/32231646" }, { "database": "PubMed", "id": "32410646", "url": "https://pubmed.ncbi.nlm.nih.gov/32410646" }, { "database": "PubMed", "id": "33281346", "url": "https://pubmed.ncbi.nlm.nih.gov/33281346" }, { "database": "PubMed", "id": "33352782", "url": "https://pubmed.ncbi.nlm.nih.gov/33352782" }, { "database": "PubMed", "id": "33574676", "url": "https://pubmed.ncbi.nlm.nih.gov/33574676" }, { "database": "PubMed", "id": "33718142", "url": "https://pubmed.ncbi.nlm.nih.gov/33718142" }, { "database": "PubMed", "id": "33863878", "url": "https://pubmed.ncbi.nlm.nih.gov/33863878" }, { "database": "PubMed", "id": "35694267", "url": "https://pubmed.ncbi.nlm.nih.gov/35694267" }, { "database": "PubMed", "id": "7543054", "url": "https://pubmed.ncbi.nlm.nih.gov/7543054" }, { "database": "PubMed", "id": "7929589", "url": "https://pubmed.ncbi.nlm.nih.gov/7929589" }, { "database": "PubMed", "id": "8078587", "url": "https://pubmed.ncbi.nlm.nih.gov/8078587" }, { "database": "PubMed", "id": "8336738", "url": "https://pubmed.ncbi.nlm.nih.gov/8336738" }, { "database": "PubMed", "id": "8440392", "url": "https://pubmed.ncbi.nlm.nih.gov/8440392" }, { "database": "PubMed", "id": "8441405", "url": "https://pubmed.ncbi.nlm.nih.gov/8441405" }, { "database": "PubMed", "id": "9001210", "url": "https://pubmed.ncbi.nlm.nih.gov/9001210" }, { "database": "PubMed", "id": "21406692", "url": "https://pubmed.ncbi.nlm.nih.gov/21406692" }, { "database": "PubMed", "id": "23186163", "url": "https://pubmed.ncbi.nlm.nih.gov/23186163" }, { "database": "PubMed", "id": "19690332", "url": "https://pubmed.ncbi.nlm.nih.gov/19690332" } ], "site_lbl": "Thr161", "uniprot_canonical_ac": "P06493-1" }, { "start_pos": 436, "end_pos": 436, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P33981", "url": "https://www.uniprot.org/uniprotkb/P33981" }, { "database": "PubMed", "id": "19369195", "url": "https://pubmed.ncbi.nlm.nih.gov/19369195" }, { "database": "PubMed", "id": "23186163", "url": "https://pubmed.ncbi.nlm.nih.gov/23186163" }, { "database": "PubMed", "id": "18691976", "url": "https://pubmed.ncbi.nlm.nih.gov/18691976" }, { "database": "iPTMnet", "id": "P33981", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P33981" }, { "database": "PubMed", "id": "19007248", "url": "https://pubmed.ncbi.nlm.nih.gov/19007248" }, { "database": "PubMed", "id": "20068231", "url": "https://pubmed.ncbi.nlm.nih.gov/20068231" }, { "database": "PubMed", "id": "26714015", "url": "https://pubmed.ncbi.nlm.nih.gov/26714015" } ], "site_lbl": "Ser436", "uniprot_canonical_ac": "P33981-1" }, { "start_pos": 2996, "end_pos": 2996, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "Q13315", "url": "https://www.uniprot.org/uniprotkb/Q13315" }, { "database": "PubMed", "id": "19369195", "url": "https://pubmed.ncbi.nlm.nih.gov/19369195" }, { "database": "PubMed", "id": "18691976", "url": "https://pubmed.ncbi.nlm.nih.gov/18691976" }, { "database": "iPTMnet", "id": "Q13315", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q13315" }, { "database": "PubMed", "id": "26714015", "url": "https://pubmed.ncbi.nlm.nih.gov/26714015" }, { "database": "PubMed", "id": "30001349", "url": "https://pubmed.ncbi.nlm.nih.gov/30001349" } ], "site_lbl": "Ser2996", "uniprot_canonical_ac": "Q13315-1" } ], "record_id": "pubmed.26714015", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 4 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 6 }, { "field": "total_sites", "count": 6 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The Bub1-Plk1 kinase complex promotes spindle checkpoint signalling through Cdc20 phosphorylation.", "journal": "Nature communications", "date": "2016", "authors": "Jia L, Li B, Yu H", "reference": { "type": "PubMed", "id": "26912231", "url": "https://pubmed.ncbi.nlm.nih.gov/26912231" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q12834-1", "protein_name": "Cell division cycle protein 20 homolog", "gene_name": "CDC20", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43683-1", "protein_name": "Mitotic checkpoint serine/threonine-protein kinase BUB1", "gene_name": "BUB1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q12834", "url": "https://www.uniprot.org/uniprotkb/Q12834" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 106, "end_pos": 106, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine", "evidence": [ { "database": "UniProtKB", "id": "Q12834", "url": "https://www.uniprot.org/uniprotkb/Q12834" }, { "database": "PubMed", "id": "14657031", "url": "https://pubmed.ncbi.nlm.nih.gov/14657031" }, { "database": "iPTMnet", "id": "Q12834", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q12834" }, { "database": "PubMed", "id": "26912231", "url": "https://pubmed.ncbi.nlm.nih.gov/26912231" }, { "database": "PubMed", "id": "26960431", "url": "https://pubmed.ncbi.nlm.nih.gov/26960431" } ], "site_lbl": "Thr106", "uniprot_canonical_ac": "Q12834-1" }, { "start_pos": 153, "end_pos": 153, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "Q12834", "url": "https://www.uniprot.org/uniprotkb/Q12834" }, { "database": "PubMed", "id": "15525512", "url": "https://pubmed.ncbi.nlm.nih.gov/15525512" }, { "database": "PRO", "id": "Q12834", "url": "https://proconsortium.org/cgi-bin/entry_pro?id=Q12834" }, { "database": "iPTMnet", "id": "Q12834", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q12834" }, { "database": "PubMed", "id": "26912231", "url": "https://pubmed.ncbi.nlm.nih.gov/26912231" } ], "site_lbl": "Ser153", "uniprot_canonical_ac": "Q12834-1" }, { "start_pos": 157, "end_pos": 157, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine", "evidence": [ { "database": "UniProtKB", "id": "Q12834", "url": "https://www.uniprot.org/uniprotkb/Q12834" }, { "database": "PubMed", "id": "15525512", "url": "https://pubmed.ncbi.nlm.nih.gov/15525512" }, { "database": "PRO", "id": "Q12834", "url": "https://proconsortium.org/cgi-bin/entry_pro?id=Q12834" }, { "database": "iPTMnet", "id": "Q12834", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q12834" }, { "database": "PubMed", "id": "26912231", "url": "https://pubmed.ncbi.nlm.nih.gov/26912231" }, { "database": "PubMed", "id": "26960431", "url": "https://pubmed.ncbi.nlm.nih.gov/26960431" } ], "site_lbl": "Thr157", "uniprot_canonical_ac": "Q12834-1" }, { "start_pos": 161, "end_pos": 161, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "Q12834", "url": "https://www.uniprot.org/uniprotkb/Q12834" }, { "database": "PubMed", "id": "15525512", "url": "https://pubmed.ncbi.nlm.nih.gov/15525512" }, { "database": "PRO", "id": "Q12834", "url": "https://proconsortium.org/cgi-bin/entry_pro?id=Q12834" }, { "database": "iPTMnet", "id": "Q12834", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q12834" }, { "database": "PubMed", "id": "26912231", "url": "https://pubmed.ncbi.nlm.nih.gov/26912231" } ], "site_lbl": "Ser161", "uniprot_canonical_ac": "Q12834-1" }, { "start_pos": 70, "end_pos": 70, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine", "evidence": [ { "database": "UniProtKB", "id": "Q12834", "url": "https://www.uniprot.org/uniprotkb/Q12834" }, { "database": "PubMed", "id": "23186163", "url": "https://pubmed.ncbi.nlm.nih.gov/23186163" }, { "database": "PubMed", "id": "14657031", "url": "https://pubmed.ncbi.nlm.nih.gov/14657031" }, { "database": "iPTMnet", "id": "Q12834", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q12834" }, { "database": "PubMed", "id": "18767875", "url": "https://pubmed.ncbi.nlm.nih.gov/18767875" }, { "database": "PubMed", "id": "26714015", "url": "https://pubmed.ncbi.nlm.nih.gov/26714015" }, { "database": "PubMed", "id": "26912231", "url": "https://pubmed.ncbi.nlm.nih.gov/26912231" }, { "database": "PubMed", "id": "26960431", "url": "https://pubmed.ncbi.nlm.nih.gov/26960431" } ], "site_lbl": "Thr70", "uniprot_canonical_ac": "Q12834-1" }, { "start_pos": 72, "end_pos": 72, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "Q12834", "url": "https://www.uniprot.org/uniprotkb/Q12834" }, { "database": "PubMed", "id": "15525512", "url": "https://pubmed.ncbi.nlm.nih.gov/15525512" }, { "database": "PRO", "id": "Q12834", "url": "https://proconsortium.org/cgi-bin/entry_pro?id=Q12834" }, { "database": "iPTMnet", "id": "Q12834", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q12834" }, { "database": "PubMed", "id": "26912231", "url": "https://pubmed.ncbi.nlm.nih.gov/26912231" } ], "site_lbl": "Ser72", "uniprot_canonical_ac": "Q12834-1" }, { "start_pos": 84, "end_pos": 84, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q12834", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q12834" }, { "database": "PubMed", "id": "26912231", "url": "https://pubmed.ncbi.nlm.nih.gov/26912231" } ], "site_lbl": "Ser84", "uniprot_canonical_ac": "Q12834-1" }, { "start_pos": 92, "end_pos": 92, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "Q12834", "url": "https://www.uniprot.org/uniprotkb/Q12834" }, { "database": "PubMed", "id": "15525512", "url": "https://pubmed.ncbi.nlm.nih.gov/15525512" }, { "database": "PRO", "id": "Q12834", "url": "https://proconsortium.org/cgi-bin/entry_pro?id=Q12834" }, { "database": "iPTMnet", "id": "Q12834", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q12834" }, { "database": "PubMed", "id": "26912231", "url": "https://pubmed.ncbi.nlm.nih.gov/26912231" } ], "site_lbl": "Ser92", "uniprot_canonical_ac": "Q12834-1" }, { "start_pos": 96, "end_pos": 96, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q12834", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q12834" }, { "database": "PubMed", "id": "26912231", "url": "https://pubmed.ncbi.nlm.nih.gov/26912231" } ], "site_lbl": "Ser96", "uniprot_canonical_ac": "Q12834-1" }, { "start_pos": 609, "end_pos": 609, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine; by CDK1", "evidence": [ { "database": "UniProtKB", "id": "O43683", "url": "https://www.uniprot.org/uniprotkb/O43683" }, { "database": "iPTMnet", "id": "O43683", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O43683" }, { "database": "PubMed", "id": "16760428", "url": "https://pubmed.ncbi.nlm.nih.gov/16760428" }, { "database": "PRO", "id": "O43683", "url": "https://proconsortium.org/cgi-bin/entry_pro?id=O43683" }, { "database": "PubMed", "id": "26912231", "url": "https://pubmed.ncbi.nlm.nih.gov/26912231" } ], "site_lbl": "Thr609", "uniprot_canonical_ac": "O43683-1" } ], "record_id": "pubmed.26912231", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 10 }, { "field": "total_sites", "count": 10 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Interphase APC/C-Cdc20 inhibition by cyclin A2-Cdk2 ensures efficient mitotic entry.", "journal": "Nature communications", "date": "2016", "authors": "Hein JB, Nilsson J", "reference": { "type": "PubMed", "id": "26960431", "url": "https://pubmed.ncbi.nlm.nih.gov/26960431" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q12834-1", "protein_name": "Cell division cycle protein 20 homolog", "gene_name": "CDC20", "tax_name": "Human" }, { "uniprot_canonical_ac": "P14635-1", "protein_name": "G2/mitotic-specific cyclin-B1", "gene_name": "CCNB1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q12834", "url": "https://www.uniprot.org/uniprotkb/Q12834" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 106, "end_pos": 106, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine", "evidence": [ { "database": "UniProtKB", "id": "Q12834", "url": "https://www.uniprot.org/uniprotkb/Q12834" }, { "database": "PubMed", "id": "14657031", "url": "https://pubmed.ncbi.nlm.nih.gov/14657031" }, { "database": "iPTMnet", "id": "Q12834", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q12834" }, { "database": "PubMed", "id": "26912231", "url": "https://pubmed.ncbi.nlm.nih.gov/26912231" }, { "database": "PubMed", "id": "26960431", "url": "https://pubmed.ncbi.nlm.nih.gov/26960431" } ], "site_lbl": "Thr106", "uniprot_canonical_ac": "Q12834-1" }, { "start_pos": 157, "end_pos": 157, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine", "evidence": [ { "database": "UniProtKB", "id": "Q12834", "url": "https://www.uniprot.org/uniprotkb/Q12834" }, { "database": "PubMed", "id": "15525512", "url": "https://pubmed.ncbi.nlm.nih.gov/15525512" }, { "database": "PRO", "id": "Q12834", "url": "https://proconsortium.org/cgi-bin/entry_pro?id=Q12834" }, { "database": "iPTMnet", "id": "Q12834", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q12834" }, { "database": "PubMed", "id": "26912231", "url": "https://pubmed.ncbi.nlm.nih.gov/26912231" }, { "database": "PubMed", "id": "26960431", "url": "https://pubmed.ncbi.nlm.nih.gov/26960431" } ], "site_lbl": "Thr157", "uniprot_canonical_ac": "Q12834-1" }, { "start_pos": 41, "end_pos": 41, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "Q12834", "url": "https://www.uniprot.org/uniprotkb/Q12834" }, { "database": "PubMed", "id": "15525512", "url": "https://pubmed.ncbi.nlm.nih.gov/15525512" }, { "database": "PubMed", "id": "23186163", "url": "https://pubmed.ncbi.nlm.nih.gov/23186163" }, { "database": "PRO", "id": "Q12834", "url": "https://proconsortium.org/cgi-bin/entry_pro?id=Q12834" }, { "database": "iPTMnet", "id": "Q12834", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q12834" }, { "database": "PubMed", "id": "26960431", "url": "https://pubmed.ncbi.nlm.nih.gov/26960431" } ], "site_lbl": "Ser41", "uniprot_canonical_ac": "Q12834-1" }, { "start_pos": 487, "end_pos": 487, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q12834", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q12834" }, { "database": "PubMed", "id": "26960431", "url": "https://pubmed.ncbi.nlm.nih.gov/26960431" } ], "site_lbl": "Ser487", "uniprot_canonical_ac": "Q12834-1" }, { "start_pos": 55, "end_pos": 55, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q12834", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q12834" }, { "database": "PubMed", "id": "26960431", "url": "https://pubmed.ncbi.nlm.nih.gov/26960431" } ], "site_lbl": "Thr55", "uniprot_canonical_ac": "Q12834-1" }, { "start_pos": 59, "end_pos": 59, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q12834", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q12834" }, { "database": "PubMed", "id": "26960431", "url": "https://pubmed.ncbi.nlm.nih.gov/26960431" } ], "site_lbl": "Thr59", "uniprot_canonical_ac": "Q12834-1" }, { "start_pos": 70, "end_pos": 70, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine", "evidence": [ { "database": "UniProtKB", "id": "Q12834", "url": "https://www.uniprot.org/uniprotkb/Q12834" }, { "database": "PubMed", "id": "23186163", "url": "https://pubmed.ncbi.nlm.nih.gov/23186163" }, { "database": "PubMed", "id": "14657031", "url": "https://pubmed.ncbi.nlm.nih.gov/14657031" }, { "database": "iPTMnet", "id": "Q12834", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q12834" }, { "database": "PubMed", "id": "18767875", "url": "https://pubmed.ncbi.nlm.nih.gov/18767875" }, { "database": "PubMed", "id": "26714015", "url": "https://pubmed.ncbi.nlm.nih.gov/26714015" }, { "database": "PubMed", "id": "26912231", "url": "https://pubmed.ncbi.nlm.nih.gov/26912231" }, { "database": "PubMed", "id": "26960431", "url": "https://pubmed.ncbi.nlm.nih.gov/26960431" } ], "site_lbl": "Thr70", "uniprot_canonical_ac": "Q12834-1" }, { "start_pos": 126, "end_pos": 126, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by CDK1", "evidence": [ { "database": "UniProtKB", "id": "P14635", "url": "https://www.uniprot.org/uniprotkb/P14635" }, { "database": "PRO", "id": "P14635", "url": "https://proconsortium.org/cgi-bin/entry_pro?id=P14635" }, { "database": "iPTMnet", "id": "P14635", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P14635" }, { "database": "PubMed", "id": "12447691", "url": "https://pubmed.ncbi.nlm.nih.gov/12447691" }, { "database": "PubMed", "id": "15798220", "url": "https://pubmed.ncbi.nlm.nih.gov/15798220" }, { "database": "PubMed", "id": "26960431", "url": "https://pubmed.ncbi.nlm.nih.gov/26960431" }, { "database": "PubMed", "id": "12524548", "url": "https://pubmed.ncbi.nlm.nih.gov/12524548" } ], "site_lbl": "Ser126", "uniprot_canonical_ac": "P14635-1" } ], "record_id": "pubmed.26960431", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 8 }, { "field": "total_sites", "count": 8 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Ubiquitin-specific protease 22 is a deubiquitinase of CCNB1.", "journal": "Cell discovery", "date": "2015", "authors": "Lin Z, Tan C, Qiu Q, Kong S, Yang H, Zhao F, Liu Z, Li J, Kong Q, Gao B, Barrett T, Yang GY, Zhang J, Fang D", "reference": { "type": "PubMed", "id": "27030811", "url": "https://pubmed.ncbi.nlm.nih.gov/27030811" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q12834-1", "protein_name": "Cell division cycle protein 20 homolog", "gene_name": "CDC20", "tax_name": "Human" }, { "uniprot_canonical_ac": "P14635-1", "protein_name": "G2/mitotic-specific cyclin-B1", "gene_name": "CCNB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UPT9-1", "protein_name": "Ubiquitin carboxyl-terminal hydrolase 22", "gene_name": "USP22", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q12834", "url": "https://www.uniprot.org/uniprotkb/Q12834" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 147, "end_pos": 147, "sequence_org": "T", "sequence_mut": "A", "comment": "Complete loss of CDK1-mediated phosphorylation; when associated with A-237.", "evidence": [ { "database": "UniProtKB", "id": "Q9UPT9", "url": "https://www.uniprot.org/uniprotkb/Q9UPT9" }, { "database": "PubMed", "id": "27030811", "url": "https://pubmed.ncbi.nlm.nih.gov/27030811" } ], "uniprot_canonical_ac": "Q9UPT9-1" }, { "start_pos": 237, "end_pos": 237, "sequence_org": "S", "sequence_mut": "A", "comment": "Complete loss of CDK1-mediated phosphorylation; when associated with A-147.", "evidence": [ { "database": "UniProtKB", "id": "Q9UPT9", "url": "https://www.uniprot.org/uniprotkb/Q9UPT9" }, { "database": "PubMed", "id": "27030811", "url": "https://pubmed.ncbi.nlm.nih.gov/27030811" } ], "uniprot_canonical_ac": "Q9UPT9-1" } ], "phosphorylation": [ { "start_pos": 147, "end_pos": 147, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine; by CDK1", "evidence": [ { "database": "UniProtKB", "id": "Q9UPT9", "url": "https://www.uniprot.org/uniprotkb/Q9UPT9" }, { "database": "iPTMnet", "id": "Q9UPT9", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9UPT9" }, { "database": "PubMed", "id": "27030811", "url": "https://pubmed.ncbi.nlm.nih.gov/27030811" } ], "site_lbl": "Thr147", "uniprot_canonical_ac": "Q9UPT9-1" }, { "start_pos": 237, "end_pos": 237, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by CDK1", "evidence": [ { "database": "UniProtKB", "id": "Q9UPT9", "url": "https://www.uniprot.org/uniprotkb/Q9UPT9" }, { "database": "iPTMnet", "id": "Q9UPT9", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9UPT9" }, { "database": "PubMed", "id": "19651622", "url": "https://pubmed.ncbi.nlm.nih.gov/19651622" }, { "database": "PubMed", "id": "27030811", "url": "https://pubmed.ncbi.nlm.nih.gov/27030811" } ], "site_lbl": "Ser237", "uniprot_canonical_ac": "Q9UPT9-1" } ], "record_id": "pubmed.27030811", "abstract": "", "glycosylation": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "APC/C and SCF(cyclin F) Constitute a Reciprocal Feedback Circuit Controlling S-Phase Entry.", "journal": "Cell Rep.", "date": "2016", "authors": "Choudhury R, Bonacci T, Arceci A, Lahiri D, Mills CA, Kernan JL, Branigan TB, DeCaprio JA, Burke DJ, Emanuele MJ", "reference": { "type": "PubMed", "id": "27653696", "url": "https://pubmed.ncbi.nlm.nih.gov/27653696" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q12834-1", "protein_name": "Cell division cycle protein 20 homolog", "gene_name": "CDC20", "tax_name": "Human" }, { "uniprot_canonical_ac": "P41002-1", "protein_name": "Cyclin-F", "gene_name": "CCNF", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UM11-1", "protein_name": "Fizzy-related protein homolog", "gene_name": "FZR1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q12834", "url": "https://www.uniprot.org/uniprotkb/Q12834" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 310, "end_pos": 313, "sequence_org": "RYIL", "sequence_mut": "AYIA", "comment": "Reduces the interaction with FZR1/CDH1. Reduced ubiquitination. Abolishes the interaction with FZR1/CDH1; when associated with 351-R--L-354. Loss of ubiquitination and impaired degradation; when associated with 351-R--L-354.", "evidence": [ { "database": "UniProtKB", "id": "P41002", "url": "https://www.uniprot.org/uniprotkb/P41002" }, { "database": "PubMed", "id": "27653696", "url": "https://pubmed.ncbi.nlm.nih.gov/27653696" } ], "uniprot_canonical_ac": "P41002-1" }, { "start_pos": 343, "end_pos": 346, "sequence_org": "RRRL", "sequence_mut": "ARRA", "comment": "Reduces the interaction with FZR1/CDH1.", "evidence": [ { "database": "UniProtKB", "id": "P41002", "url": "https://www.uniprot.org/uniprotkb/P41002" }, { "database": "PubMed", "id": "27653696", "url": "https://pubmed.ncbi.nlm.nih.gov/27653696" } ], "uniprot_canonical_ac": "P41002-1" }, { "start_pos": 349, "end_pos": 352, "sequence_org": "RYRL", "sequence_mut": "AYRA", "comment": "Reduces the interaction with FZR1/CDH1.", "evidence": [ { "database": "UniProtKB", "id": "P41002", "url": "https://www.uniprot.org/uniprotkb/P41002" }, { "database": "PubMed", "id": "27653696", "url": "https://pubmed.ncbi.nlm.nih.gov/27653696" } ], "uniprot_canonical_ac": "P41002-1" }, { "start_pos": 351, "end_pos": 354, "sequence_org": "RLQL", "sequence_mut": "ALQA", "comment": "Reduces the interaction with FZR1/CDH1. Abolishes the interaction with FZR1/CDH1; when associated with 310-R--L-313. Loss of ubiquitination and impaired degradation; when associated with 310-R--L-313.", "evidence": [ { "database": "UniProtKB", "id": "P41002", "url": "https://www.uniprot.org/uniprotkb/P41002" }, { "database": "PubMed", "id": "27653696", "url": "https://pubmed.ncbi.nlm.nih.gov/27653696" } ], "uniprot_canonical_ac": "P41002-1" }, { "start_pos": 767, "end_pos": 770, "sequence_org": "RINL", "sequence_mut": "AINA", "comment": "Reduces the interaction with FZR1/CDH1.", "evidence": [ { "database": "UniProtKB", "id": "P41002", "url": "https://www.uniprot.org/uniprotkb/P41002" }, { "database": "PubMed", "id": "27653696", "url": "https://pubmed.ncbi.nlm.nih.gov/27653696" } ], "uniprot_canonical_ac": "P41002-1" }, { "start_pos": 445, "end_pos": 447, "sequence_org": "RVL", "sequence_mut": "AVA", "comment": "Reduced interaction with CCNF.", "evidence": [ { "database": "UniProtKB", "id": "Q9UM11", "url": "https://www.uniprot.org/uniprotkb/Q9UM11" }, { "database": "PubMed", "id": "27653696", "url": "https://pubmed.ncbi.nlm.nih.gov/27653696" } ], "uniprot_canonical_ac": "Q9UM11-1" }, { "start_pos": 7, "end_pos": 14, "sequence_org": "RRLLRQIV", "sequence_mut": "AAAAAQAA", "comment": "Reduced interaction with CCNF. Impaired degradation.", "evidence": [ { "database": "UniProtKB", "id": "Q9UM11", "url": "https://www.uniprot.org/uniprotkb/Q9UM11" }, { "database": "PubMed", "id": "27653696", "url": "https://pubmed.ncbi.nlm.nih.gov/27653696" } ], "uniprot_canonical_ac": "Q9UM11-1" } ], "record_id": "pubmed.27653696", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Direct interactions of mitotic arrest deficient 1 (MAD1) domains with each other and MAD2 conformers are required for mitotic checkpoint signaling.", "journal": "J. Biol. Chem.", "date": "2018", "authors": "Ji W, Luo Y, Ahmad E, Liu ST", "reference": { "type": "PubMed", "id": "29162720", "url": "https://pubmed.ncbi.nlm.nih.gov/29162720" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q12834-1", "protein_name": "Cell division cycle protein 20 homolog", "gene_name": "CDC20", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13257-1", "protein_name": "Mitotic spindle assembly checkpoint protein MAD2A", "gene_name": "MAD2L1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y6D9-1", "protein_name": "Mitotic spindle assembly checkpoint protein MAD1", "gene_name": "MAD1L1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60566-1", "protein_name": "Mitotic checkpoint serine/threonine-protein kinase BUB1 beta", "gene_name": "BUB1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P33981-1", "protein_name": "Dual specificity protein kinase TTK", "gene_name": "TTK", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q12834", "url": "https://www.uniprot.org/uniprotkb/Q12834" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 13, "end_pos": 13, "sequence_org": "L", "sequence_mut": "A", "comment": "Leads to formation the closed conformation and homodimerization. Reduces binding to MAD1L1.", "evidence": [ { "database": "UniProtKB", "id": "Q13257", "url": "https://www.uniprot.org/uniprotkb/Q13257" }, { "database": "PubMed", "id": "18318601", "url": "https://pubmed.ncbi.nlm.nih.gov/18318601" }, { "database": "PubMed", "id": "29162720", "url": "https://pubmed.ncbi.nlm.nih.gov/29162720" } ], "uniprot_canonical_ac": "Q13257-1" }, { "start_pos": 195, "end_pos": 195, "sequence_org": "S", "sequence_mut": "D", "comment": "Binds to the N and C-terminus of MAD1L1. Abolishes interaction with MAD1L1 and reduces interaction with CDC20; when associated with D-170 and D-178.", "evidence": [ { "database": "UniProtKB", "id": "Q13257", "url": "https://www.uniprot.org/uniprotkb/Q13257" }, { "database": "PubMed", "id": "12574116", "url": "https://pubmed.ncbi.nlm.nih.gov/12574116" }, { "database": "PubMed", "id": "29162720", "url": "https://pubmed.ncbi.nlm.nih.gov/29162720" } ], "uniprot_canonical_ac": "Q13257-1" }, { "start_pos": 1, "end_pos": 485, "sequence_org": "MEDLGENTMVLSTLRSLNNFISQRVEGGSGLDISTSAPGSLQMQYQQSMQLEERAEQIRSKSHLIQVEREKMQMELSHKRARVELERAASTSARNYEREVDRNQELLTRIRQLQEREAGAEEKMQEQLERNRQCQQNLDAASKRLREKEDSLAQAGETINALKGRISELQWSVMDQEMRVKRLESEKQELQEQLDLQHKKCQEANQKIQELQASQEARADHEQQIKDLEQKLSLQEQDAAIVKNMKSELVRLPRLERELKQLREESAHLREMRETNGLLQEELEGLQRKLGRQEKMQETLVGLELENERLLAKLQSWERLDQTMGLSIRTPEDLSRFVVELQQRELALKDKNSAVTSSARGLEKARQQLQEELRQVSGQLLEERKKRETHEALARRLQKRVLLLTKERDGMRAILGSYDSELTPAEYSPQLTRRMREAEDMVQKVHSHSAEMEAQLSQALEELGGQKQRADMLEMELKMLKSQSS", "sequence_mut": "", "comment": "Defective dimerization. Abolishes binding to the closed and open conformations of MAD2L1. Impairs mitotic checkpoint signaling abolishing mitotic arrest, and shortens the duration of mitosis.", "evidence": [ { "database": "UniProtKB", "id": "Q9Y6D9", "url": "https://www.uniprot.org/uniprotkb/Q9Y6D9" }, { "database": "PubMed", "id": "29162720", "url": "https://pubmed.ncbi.nlm.nih.gov/29162720" } ], "uniprot_canonical_ac": "Q9Y6D9-1" }, { "start_pos": 541, "end_pos": 541, "sequence_org": "K", "sequence_mut": "A", "comment": "Abolishes binding to closed and open conformations of MAD2L1 and impairs mitotic checkpint signaling abolishing mitotic arrest, and shortens the duration of mitosis; in association with A-543.", "evidence": [ { "database": "UniProtKB", "id": "Q9Y6D9", "url": "https://www.uniprot.org/uniprotkb/Q9Y6D9" }, { "database": "PubMed", "id": "29162720", "url": "https://pubmed.ncbi.nlm.nih.gov/29162720" } ], "uniprot_canonical_ac": "Q9Y6D9-1" }, { "start_pos": 543, "end_pos": 543, "sequence_org": "L", "sequence_mut": "A", "comment": "Abolishes binding to closed and open conformations of MAD2L1 and impairs mitotic checkpoint signaling abolishing mitotic arrest, and shortens the duration of mitosis; in association with A-541.", "evidence": [ { "database": "UniProtKB", "id": "Q9Y6D9", "url": "https://www.uniprot.org/uniprotkb/Q9Y6D9" }, { "database": "PubMed", "id": "29162720", "url": "https://pubmed.ncbi.nlm.nih.gov/29162720" } ], "uniprot_canonical_ac": "Q9Y6D9-1" }, { "start_pos": 597, "end_pos": 718, "sequence_org": "SSKEVAELKKQVESAELKNQRLKEVFQTKIQEFRKACYTLTGYQIDITTENQYRLTSLYAEHPGDCLIFKATSPSGSKMQLLETEFSHTVGELIEVHLRRQDSIPAFLSSLTLELFSRQTVA", "sequence_mut": "", "comment": "Defective dimerization. Reduces binding to the closed and open conformations of MAD2L1. Impairs mitotic checkpoint signaling abolishing mitotic arrest, and shortens the duration of mitosis.", "evidence": [ { "database": "UniProtKB", "id": "Q9Y6D9", "url": "https://www.uniprot.org/uniprotkb/Q9Y6D9" }, { "database": "PubMed", "id": "29162720", "url": "https://pubmed.ncbi.nlm.nih.gov/29162720" } ], "uniprot_canonical_ac": "Q9Y6D9-1" }, { "start_pos": 598, "end_pos": 598, "sequence_org": "S", "sequence_mut": "A", "comment": "Does not impact the duration of mitosis.", "evidence": [ { "database": "UniProtKB", "id": "Q9Y6D9", "url": "https://www.uniprot.org/uniprotkb/Q9Y6D9" }, { "database": "PubMed", "id": "29162720", "url": "https://pubmed.ncbi.nlm.nih.gov/29162720" } ], "uniprot_canonical_ac": "Q9Y6D9-1" }, { "start_pos": 598, "end_pos": 598, "sequence_org": "S", "sequence_mut": "E", "comment": "Does not impact the duration of mitosis.", "evidence": [ { "database": "UniProtKB", "id": "Q9Y6D9", "url": "https://www.uniprot.org/uniprotkb/Q9Y6D9" }, { "database": "PubMed", "id": "29162720", "url": "https://pubmed.ncbi.nlm.nih.gov/29162720" } ], "uniprot_canonical_ac": "Q9Y6D9-1" }, { "start_pos": 610, "end_pos": 610, "sequence_org": "S", "sequence_mut": "A", "comment": "Impairs mitotic checkpoint signaling and shortens the duration of mitosis.", "evidence": [ { "database": "UniProtKB", "id": "Q9Y6D9", "url": "https://www.uniprot.org/uniprotkb/Q9Y6D9" }, { "database": "PubMed", "id": "29162720", "url": "https://pubmed.ncbi.nlm.nih.gov/29162720" } ], "uniprot_canonical_ac": "Q9Y6D9-1" }, { "start_pos": 610, "end_pos": 610, "sequence_org": "S", "sequence_mut": "E", "comment": "Impairs mitotic checkpoint signaling and shortens the duration of mitosis.", "evidence": [ { "database": "UniProtKB", "id": "Q9Y6D9", "url": "https://www.uniprot.org/uniprotkb/Q9Y6D9" }, { "database": "PubMed", "id": "29162720", "url": "https://pubmed.ncbi.nlm.nih.gov/29162720" } ], "uniprot_canonical_ac": "Q9Y6D9-1" }, { "start_pos": 634, "end_pos": 634, "sequence_org": "Y", "sequence_mut": "E", "comment": "Reduces binding to closed and open conformations of MAD2L1. Impairs mitotic checkpoint signaling abolishing mitotic arrest, and shortens the duration of mitosis.", "evidence": [ { "database": "UniProtKB", "id": "Q9Y6D9", "url": "https://www.uniprot.org/uniprotkb/Q9Y6D9" }, { "database": "PubMed", "id": "29162720", "url": "https://pubmed.ncbi.nlm.nih.gov/29162720" } ], "uniprot_canonical_ac": "Q9Y6D9-1" }, { "start_pos": 634, "end_pos": 634, "sequence_org": "Y", "sequence_mut": "F", "comment": "Reduces binding to closed and open conformations of MAD2L1. Does not impact the duration of mitosis.", "evidence": [ { "database": "UniProtKB", "id": "Q9Y6D9", "url": "https://www.uniprot.org/uniprotkb/Q9Y6D9" }, { "database": "PubMed", "id": "29162720", "url": "https://pubmed.ncbi.nlm.nih.gov/29162720" } ], "uniprot_canonical_ac": "Q9Y6D9-1" }, { "start_pos": 716, "end_pos": 716, "sequence_org": "T", "sequence_mut": "A", "comment": "Reduces binding to closed and open conformations of MAD2L1. Impairs mitotic checkpoint signaling and shortens the duration of mitosis.", "evidence": [ { "database": "UniProtKB", "id": "Q9Y6D9", "url": "https://www.uniprot.org/uniprotkb/Q9Y6D9" }, { "database": "PubMed", "id": "29162720", "url": "https://pubmed.ncbi.nlm.nih.gov/29162720" } ], "uniprot_canonical_ac": "Q9Y6D9-1" }, { "start_pos": 716, "end_pos": 716, "sequence_org": "T", "sequence_mut": "E", "comment": "Reduces binding to closed and open conformations of MAD2L1. Impairs mitotic checkpoint signaling and shortens the duration of mitosis.", "evidence": [ { "database": "UniProtKB", "id": "Q9Y6D9", "url": "https://www.uniprot.org/uniprotkb/Q9Y6D9" }, { "database": "PubMed", "id": "29162720", "url": "https://pubmed.ncbi.nlm.nih.gov/29162720" } ], "uniprot_canonical_ac": "Q9Y6D9-1" } ], "phosphorylation": [ { "start_pos": 598, "end_pos": 598, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "Q9Y6D9", "url": "https://www.uniprot.org/uniprotkb/Q9Y6D9" }, { "database": "PubMed", "id": "29162720", "url": "https://pubmed.ncbi.nlm.nih.gov/29162720" }, { "database": "iPTMnet", "id": "Q9Y6D9", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9Y6D9" } ], "site_lbl": "Ser598", "uniprot_canonical_ac": "Q9Y6D9-1" }, { "start_pos": 610, "end_pos": 610, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "Q9Y6D9", "url": "https://www.uniprot.org/uniprotkb/Q9Y6D9" }, { "database": "PubMed", "id": "29162720", "url": "https://pubmed.ncbi.nlm.nih.gov/29162720" }, { "database": "iPTMnet", "id": "Q9Y6D9", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9Y6D9" } ], "site_lbl": "Ser610", "uniprot_canonical_ac": "Q9Y6D9-1" }, { "start_pos": 634, "end_pos": 634, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "Phosphotyrosine", "evidence": [ { "database": "UniProtKB", "id": "Q9Y6D9", "url": "https://www.uniprot.org/uniprotkb/Q9Y6D9" }, { "database": "PubMed", "id": "29162720", "url": "https://pubmed.ncbi.nlm.nih.gov/29162720" }, { "database": "iPTMnet", "id": "Q9Y6D9", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9Y6D9" } ], "site_lbl": "Tyr634", "uniprot_canonical_ac": "Q9Y6D9-1" }, { "start_pos": 716, "end_pos": 716, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine", "evidence": [ { "database": "UniProtKB", "id": "Q9Y6D9", "url": "https://www.uniprot.org/uniprotkb/Q9Y6D9" }, { "database": "PubMed", "id": "29162720", "url": "https://pubmed.ncbi.nlm.nih.gov/29162720" }, { "database": "iPTMnet", "id": "Q9Y6D9", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9Y6D9" }, { "database": "PubMed", "id": "28072388", "url": "https://pubmed.ncbi.nlm.nih.gov/28072388" }, { "database": "PubMed", "id": "32202322", "url": "https://pubmed.ncbi.nlm.nih.gov/32202322" } ], "site_lbl": "Thr716", "uniprot_canonical_ac": "Q9Y6D9-1" } ], "record_id": "pubmed.29162720", "abstract": "", "glycosylation": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 5 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 4 }, { "field": "total_sites", "count": 4 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Degradation of FBXO31 by APC/C is regulated by AKT- and ATM-mediated phosphorylation.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2018", "authors": "Choppara S, Malonia SK, Sankaran G, Green MR, Santra MK", "reference": { "type": "PubMed", "id": "29343641", "url": "https://pubmed.ncbi.nlm.nih.gov/29343641" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q12834-1", "protein_name": "Cell division cycle protein 20 homolog", "gene_name": "CDC20", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5XUX0-1", "protein_name": "F-box only protein 31", "gene_name": "FBXO31", "tax_name": "Human" }, { "uniprot_canonical_ac": "P31749-1", "protein_name": "RAC-alpha serine/threonine-protein kinase", "gene_name": "AKT1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q12834", "url": "https://www.uniprot.org/uniprotkb/Q12834" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 33, "end_pos": 33, "sequence_org": "S", "sequence_mut": "A", "comment": "Abolished phosphorylation by AKT1.", "evidence": [ { "database": "UniProtKB", "id": "Q5XUX0", "url": "https://www.uniprot.org/uniprotkb/Q5XUX0" }, { "database": "PubMed", "id": "29343641", "url": "https://pubmed.ncbi.nlm.nih.gov/29343641" } ], "uniprot_canonical_ac": "Q5XUX0-1" }, { "start_pos": 64, "end_pos": 67, "sequence_org": "RCSL", "sequence_mut": "ACSA", "comment": "Abolished ubiquitination and degradation by the APC/C complex.", "evidence": [ { "database": "UniProtKB", "id": "Q5XUX0", "url": "https://www.uniprot.org/uniprotkb/Q5XUX0" }, { "database": "PubMed", "id": "29343641", "url": "https://pubmed.ncbi.nlm.nih.gov/29343641" } ], "uniprot_canonical_ac": "Q5XUX0-1" } ], "phosphorylation": [ { "start_pos": 278, "end_pos": 278, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by ATM", "evidence": [ { "database": "UniProtKB", "id": "Q5XUX0", "url": "https://www.uniprot.org/uniprotkb/Q5XUX0" }, { "database": "iPTMnet", "id": "Q5XUX0", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q5XUX0" }, { "database": "PubMed", "id": "29343641", "url": "https://pubmed.ncbi.nlm.nih.gov/29343641" }, { "database": "PubMed", "id": "30171069", "url": "https://pubmed.ncbi.nlm.nih.gov/30171069" }, { "database": "PubMed", "id": "19412162", "url": "https://pubmed.ncbi.nlm.nih.gov/19412162" } ], "site_lbl": "Ser278", "uniprot_canonical_ac": "Q5XUX0-1" }, { "start_pos": 33, "end_pos": 33, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "Q5XUX0", "url": "https://www.uniprot.org/uniprotkb/Q5XUX0" }, { "database": "iPTMnet", "id": "Q5XUX0", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q5XUX0" }, { "database": "PubMed", "id": "29343641", "url": "https://pubmed.ncbi.nlm.nih.gov/29343641" } ], "site_lbl": "Ser33", "uniprot_canonical_ac": "Q5XUX0-1" } ], "record_id": "pubmed.29343641", "abstract": "", "glycosylation": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Biallelic mutations in CDC20 cause female infertility characterized by abnormalities in oocyte maturation and early embryonic development.", "journal": "Protein & cell", "date": "2020", "authors": "Zhao L, Xue S, Yao Z, Shi J, Chen B, Wu L, Sun L, Xu Y, Yan Z, Li B, Mao X, Fu J, Zhang Z, Mu J, Wang W, Du J, Liu S, Dong J, Wang W, Li Q, He L, Jin L, Liang X, Kuang Y, Sun X, Wang L, Sang Q", "reference": { "type": "PubMed", "id": "32666501", "url": "https://pubmed.ncbi.nlm.nih.gov/32666501" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q12834-1", "protein_name": "Cell division cycle protein 20 homolog", "gene_name": "CDC20", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9JJ66-1", "protein_name": "Cell division cycle protein 20 homolog", "gene_name": "Cdc20", "tax_name": "Mouse" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q12834", "url": "https://www.uniprot.org/uniprotkb/Q12834" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.32666501", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Premature aging syndrome showing random chromosome number instabilities with CDC20 mutation.", "journal": "Aging cell", "date": "2020-11", "authors": "Fujita Harumi, Sasaki Takashi, Miyamoto Tatsuo, Akutsu Silvia Natsuko, Sato Showbu, Mori Takehiko, Nakabayashi Kazuhiko, Hata Kenichiro, Suzuki Hisato, Kosaki Kenjiro, Matsuura Shinya, Matsubara Yoichi, Amagai Masayuki, Kubo Akiharu", "reference": { "type": "PubMed", "id": "33094908", "url": "https://pubmed.ncbi.nlm.nih.gov/33094908" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q12834-1", "protein_name": "Cell division cycle protein 20 homolog", "gene_name": "CDC20", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60566-1", "protein_name": "Mitotic checkpoint serine/threonine-protein kinase BUB1 beta", "gene_name": "BUB1B", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q12834", "url": "https://www.uniprot.org/uniprotkb/Q12834" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.33094908", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Novel Mutations in CDC20 Are Associated with Female Infertility Due to Oocyte Maturation Abnormality and Early Embryonic Arrest.", "journal": "Reproductive sciences (Thousand Oaks, Calif.)", "date": "2021-07", "authors": "Huang Lingli, Wang Fengsong, Kong Shuai, Wang Yu, Song Gaojie, Lu Fangting, Ji Jingjuan, Luo Lihua, Tong Xianhong", "reference": { "type": "PubMed", "id": "33683667", "url": "https://pubmed.ncbi.nlm.nih.gov/33683667" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q12834-1", "protein_name": "Cell division cycle protein 20 homolog", "gene_name": "CDC20", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q12834", "url": "https://www.uniprot.org/uniprotkb/Q12834" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.33683667", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Identification of Novel Mutations in CDC20: Expanding the Mutational Spectrum for Female Infertility.", "journal": "Frontiers in cell and developmental biology", "date": "2021", "authors": "Zhao Lin, Guan Yichun, Meng Qingxia, Wang Weijie, Wu Ling, Chen Biaobang, Hu Jijun, Zhu Jiawei, Zhang Zhihua, Mu Jian, Chen Yao, Sun Yiming, Wu Tianyu, Wang Wenjing, Zhou Zhou, Dong Jie, Zeng Yang, Liu Ruyi, Li Qiaoli, Du Jing, Kuang Yanping, Sang Qing, Wang Lei", "reference": { "type": "PubMed", "id": "33898437", "url": "https://pubmed.ncbi.nlm.nih.gov/33898437" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q12834-1", "protein_name": "Cell division cycle protein 20 homolog", "gene_name": "CDC20", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q12834", "url": "https://www.uniprot.org/uniprotkb/Q12834" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.33898437", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The homozygous p.Tyr228Cys variant in CDC20 causes oocyte maturation arrest: an additional evidence supporting the causality between CDC20 mutation and female infertility.", "journal": "Journal of assisted reproduction and genetics", "date": "2021-08", "authors": "Xu Yao, Zhu Xiuxian, Wang Miao, Cai Luyi, Ge Qiulin, Fu Yonglun, Jin Liping", "reference": { "type": "PubMed", "id": "34218387", "url": "https://pubmed.ncbi.nlm.nih.gov/34218387" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q12834-1", "protein_name": "Cell division cycle protein 20 homolog", "gene_name": "CDC20", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q12834", "url": "https://www.uniprot.org/uniprotkb/Q12834" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.34218387", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Role of ubiquitin-protein ligase UBR5 in the disassembly of mitotic checkpoint complexes.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2022", "authors": "Kaisari S, Miniowitz-Shemtov S, Sitry-Shevah D, Shomer P, Kozlov G, Gehring K, Hershko A", "reference": { "type": "PubMed", "id": "35217622", "url": "https://pubmed.ncbi.nlm.nih.gov/35217622" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q12834-1", "protein_name": "Cell division cycle protein 20 homolog", "gene_name": "CDC20", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95071-1", "protein_name": "E3 ubiquitin-protein ligase UBR5", "gene_name": "UBR5", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43684-1", "protein_name": "Mitotic checkpoint protein BUB3", "gene_name": "BUB3", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60566-1", "protein_name": "Mitotic checkpoint serine/threonine-protein kinase BUB1 beta", "gene_name": "BUB1B", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q12834", "url": "https://www.uniprot.org/uniprotkb/Q12834" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.35217622", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 4 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Orphan quality control shapes network dynamics and gene expression.", "journal": "Cell", "date": "2023-08-03", "authors": "Mark Kevin G, Kolla SriDurgaDevi, Aguirre Jacob D, Garshott Danielle M, Schmitt Stefan, Haakonsen Diane L, Xu Christina, Kater Lukas, Kempf Georg, Mart\u00ednez-Gonz\u00e1lez Brenda, Akopian David, See Stephanie K, Thom\u00e4 Nicolas H, Rap\u00e9 Michael", "reference": { "type": "PubMed", "id": "37478862", "url": "https://pubmed.ncbi.nlm.nih.gov/37478862" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q12834-1", "protein_name": "Cell division cycle protein 20 homolog", "gene_name": "CDC20", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96EZ8-1", "protein_name": "Microspherule protein 1", "gene_name": "MCRS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95071-1", "protein_name": "E3 ubiquitin-protein ligase UBR5", "gene_name": "UBR5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01106-2", "protein_name": "Myc proto-oncogene protein", "gene_name": "MYC", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00267-1", "protein_name": "Transcription elongation factor SPT5", "gene_name": "SUPT5H", "tax_name": "Human" }, { "uniprot_canonical_ac": "P63272-1", "protein_name": "Transcription elongation factor SPT4", "gene_name": "SUPT4H1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q12834", "url": "https://www.uniprot.org/uniprotkb/Q12834" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 2768, "end_pos": 2768, "sequence_org": "C", "sequence_mut": "A", "comment": "Loss of E3 ubiquitin-protein ligase activity.", "evidence": [ { "database": "UniProtKB", "id": "O95071", "url": "https://www.uniprot.org/uniprotkb/O95071" }, { "database": "PubMed", "id": "11287654", "url": "https://pubmed.ncbi.nlm.nih.gov/11287654" }, { "database": "PubMed", "id": "37620400", "url": "https://pubmed.ncbi.nlm.nih.gov/37620400" }, { "database": "PubMed", "id": "37040767", "url": "https://pubmed.ncbi.nlm.nih.gov/37040767" }, { "database": "PubMed", "id": "23027739", "url": "https://pubmed.ncbi.nlm.nih.gov/23027739" }, { "database": "PubMed", "id": "28689657", "url": "https://pubmed.ncbi.nlm.nih.gov/28689657" }, { "database": "PubMed", "id": "37478862", "url": "https://pubmed.ncbi.nlm.nih.gov/37478862" } ], "uniprot_canonical_ac": "O95071-1" }, { "start_pos": 2768, "end_pos": 2768, "sequence_org": "C", "sequence_mut": "S", "comment": "Loss of E3 ubiquitin-protein ligase activity.", "evidence": [ { "database": "UniProtKB", "id": "O95071", "url": "https://www.uniprot.org/uniprotkb/O95071" }, { "database": "PubMed", "id": "11287654", "url": "https://pubmed.ncbi.nlm.nih.gov/11287654" }, { "database": "PubMed", "id": "37620400", "url": "https://pubmed.ncbi.nlm.nih.gov/37620400" }, { "database": "PubMed", "id": "37040767", "url": "https://pubmed.ncbi.nlm.nih.gov/37040767" }, { "database": "PubMed", "id": "23027739", "url": "https://pubmed.ncbi.nlm.nih.gov/23027739" }, { "database": "PubMed", "id": "28689657", "url": "https://pubmed.ncbi.nlm.nih.gov/28689657" }, { "database": "PubMed", "id": "37478862", "url": "https://pubmed.ncbi.nlm.nih.gov/37478862" } ], "uniprot_canonical_ac": "O95071-1" } ], "record_id": "pubmed.37478862", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 6 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Functional analysis of Cdc20 reveals a critical role of CRY box in mitotic checkpoint signaling.", "journal": "Communications biology", "date": "2024-02-09", "authors": "Zhang Yuqing, Young Rose, Garvanska Dimitriya H, Song Chunlin, Zhai Yujing, Wang Ying, Jiang Hongfei, Fang Jing, Nilsson Jakob, Alfieri Claudio, Zhang Gang", "reference": { "type": "PubMed", "id": "38337031", "url": "https://pubmed.ncbi.nlm.nih.gov/38337031" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q12834-1", "protein_name": "Cell division cycle protein 20 homolog", "gene_name": "CDC20", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q12834", "url": "https://www.uniprot.org/uniprotkb/Q12834" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.38337031", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "CCDC68 Maintains Mitotic Checkpoint Activation by Promoting CDC20 Integration into the MCC.", "journal": "Advanced science (Weinheim, Baden-Wurttemberg, Germany)", "date": "2024-09", "authors": "Li Qi, Chen Qingzhou, Zheng Tao, Wang Fulin, Teng Junlin, Zhou Haining, Chen Jianguo", "reference": { "type": "PubMed", "id": "39018254", "url": "https://pubmed.ncbi.nlm.nih.gov/39018254" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q12834-1", "protein_name": "Cell division cycle protein 20 homolog", "gene_name": "CDC20", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H2F9-1", "protein_name": "Coiled-coil domain-containing protein 68", "gene_name": "CCDC68", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q12834", "url": "https://www.uniprot.org/uniprotkb/Q12834" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.39018254", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The Mitotic Checkpoint Complex controls the association of Cdc20 regulatory protein with the ubiquitin ligase APC/C in mitosis.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2024-09-10", "authors": "Sitry-Shevah Danielle, Miniowitz-Shemtov Shirly, Liburkin Dan Tanya, Hershko Avram", "reference": { "type": "PubMed", "id": "39231204", "url": "https://pubmed.ncbi.nlm.nih.gov/39231204" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q12834-1", "protein_name": "Cell division cycle protein 20 homolog", "gene_name": "CDC20", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q12834", "url": "https://www.uniprot.org/uniprotkb/Q12834" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.39231204", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "A novel mammalian protein, p55CDC, present in dividing cells is associated with protein kinase activity and has homology to the Saccharomyces cerevisiae cell division cycle proteins Cdc20 and Cdc4.", "journal": "Mol. Cell. Biol.", "date": "1994", "authors": "Weinstein J, Jacobsen F W, Hsu-Chen J, Wu T, Baum L G", "reference": { "type": "PubMed", "id": "7513050", "url": "https://pubmed.ncbi.nlm.nih.gov/7513050" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q12834-1", "protein_name": "Cell division cycle protein 20 homolog", "gene_name": "CDC20", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q62623-1", "protein_name": "Cell division cycle protein 20 homolog", "gene_name": "Cdc20", "tax_name": "Rat" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q12834", "url": "https://www.uniprot.org/uniprotkb/Q12834" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.7513050", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The checkpoint protein MAD2 and the mitotic regulator CDC20 form a ternary complex with the anaphase-promoting complex to control anaphase initiation.", "journal": "Genes & development", "date": "1998", "authors": "Fang G, Yu H, Kirschner MW", "reference": { "type": "PubMed", "id": "9637688", "url": "https://pubmed.ncbi.nlm.nih.gov/9637688" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q12834-1", "protein_name": "Cell division cycle protein 20 homolog", "gene_name": "CDC20", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13257-1", "protein_name": "Mitotic spindle assembly checkpoint protein MAD2A", "gene_name": "MAD2L1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q12834", "url": "https://www.uniprot.org/uniprotkb/Q12834" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.9637688", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Direct binding of CDC20 protein family members activates the anaphase-promoting complex in mitosis and G1.", "journal": "Molecular cell", "date": "1998", "authors": "Fang G, Yu H, Kirschner MW", "reference": { "type": "PubMed", "id": "9734353", "url": "https://pubmed.ncbi.nlm.nih.gov/9734353" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q12834-1", "protein_name": "Cell division cycle protein 20 homolog", "gene_name": "CDC20", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UM11-1", "protein_name": "Fizzy-related protein homolog", "gene_name": "FZR1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q12834", "url": "https://www.uniprot.org/uniprotkb/Q12834" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.9734353", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Activation of the human anaphase-promoting complex by proteins of the CDC20/Fizzy family.", "journal": "Current biology : CB", "date": "1998", "authors": "Kramer ER, Gieffers C, Holzl G, Hengstschlager M, Peters JM", "reference": { "type": "PubMed", "id": "9811605", "url": "https://pubmed.ncbi.nlm.nih.gov/9811605" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q12834-1", "protein_name": "Cell division cycle protein 20 homolog", "gene_name": "CDC20", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UM11-1", "protein_name": "Fizzy-related protein homolog", "gene_name": "FZR1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q12834", "url": "https://www.uniprot.org/uniprotkb/Q12834" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.9811605", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Gene expression profiling predicts clinical outcome of breast cancer.", "journal": "Nature", "date": "2002", "authors": "van 't Veer Laura J, Dai Hongyue, van de Vijver Marc J, He Yudong D, Hart Augustinus A M, Mao Mao, Peterse Hans L, van der Kooy Karin, Marton Matthew J, Witteveen Anke T, Schreiber George J, Kerkhoven Ron M, Roberts Chris, Linsley Peter S, Bernards Ren\u00e9, Friend Stephen H", "reference": { "type": "PubMed", "id": "11823860", "url": "https://pubmed.ncbi.nlm.nih.gov/11823860" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q86UE4-1", "protein_name": "Protein LYRIC", "gene_name": "MTDH", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q86UE4", "url": "https://www.uniprot.org/uniprotkb/Q86UE4" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.11823860", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "3D3/lyric: a novel transmembrane protein of the endoplasmic reticulum and nuclear envelope, which is also present in the nucleolus.", "journal": "Exp. Cell Res.", "date": "2004", "authors": "Sutherland HG, Lam YW, Briers S, Lamond AI, Bickmore WA", "reference": { "type": "PubMed", "id": "14980505", "url": "https://pubmed.ncbi.nlm.nih.gov/14980505" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q86UE4-1", "protein_name": "Protein LYRIC", "gene_name": "MTDH", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q80WJ7-1", "protein_name": "Protein LYRIC", "gene_name": "Mtdh", "tax_name": "Mouse" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q86UE4", "url": "https://www.uniprot.org/uniprotkb/Q86UE4" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.14980505", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Metadherin, a cell surface protein in breast tumors that mediates lung metastasis.", "journal": "Cancer Cell", "date": "2004", "authors": "Brown DM, Ruoslahti E", "reference": { "type": "PubMed", "id": "15093543", "url": "https://pubmed.ncbi.nlm.nih.gov/15093543" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q86UE4-1", "protein_name": "Protein LYRIC", "gene_name": "MTDH", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q80WJ7-1", "protein_name": "Protein LYRIC", "gene_name": "Mtdh", "tax_name": "Mouse" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q86UE4", "url": "https://www.uniprot.org/uniprotkb/Q86UE4" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.15093543", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Identification of a novel protein, LYRIC, localized to tight junctions of polarized epithelial cells.", "journal": "Exp. Cell Res.", "date": "2004", "authors": "Britt DE, Yang DF, Yang DQ, Flanagan D, Callanan H, Lim YP, Lin SH, Hixson DC", "reference": { "type": "PubMed", "id": "15383321", "url": "https://pubmed.ncbi.nlm.nih.gov/15383321" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q86UE4-1", "protein_name": "Protein LYRIC", "gene_name": "MTDH", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Z1W6-1", "protein_name": "Protein LYRIC", "gene_name": "Mtdh", "tax_name": "Rat" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q86UE4", "url": "https://www.uniprot.org/uniprotkb/Q86UE4" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.15383321", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Cloning and characterization of HIV-1-inducible astrocyte elevated gene-1, AEG-1.", "journal": "Gene", "date": "2005-06-20", "authors": "Kang Dong-Chul, Su Zao-Zhong, Sarkar Devanand, Emdad Luni, Volsky David J, Fisher Paul B", "reference": { "type": "PubMed", "id": "15927426", "url": "https://pubmed.ncbi.nlm.nih.gov/15927426" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q86UE4-1", "protein_name": "Protein LYRIC", "gene_name": "MTDH", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q86UE4", "url": "https://www.uniprot.org/uniprotkb/Q86UE4" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.15927426", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Activation of the nuclear factor kappaB pathway by astrocyte elevated gene-1: implications for tumor progression and metastasis.", "journal": "Cancer research", "date": "2006-02-01", "authors": "Emdad Luni, Sarkar Devanand, Su Zao-zhong, Randolph Aaron, Boukerche Habib, Valerie Kristoffer, Fisher Paul B", "reference": { "type": "PubMed", "id": "16452207", "url": "https://pubmed.ncbi.nlm.nih.gov/16452207" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q86UE4-1", "protein_name": "Protein LYRIC", "gene_name": "MTDH", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q04206-1", "protein_name": "Transcription factor p65", "gene_name": "RELA", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q86UE4", "url": "https://www.uniprot.org/uniprotkb/Q86UE4" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.16452207", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "LYRIC/AEG-1 overexpression modulates BCCIPalpha protein levels in prostate tumor cells.", "journal": "Biochem. Biophys. Res. Commun.", "date": "2008", "authors": "Ash SC, Yang DQ, Britt DE", "reference": { "type": "PubMed", "id": "18440304", "url": "https://pubmed.ncbi.nlm.nih.gov/18440304" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q86UE4-1", "protein_name": "Protein LYRIC", "gene_name": "MTDH", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9P287-1", "protein_name": "BRCA2 and CDKN1A-interacting protein", "gene_name": "BCCIP", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q86UE4", "url": "https://www.uniprot.org/uniprotkb/Q86UE4" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.18440304", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "MTDH activation by 8q22 genomic gain promotes chemoresistance and metastasis of poor-prognosis breast cancer.", "journal": "Cancer cell", "date": "2009-01-06", "authors": "Hu Guohong, Chong Robert A, Yang Qifeng, Wei Yong, Blanco Mario A, Li Feng, Reiss Michael, Au Jessie L-S, Haffty Bruce G, Kang Yibin", "reference": { "type": "PubMed", "id": "19111877", "url": "https://pubmed.ncbi.nlm.nih.gov/19111877" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q86UE4-1", "protein_name": "Protein LYRIC", "gene_name": "MTDH", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q86UE4", "url": "https://www.uniprot.org/uniprotkb/Q86UE4" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.19111877", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Identification of novel signaling components in N,N'-dinitrosopiperazine-mediated metastasis of nasopharyngeal carcinoma by quantitative phosphoproteomics.", "journal": "BMC cancer", "date": "2014-04-05", "authors": "Huang Damao, Li Yuejin, Liu Na, Zhang Zhenlin, Peng Zhengke, Duan Chaojun, Tang Xiaowei, Tan Gongjun, Yan Guangrong, Tang Faqing", "reference": { "type": "PubMed", "id": "24708550", "url": "https://pubmed.ncbi.nlm.nih.gov/24708550" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q86UE4-1", "protein_name": "Protein LYRIC", "gene_name": "MTDH", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q86UE4", "url": "https://www.uniprot.org/uniprotkb/Q86UE4" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 568, "end_pos": 568, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "Q86UE4", "url": "https://www.uniprot.org/uniprotkb/Q86UE4" }, { "database": "PubMed", "id": "18669648", "url": "https://pubmed.ncbi.nlm.nih.gov/18669648" }, { "database": "PubMed", "id": "23186163", "url": "https://pubmed.ncbi.nlm.nih.gov/23186163" }, { "database": "iPTMnet", "id": "Q86UE4", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q86UE4" }, { "database": "PubMed", "id": "19651622", "url": "https://pubmed.ncbi.nlm.nih.gov/19651622" }, { "database": "PubMed", "id": "20068231", "url": "https://pubmed.ncbi.nlm.nih.gov/20068231" }, { "database": "IEDB", "id": "Q86UE4", "url": "https://www.iedb.org/epitope/Q86UE4" }, { "database": "PubMed", "id": "35494241", "url": "https://pubmed.ncbi.nlm.nih.gov/35494241" }, { "database": "PubMed", "id": "24708550", "url": "https://pubmed.ncbi.nlm.nih.gov/24708550" } ], "site_lbl": "Ser568", "uniprot_canonical_ac": "Q86UE4-1" } ], "record_id": "pubmed.24708550", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Quantitative analysis of the TNF-alpha-induced phosphoproteome reveals AEG-1/MTDH/LYRIC as an IKKbeta substrate.", "journal": "Nature communications", "date": "2015", "authors": "Krishnan RK, Nolte H, Sun T, Kaur H, Sreenivasan K, Looso M, Offermanns S, Kruger M, Swiercz JM", "reference": { "type": "PubMed", "id": "25849741", "url": "https://pubmed.ncbi.nlm.nih.gov/25849741" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q86UE4-1", "protein_name": "Protein LYRIC", "gene_name": "MTDH", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q86UE4", "url": "https://www.uniprot.org/uniprotkb/Q86UE4" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 298, "end_pos": 298, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "Q86UE4", "url": "https://www.uniprot.org/uniprotkb/Q86UE4" }, { "database": "PubMed", "id": "21406692", "url": "https://pubmed.ncbi.nlm.nih.gov/21406692" }, { "database": "PubMed", "id": "18669648", "url": "https://pubmed.ncbi.nlm.nih.gov/18669648" }, { "database": "PubMed", "id": "17081983", "url": "https://pubmed.ncbi.nlm.nih.gov/17081983" }, { "database": "PubMed", "id": "24275569", "url": "https://pubmed.ncbi.nlm.nih.gov/24275569" }, { "database": "PubMed", "id": "20068231", "url": "https://pubmed.ncbi.nlm.nih.gov/20068231" }, { "database": "PubMed", "id": "18088087", "url": "https://pubmed.ncbi.nlm.nih.gov/18088087" }, { "database": "PubMed", "id": "23186163", "url": "https://pubmed.ncbi.nlm.nih.gov/23186163" }, { "database": "iPTMnet", "id": "Q86UE4", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q86UE4" }, { "database": "PubMed", "id": "18578522", "url": "https://pubmed.ncbi.nlm.nih.gov/18578522" }, { "database": "PubMed", "id": "18767875", "url": "https://pubmed.ncbi.nlm.nih.gov/18767875" }, { "database": "PubMed", "id": "19413330", "url": "https://pubmed.ncbi.nlm.nih.gov/19413330" }, { "database": "PubMed", "id": "19651622", "url": "https://pubmed.ncbi.nlm.nih.gov/19651622" }, { "database": "PubMed", "id": "20166139", "url": "https://pubmed.ncbi.nlm.nih.gov/20166139" }, { "database": "PubMed", "id": "25849741", "url": "https://pubmed.ncbi.nlm.nih.gov/25849741" } ], "site_lbl": "Ser298", "uniprot_canonical_ac": "Q86UE4-1" } ], "record_id": "pubmed.25849741", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "HIV-1 gp120 amplifies astrocyte elevated gene-1 activity to compromise the integrity of the outer blood-retinal barrier.", "journal": "AIDS (London, England)", "date": "2024-05-01", "authors": "Jiang Jing, Wang Luoziyi, Li Qingjian, Wang Yucen, Wang Zhiliang", "reference": { "type": "PubMed", "id": "38578957", "url": "https://pubmed.ncbi.nlm.nih.gov/38578957" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q86UE4-1", "protein_name": "Protein LYRIC", "gene_name": "MTDH", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q86UE4", "url": "https://www.uniprot.org/uniprotkb/Q86UE4" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.38578957", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Plasma metadherin mRNA expression in bladder cancer.", "journal": "The Egyptian journal of immunology", "date": "2024-04", "authors": "Abd Elhameed Zeinab A, Tag El Din Lubna M, Sherif Tahra, Abdel Aal Amal M, Moeen Ahmed M, Abd El Hakeem Esraa N, Abdelrahman Eman M", "reference": { "type": "PubMed", "id": "38615202", "url": "https://pubmed.ncbi.nlm.nih.gov/38615202" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q86UE4-1", "protein_name": "Protein LYRIC", "gene_name": "MTDH", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q86UE4", "url": "https://www.uniprot.org/uniprotkb/Q86UE4" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.38615202", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "USP7 promotes cervical cancer progression by stabilizing MTDH expression through deubiquitination.", "journal": "Journal of cancer research and clinical oncology", "date": "2024-04-16", "authors": "Wang Na, Xu Jing, Wang Yujing, Zhang Xuejiao, Zhang Hongzhen", "reference": { "type": "PubMed", "id": "38625581", "url": "https://pubmed.ncbi.nlm.nih.gov/38625581" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q86UE4-1", "protein_name": "Protein LYRIC", "gene_name": "MTDH", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q86UE4", "url": "https://www.uniprot.org/uniprotkb/Q86UE4" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.38625581", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "A Study on the Binding Mechanism and the Impact of Key Residue Mutations between SND1 and MTDH Peptide through Molecular Dynamics Simulations.", "journal": "The journal of physical chemistry. B", "date": "2024-09-26", "authors": "Liu Senchen, Hao Xiafei, Miao Dongqiang, Zhang Yanjun", "reference": { "type": "PubMed", "id": "39276108", "url": "https://pubmed.ncbi.nlm.nih.gov/39276108" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q86UE4-1", "protein_name": "Protein LYRIC", "gene_name": "MTDH", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q7KZF4-1", "protein_name": "Staphylococcal nuclease domain-containing protein 1", "gene_name": "SND1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q86UE4", "url": "https://www.uniprot.org/uniprotkb/Q86UE4" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.39276108", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Mammalian miRNA RISC recruits CAF1 and PABP to affect PABP-dependent deadenylation.", "journal": "Mol. Cell", "date": "2009", "authors": "Fabian MR, Mathonnet G, Sundermeier T, Mathys H, Zipprich JT, Svitkin YV, Rivas F, Jinek M, Wohlschlegel J, Doudna JA, Chen CY, Shyu AB, Yates JR 3rd, Hannon GJ, Filipowicz W, Duchaine TF, Sonenberg N", "reference": { "type": "PubMed", "id": "19716330", "url": "https://pubmed.ncbi.nlm.nih.gov/19716330" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9HCJ0-3", "protein_name": "Trinucleotide repeat-containing gene 6C protein", "gene_name": "TNRC6C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q60809-1", "protein_name": "CCR4-NOT transcription complex subunit 7", "gene_name": "Cnot7", "tax_name": "Mouse" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9HCJ0", "url": "https://www.uniprot.org/uniprotkb/Q9HCJ0" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.19716330", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "miRNA repression involves GW182-mediated recruitment of CCR4-NOT through conserved W-containing motifs.", "journal": "Nature structural & molecular biology", "date": "2011", "authors": "Chekulaeva M, Mathys H, Zipprich JT, Attig J, Colic M, Parker R, Filipowicz W", "reference": { "type": "PubMed", "id": "21984184", "url": "https://pubmed.ncbi.nlm.nih.gov/21984184" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9HCJ0-3", "protein_name": "Trinucleotide repeat-containing gene 6C protein", "gene_name": "TNRC6C", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9HCJ0", "url": "https://www.uniprot.org/uniprotkb/Q9HCJ0" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 1691, "end_pos": 1691, "sequence_org": "W", "sequence_mut": "A", "comment": "Abolishes translational repression when tethered to a target mRNA, abolishes association with the CCR4-NOT complex; when associated with A-1733, A-1740, A-1750, A-1761, A-1851 and A-1894.", "evidence": [ { "database": "UniProtKB", "id": "Q9HCJ0", "url": "https://www.uniprot.org/uniprotkb/Q9HCJ0" }, { "database": "PubMed", "id": "21984184", "url": "https://pubmed.ncbi.nlm.nih.gov/21984184" } ], "uniprot_canonical_ac": "Q9HCJ0-3" }, { "start_pos": 1733, "end_pos": 1733, "sequence_org": "W", "sequence_mut": "A", "comment": "Abolishes translational repression when tethered to a target mRNA, abolishes association with the CCR4-NOT complex; when associated with A-1691, A-1740, A-1750, A-1761, A-1851 and A-1894.", "evidence": [ { "database": "UniProtKB", "id": "Q9HCJ0", "url": "https://www.uniprot.org/uniprotkb/Q9HCJ0" }, { "database": "PubMed", "id": "21984184", "url": "https://pubmed.ncbi.nlm.nih.gov/21984184" } ], "uniprot_canonical_ac": "Q9HCJ0-3" }, { "start_pos": 1740, "end_pos": 1740, "sequence_org": "W", "sequence_mut": "A", "comment": "Abolishes translational repression when tethered to a target mRNA, abolishes association with the CCR4-NOT complex; when associated with A-1691, A-1733, A-1750, A-1761, A-1851 and A-1894.", "evidence": [ { "database": "UniProtKB", "id": "Q9HCJ0", "url": "https://www.uniprot.org/uniprotkb/Q9HCJ0" }, { "database": "PubMed", "id": "21984184", "url": "https://pubmed.ncbi.nlm.nih.gov/21984184" } ], "uniprot_canonical_ac": "Q9HCJ0-3" }, { "start_pos": 1750, "end_pos": 1750, "sequence_org": "W", "sequence_mut": "A", "comment": "Abolishes translational repression when tethered to a target mRNA, abolishes association with the CCR4-NOT complex; when associated with A-1691, A-1733, A-1740, A-1761, A-1851 and A-1894.", "evidence": [ { "database": "UniProtKB", "id": "Q9HCJ0", "url": "https://www.uniprot.org/uniprotkb/Q9HCJ0" }, { "database": "PubMed", "id": "21984184", "url": "https://pubmed.ncbi.nlm.nih.gov/21984184" } ], "uniprot_canonical_ac": "Q9HCJ0-3" }, { "start_pos": 1761, "end_pos": 1761, "sequence_org": "W", "sequence_mut": "A", "comment": "Abolishes translational repression when tethered to a target mRNA, abolishes association with the CCR4-NOT complex; when associated with A-1691, A-1733, A-1740, A-1750, A-1851 and A-1894.", "evidence": [ { "database": "UniProtKB", "id": "Q9HCJ0", "url": "https://www.uniprot.org/uniprotkb/Q9HCJ0" }, { "database": "PubMed", "id": "21984184", "url": "https://pubmed.ncbi.nlm.nih.gov/21984184" } ], "uniprot_canonical_ac": "Q9HCJ0-3" }, { "start_pos": 1851, "end_pos": 1851, "sequence_org": "W", "sequence_mut": "A", "comment": "Abolishes translational repression when tethered to a target mRNA, abolishes association with the CCR4-NOT complex; when associated with A-1691, A-1733, A-1740, A-1750, A-1761 and A-1894.", "evidence": [ { "database": "UniProtKB", "id": "Q9HCJ0", "url": "https://www.uniprot.org/uniprotkb/Q9HCJ0" }, { "database": "PubMed", "id": "21984184", "url": "https://pubmed.ncbi.nlm.nih.gov/21984184" } ], "uniprot_canonical_ac": "Q9HCJ0-3" }, { "start_pos": 1894, "end_pos": 1894, "sequence_org": "W", "sequence_mut": "A", "comment": "Abolishes translational repression when tethered to a target mRNA, abolishes association with the CCR4-NOT complex; when associated with A-1691, A-1733, A-1740, A-1750, A-1761 and A-1851.", "evidence": [ { "database": "UniProtKB", "id": "Q9HCJ0", "url": "https://www.uniprot.org/uniprotkb/Q9HCJ0" }, { "database": "PubMed", "id": "21984184", "url": "https://pubmed.ncbi.nlm.nih.gov/21984184" } ], "uniprot_canonical_ac": "Q9HCJ0-3" } ], "record_id": "pubmed.21984184", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Expression of TNRC6 (GW182) Proteins Is Not Necessary for Gene Silencing by Fully Complementary RNA Duplexes.", "journal": "Nucleic acid therapeutics", "date": "2019", "authors": "Liu Z, Johnson ST, Zhang Z, Corey DR", "reference": { "type": "PubMed", "id": "31670606", "url": "https://pubmed.ncbi.nlm.nih.gov/31670606" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9HCJ0-3", "protein_name": "Trinucleotide repeat-containing gene 6C protein", "gene_name": "TNRC6C", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9HCJ0", "url": "https://www.uniprot.org/uniprotkb/Q9HCJ0" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.31670606", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Massively parallel reporter assays discover de novo exonic splicing mutants in paralogs of Autism genes.", "journal": "PLoS genetics", "date": "2022", "authors": "Rhine CL, Neil C, Wang J, Maguire S, Buerer L, Salomon M, Meremikwu IC, Kim J, Strande NT, Fairbrother WG", "reference": { "type": "PubMed", "id": "35051175", "url": "https://pubmed.ncbi.nlm.nih.gov/35051175" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9HCJ0-3", "protein_name": "Trinucleotide repeat-containing gene 6C protein", "gene_name": "TNRC6C", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9HCJ0", "url": "https://www.uniprot.org/uniprotkb/Q9HCJ0" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.35051175", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Cargo-selected transport from the mitochondria to peroxisomes is mediated by vesicular carriers.", "journal": "Current biology : CB", "date": "2008", "authors": "Neuspiel M, Schauss AC, Braschi E, Zunino R, Rippstein P, Rachubinski RA, Andrade-Navarro MA, McBride HM", "reference": { "type": "PubMed", "id": "18207745", "url": "https://pubmed.ncbi.nlm.nih.gov/18207745" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q969V5-1", "protein_name": "Mitochondrial ubiquitin ligase activator of NFKB 1", "gene_name": "MUL1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q969V5", "url": "https://www.uniprot.org/uniprotkb/Q969V5" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.18207745", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Genome-wide and functional annotation of human E3 ubiquitin ligases identifies MULAN, a mitochondrial E3 that regulates the organelle's dynamics and signaling.", "journal": "PloS one", "date": "2008", "authors": "Li W, Bengtson MH, Ulbrich A, Matsuda A, Reddy VA, Orth A, Chanda SK, Batalov S, Joazeiro CA", "reference": { "type": "PubMed", "id": "18213395", "url": "https://pubmed.ncbi.nlm.nih.gov/18213395" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q969V5-1", "protein_name": "Mitochondrial ubiquitin ligase activator of NFKB 1", "gene_name": "MUL1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q969V5", "url": "https://www.uniprot.org/uniprotkb/Q969V5" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 260, "end_pos": 260, "sequence_org": "R", "sequence_mut": "A", "comment": "Protein is targeted to the ER; when associated with A-261.", "evidence": [ { "database": "UniProtKB", "id": "Q969V5", "url": "https://www.uniprot.org/uniprotkb/Q969V5" }, { "database": "PubMed", "id": "18213395", "url": "https://pubmed.ncbi.nlm.nih.gov/18213395" } ], "uniprot_canonical_ac": "Q969V5-1" }, { "start_pos": 261, "end_pos": 261, "sequence_org": "K", "sequence_mut": "A", "comment": "Protein is targeted to the ER; when associated with A-260.", "evidence": [ { "database": "UniProtKB", "id": "Q969V5", "url": "https://www.uniprot.org/uniprotkb/Q969V5" }, { "database": "PubMed", "id": "18213395", "url": "https://pubmed.ncbi.nlm.nih.gov/18213395" } ], "uniprot_canonical_ac": "Q969V5-1" }, { "start_pos": 339, "end_pos": 339, "sequence_org": "C", "sequence_mut": "A", "comment": "Abolishes ligase activity.", "evidence": [ { "database": "UniProtKB", "id": "Q969V5", "url": "https://www.uniprot.org/uniprotkb/Q969V5" }, { "database": "PubMed", "id": "18213395", "url": "https://pubmed.ncbi.nlm.nih.gov/18213395" } ], "uniprot_canonical_ac": "Q969V5-1" } ], "record_id": "pubmed.18213395", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "GIDE is a mitochondrial E3 ubiquitin ligase that induces apoptosis and slows growth.", "journal": "Cell research", "date": "2008", "authors": "Zhang B, Huang J, Li HL, Liu T, Wang YY, Waterman P, Mao AP, Xu LG, Zhai Z, Liu D, Marrack P, Shu HB", "reference": { "type": "PubMed", "id": "18591963", "url": "https://pubmed.ncbi.nlm.nih.gov/18591963" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q969V5-1", "protein_name": "Mitochondrial ubiquitin ligase activator of NFKB 1", "gene_name": "MUL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8VCM5-1", "protein_name": "Mitochondrial ubiquitin ligase activator of NFKB 1", "gene_name": "Mul1", "tax_name": "Mouse" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q969V5", "url": "https://www.uniprot.org/uniprotkb/Q969V5" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 319, "end_pos": 319, "sequence_org": "H", "sequence_mut": "A", "comment": "Abolishes ligase activity. No effect on mitochondrial localization.", "evidence": [ { "database": "UniProtKB", "id": "Q969V5", "url": "https://www.uniprot.org/uniprotkb/Q969V5" }, { "database": "PubMed", "id": "18591963", "url": "https://pubmed.ncbi.nlm.nih.gov/18591963" } ], "uniprot_canonical_ac": "Q969V5-1" } ], "record_id": "pubmed.18591963", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "MAPL is a new mitochondrial SUMO E3 ligase that regulates mitochondrial fission.", "journal": "EMBO reports", "date": "2009", "authors": "Braschi E, Zunino R, McBride HM", "reference": { "type": "PubMed", "id": "19407830", "url": "https://pubmed.ncbi.nlm.nih.gov/19407830" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q969V5-1", "protein_name": "Mitochondrial ubiquitin ligase activator of NFKB 1", "gene_name": "MUL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00429-1", "protein_name": "Dynamin-1-like protein", "gene_name": "DNM1L", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q969V5", "url": "https://www.uniprot.org/uniprotkb/Q969V5" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.19407830", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "E3 ubiquitin ligase Hades negatively regulates the exonuclear function of p53.", "journal": "Cell death and differentiation", "date": "2011", "authors": "Jung JH, Bae S, Lee JY, Woo SR, Cha HJ, Yoon Y, Suh KS, Lee SJ, Park IC, Jin YW, Lee KH, An S, Lee JH", "reference": { "type": "PubMed", "id": "21597459", "url": "https://pubmed.ncbi.nlm.nih.gov/21597459" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q969V5-1", "protein_name": "Mitochondrial ubiquitin ligase activator of NFKB 1", "gene_name": "MUL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04637-1", "protein_name": "Cellular tumor antigen p53", "gene_name": "TP53", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q969V5", "url": "https://www.uniprot.org/uniprotkb/Q969V5" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 302, "end_pos": 302, "sequence_org": "C", "sequence_mut": "S", "comment": "Failure to reduce TP53 levels and abolishes ligase activity; when associated with S-305.", "evidence": [ { "database": "UniProtKB", "id": "Q969V5", "url": "https://www.uniprot.org/uniprotkb/Q969V5" }, { "database": "PubMed", "id": "21597459", "url": "https://pubmed.ncbi.nlm.nih.gov/21597459" } ], "uniprot_canonical_ac": "Q969V5-1" }, { "start_pos": 305, "end_pos": 305, "sequence_org": "C", "sequence_mut": "S", "comment": "Failure to reduce TP53 levels and abolishes ligase activity; when associated with S-302.", "evidence": [ { "database": "UniProtKB", "id": "Q969V5", "url": "https://www.uniprot.org/uniprotkb/Q969V5" }, { "database": "PubMed", "id": "21597459", "url": "https://pubmed.ncbi.nlm.nih.gov/21597459" } ], "uniprot_canonical_ac": "Q969V5-1" }, { "start_pos": 24, "end_pos": 24, "sequence_org": "K", "sequence_mut": "R", "comment": "Abolishes ubiquitination by MUL1.", "evidence": [ { "database": "UniProtKB", "id": "P04637", "url": "https://www.uniprot.org/uniprotkb/P04637" }, { "database": "PubMed", "id": "21597459", "url": "https://pubmed.ncbi.nlm.nih.gov/21597459" } ], "uniprot_canonical_ac": "P04637-1" }, { "start_pos": 24, "end_pos": 24, "sequence_org": "K", "sequence_mut": "R", "comment": "Abolishes ubiquitination by MUL1.", "evidence": [ { "database": "UniProtKB", "id": "P04637", "url": "https://www.uniprot.org/uniprotkb/P04637" }, { "database": "PubMed", "id": "21597459", "url": "https://pubmed.ncbi.nlm.nih.gov/21597459" } ], "uniprot_canonical_ac": "P04637-1" } ], "record_id": "pubmed.21597459", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Akt is negatively regulated by the MULAN E3 ligase.", "journal": "Cell research", "date": "2012", "authors": "Bae S, Kim SY, Jung JH, Yoon Y, Cha HJ, Lee H, Kim K, Kim J, An IS, Kim J, Um HD, Park IC, Lee SJ, Nam SY, Jin YW, Lee JH, An S", "reference": { "type": "PubMed", "id": "22410793", "url": "https://pubmed.ncbi.nlm.nih.gov/22410793" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q969V5-1", "protein_name": "Mitochondrial ubiquitin ligase activator of NFKB 1", "gene_name": "MUL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P31749-1", "protein_name": "RAC-alpha serine/threonine-protein kinase", "gene_name": "AKT1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q969V5", "url": "https://www.uniprot.org/uniprotkb/Q969V5" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.22410793", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Mitochondrially localised MUL1 is a novel modulator of antiviral signaling.", "journal": "Immunology and cell biology", "date": "2013", "authors": "Jenkins K, Khoo JJ, Sadler A, Piganis R, Wang D, Borg NA, Hjerrild K, Gould J, Thomas BJ, Nagley P, Hertzog PJ, Mansell A", "reference": { "type": "PubMed", "id": "23399697", "url": "https://pubmed.ncbi.nlm.nih.gov/23399697" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q969V5-1", "protein_name": "Mitochondrial ubiquitin ligase activator of NFKB 1", "gene_name": "MUL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95786-1", "protein_name": "Antiviral innate immune response receptor RIG-I", "gene_name": "DDX58; RIGI", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q7Z434-1", "protein_name": "Mitochondrial antiviral-signaling protein", "gene_name": "MAVS", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q969V5", "url": "https://www.uniprot.org/uniprotkb/Q969V5" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.23399697", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "MUL1 acts in parallel to the PINK1/parkin pathway in regulating mitofusin and compensates for loss of PINK1/parkin.", "journal": "eLife", "date": "2014", "authors": "Yun J, Puri R, Yang H, Lizzio MA, Wu C, Sheng ZH, Guo M", "reference": { "type": "PubMed", "id": "24898855", "url": "https://pubmed.ncbi.nlm.nih.gov/24898855" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q969V5-1", "protein_name": "Mitochondrial ubiquitin ligase activator of NFKB 1", "gene_name": "MUL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9WVS6-1", "protein_name": "E3 ubiquitin-protein ligase parkin", "gene_name": "Prkn", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "Q8VCM5-1", "protein_name": "Mitochondrial ubiquitin ligase activator of NFKB 1", "gene_name": "Mul1", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "Q7KTX7-1", "protein_name": "E3 ubiquitin-protein ligase parkin", "gene_name": "park", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q7YU24-1", "protein_name": "Transmembrane GTPase Marf", "gene_name": "Marf", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q9VZJ9-1", "protein_name": "Mitochondrial E3 ubiquitin protein ligase 1", "gene_name": "Mul1", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "O60260-1", "protein_name": "E3 ubiquitin-protein ligase parkin", "gene_name": "PRKN", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BXM7-1", "protein_name": "Serine/threonine-protein kinase PINK1, mitochondrial", "gene_name": "PINK1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q969V5", "url": "https://www.uniprot.org/uniprotkb/Q969V5" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 307, "end_pos": 307, "sequence_org": "H", "sequence_mut": "A", "comment": "Abolishes ligase activity.", "evidence": [ { "database": "UniProtKB", "id": "Q9VZJ9", "url": "https://www.uniprot.org/uniprotkb/Q9VZJ9" }, { "database": "PubMed", "id": "24898855", "url": "https://pubmed.ncbi.nlm.nih.gov/24898855" } ], "uniprot_canonical_ac": "Q9VZJ9-1" } ], "record_id": "pubmed.24898855", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 8 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "A new functional role of mitochondria-anchored protein ligase in peroxisome morphology in mammalian cells.", "journal": "Journal of cellular biochemistry", "date": "2021", "authors": "Mohanty A, Zunino R, Soubannier V, Dilipkumar S", "reference": { "type": "PubMed", "id": "34322908", "url": "https://pubmed.ncbi.nlm.nih.gov/34322908" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q969V5-1", "protein_name": "Mitochondrial ubiquitin ligase activator of NFKB 1", "gene_name": "MUL1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q969V5", "url": "https://www.uniprot.org/uniprotkb/Q969V5" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.34322908", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "MUL1 identified as mitochondria-linked biomarker promoting cisplatin resistance in OC cells.", "journal": "Gene", "date": "2024-12-20", "authors": "Liu Lixiao, Zou Chengyang, Shen Jingtian, Huang Rong, Zhang Fubin, Du Yongming, Luo Xishao, Yang Aiwu, Zhang Jinsan, Guan Yutao, Yan Xiaojian", "reference": { "type": "PubMed", "id": "39134101", "url": "https://pubmed.ncbi.nlm.nih.gov/39134101" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q969V5-1", "protein_name": "Mitochondrial ubiquitin ligase activator of NFKB 1", "gene_name": "MUL1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q969V5", "url": "https://www.uniprot.org/uniprotkb/Q969V5" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.39134101", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Alternative splice variants of the human centrosome kinase Nek2 exhibit distinct patterns of expression in mitosis.", "journal": "The Biochemical journal", "date": "2002", "authors": "Hames RS, Fry AM", "reference": { "type": "PubMed", "id": "11742531", "url": "https://pubmed.ncbi.nlm.nih.gov/11742531" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P51955-1", "protein_name": "Serine/threonine-protein kinase Nek2", "gene_name": "NEK2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P51955", "url": "https://www.uniprot.org/uniprotkb/P51955" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.11742531", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Nek2A kinase stimulates centrosome disjunction and is required for formation of bipolar mitotic spindles.", "journal": "Molecular biology of the cell", "date": "2003-07", "authors": "Faragher Alison J, Fry Andrew M", "reference": { "type": "PubMed", "id": "12857871", "url": "https://pubmed.ncbi.nlm.nih.gov/12857871" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P51955-1", "protein_name": "Serine/threonine-protein kinase Nek2", "gene_name": "NEK2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P51955", "url": "https://www.uniprot.org/uniprotkb/P51955" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.12857871", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "NEK2A interacts with MAD1 and possibly functions as a novel integrator of the spindle checkpoint signaling.", "journal": "The Journal of biological chemistry", "date": "2004", "authors": "Lou Y, Yao J, Zereshki A, Dou Z, Ahmed K, Wang H, Hu J, Wang Y, Yao X", "reference": { "type": "PubMed", "id": "14978040", "url": "https://pubmed.ncbi.nlm.nih.gov/14978040" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P51955-1", "protein_name": "Serine/threonine-protein kinase Nek2", "gene_name": "NEK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13257-1", "protein_name": "Mitotic spindle assembly checkpoint protein MAD2A", "gene_name": "MAD2L1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14777-1", "protein_name": "Kinetochore protein NDC80 homolog", "gene_name": "NDC80", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y6D9-1", "protein_name": "Mitotic spindle assembly checkpoint protein MAD1", "gene_name": "MAD1L1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P51955", "url": "https://www.uniprot.org/uniprotkb/P51955" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.14978040", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 4 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Nucleolar Nek11 is a novel target of Nek2A in G1/S-arrested cells.", "journal": "The Journal of biological chemistry", "date": "2004", "authors": "Noguchi K, Fukazawa H, Murakami Y, Uehara Y", "reference": { "type": "PubMed", "id": "15161910", "url": "https://pubmed.ncbi.nlm.nih.gov/15161910" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P51955-1", "protein_name": "Serine/threonine-protein kinase Nek2", "gene_name": "NEK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NG66-1", "protein_name": "Serine/threonine-protein kinase Nek11", "gene_name": "NEK11", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P51955", "url": "https://www.uniprot.org/uniprotkb/P51955" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 37, "end_pos": 37, "sequence_org": "K", "sequence_mut": "R", "comment": "Loss of kinase activity and of ability to activate NEK11. Loss of phosphorylation of CCDC102B.", "evidence": [ { "database": "UniProtKB", "id": "P51955", "url": "https://www.uniprot.org/uniprotkb/P51955" }, { "database": "PubMed", "id": "30404835", "url": "https://pubmed.ncbi.nlm.nih.gov/30404835" }, { "database": "PubMed", "id": "15161910", "url": "https://pubmed.ncbi.nlm.nih.gov/15161910" }, { "database": "PubMed", "id": "17197699", "url": "https://pubmed.ncbi.nlm.nih.gov/17197699" } ], "uniprot_canonical_ac": "P51955-1" } ], "record_id": "pubmed.15161910", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Nek2A specifies the centrosomal localization of Erk2.", "journal": "Biochemical and biophysical research communications", "date": "2004-08-20", "authors": "Lou Yang, Xie Wei, Zhang Dong-Fang, Yao Jian-hui, Luo Zhao-feng, Wang Yu-Zhen, Shi Yun-Yu, Yao Xue-Biao", "reference": { "type": "PubMed", "id": "15358203", "url": "https://pubmed.ncbi.nlm.nih.gov/15358203" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P51955-1", "protein_name": "Serine/threonine-protein kinase Nek2", "gene_name": "NEK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P28482-1", "protein_name": "Mitogen-activated protein kinase 1", "gene_name": "MAPK1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P51955", "url": "https://www.uniprot.org/uniprotkb/P51955" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.15358203", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Nek2A kinase regulates the localization of numatrin to centrosome in mitosis.", "journal": "FEBS letters", "date": "2004", "authors": "Yao J, Fu C, Ding X, Guo Z, Zenreski A, Chen Y, Ahmed K, Liao J, Dou Z, Yao X", "reference": { "type": "PubMed", "id": "15388344", "url": "https://pubmed.ncbi.nlm.nih.gov/15388344" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P51955-1", "protein_name": "Serine/threonine-protein kinase Nek2", "gene_name": "NEK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06748-1", "protein_name": "Nucleophosmin", "gene_name": "NPM1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P51955", "url": "https://www.uniprot.org/uniprotkb/P51955" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.15388344", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Alternatively spliced protein variants as potential therapeutic targets for male infertility and contraception.", "journal": "Ann. N. Y. Acad. Sci.", "date": "2004", "authors": "Fardilha M, Wu W, Sa R, Fidalgo S, Sousa C, Mota C, da Cruz e Silva OA, da Cruz e Silva EF", "reference": { "type": "PubMed", "id": "15659832", "url": "https://pubmed.ncbi.nlm.nih.gov/15659832" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P51955-1", "protein_name": "Serine/threonine-protein kinase Nek2", "gene_name": "NEK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P36873-1", "protein_name": "Serine/threonine-protein phosphatase PP1-gamma catalytic subunit", "gene_name": "PPP1CC", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P51955", "url": "https://www.uniprot.org/uniprotkb/P51955" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.15659832", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Caught Nek-ing: cilia and centrioles.", "journal": "J. Cell Sci.", "date": "2005", "authors": "Quarmby Lynne M, Mahjoub Moe R", "reference": { "type": "PubMed", "id": "16280549", "url": "https://pubmed.ncbi.nlm.nih.gov/16280549" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P51955-1", "protein_name": "Serine/threonine-protein kinase Nek2", "gene_name": "NEK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HC98-1", "protein_name": "Serine/threonine-protein kinase Nek6", "gene_name": "NEK6", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P51955", "url": "https://www.uniprot.org/uniprotkb/P51955" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.16280549", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Structure and regulation of the human Nek2 centrosomal kinase.", "journal": "The Journal of biological chemistry", "date": "2007", "authors": "Rellos P, Ivins FJ, Baxter JE, Pike A, Nott TJ, Parkinson DM, Das S, Howell S, Fedorov O, Shen QY, Fry AM, Knapp S, Smerdon SJ", "reference": { "type": "PubMed", "id": "17197699", "url": "https://pubmed.ncbi.nlm.nih.gov/17197699" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P51955-1", "protein_name": "Serine/threonine-protein kinase Nek2", "gene_name": "NEK2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P51955", "url": "https://www.uniprot.org/uniprotkb/P51955" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 141, "end_pos": 141, "sequence_org": "D", "sequence_mut": "A", "comment": "Loss of autophosphorylation.", "evidence": [ { "database": "UniProtKB", "id": "P51955", "url": "https://www.uniprot.org/uniprotkb/P51955" }, { "database": "PubMed", "id": "17197699", "url": "https://pubmed.ncbi.nlm.nih.gov/17197699" } ], "uniprot_canonical_ac": "P51955-1" }, { "start_pos": 170, "end_pos": 170, "sequence_org": "T", "sequence_mut": "A", "comment": "No effect on kinase activity.", "evidence": [ { "database": "UniProtKB", "id": "P51955", "url": "https://www.uniprot.org/uniprotkb/P51955" }, { "database": "PubMed", "id": "17197699", "url": "https://pubmed.ncbi.nlm.nih.gov/17197699" } ], "uniprot_canonical_ac": "P51955-1" }, { "start_pos": 170, "end_pos": 170, "sequence_org": "T", "sequence_mut": "E", "comment": "Kinase activity increased by two fold.", "evidence": [ { "database": "UniProtKB", "id": "P51955", "url": "https://www.uniprot.org/uniprotkb/P51955" }, { "database": "PubMed", "id": "17197699", "url": "https://pubmed.ncbi.nlm.nih.gov/17197699" } ], "uniprot_canonical_ac": "P51955-1" }, { "start_pos": 171, "end_pos": 171, "sequence_org": "S", "sequence_mut": "A", "comment": "No effect on kinase activity.", "evidence": [ { "database": "UniProtKB", "id": "P51955", "url": "https://www.uniprot.org/uniprotkb/P51955" }, { "database": "PubMed", "id": "17197699", "url": "https://pubmed.ncbi.nlm.nih.gov/17197699" } ], "uniprot_canonical_ac": "P51955-1" }, { "start_pos": 171, "end_pos": 171, "sequence_org": "S", "sequence_mut": "D", "comment": "Kinase activity increased by two fold.", "evidence": [ { "database": "UniProtKB", "id": "P51955", "url": "https://www.uniprot.org/uniprotkb/P51955" }, { "database": "PubMed", "id": "17197699", "url": "https://pubmed.ncbi.nlm.nih.gov/17197699" } ], "uniprot_canonical_ac": "P51955-1" }, { "start_pos": 175, "end_pos": 175, "sequence_org": "T", "sequence_mut": "A", "comment": "Kinase activity decreased by two fold.", "evidence": [ { "database": "UniProtKB", "id": "P51955", "url": "https://www.uniprot.org/uniprotkb/P51955" }, { "database": "PubMed", "id": "17197699", "url": "https://pubmed.ncbi.nlm.nih.gov/17197699" } ], "uniprot_canonical_ac": "P51955-1" }, { "start_pos": 175, "end_pos": 175, "sequence_org": "T", "sequence_mut": "E", "comment": "Kinase activity increased by two fold.", "evidence": [ { "database": "UniProtKB", "id": "P51955", "url": "https://www.uniprot.org/uniprotkb/P51955" }, { "database": "PubMed", "id": "17197699", "url": "https://pubmed.ncbi.nlm.nih.gov/17197699" } ], "uniprot_canonical_ac": "P51955-1" }, { "start_pos": 179, "end_pos": 179, "sequence_org": "T", "sequence_mut": "A", "comment": "Loss of kinase activity.", "evidence": [ { "database": "UniProtKB", "id": "P51955", "url": "https://www.uniprot.org/uniprotkb/P51955" }, { "database": "PubMed", "id": "17197699", "url": "https://pubmed.ncbi.nlm.nih.gov/17197699" } ], "uniprot_canonical_ac": "P51955-1" }, { "start_pos": 179, "end_pos": 179, "sequence_org": "T", "sequence_mut": "E", "comment": "Loss of kinase activity.", "evidence": [ { "database": "UniProtKB", "id": "P51955", "url": "https://www.uniprot.org/uniprotkb/P51955" }, { "database": "PubMed", "id": "17197699", "url": "https://pubmed.ncbi.nlm.nih.gov/17197699" } ], "uniprot_canonical_ac": "P51955-1" }, { "start_pos": 241, "end_pos": 241, "sequence_org": "S", "sequence_mut": "A", "comment": "Loss of kinase activity.", "evidence": [ { "database": "UniProtKB", "id": "P51955", "url": "https://www.uniprot.org/uniprotkb/P51955" }, { "database": "PubMed", "id": "17197699", "url": "https://pubmed.ncbi.nlm.nih.gov/17197699" } ], "uniprot_canonical_ac": "P51955-1" }, { "start_pos": 241, "end_pos": 241, "sequence_org": "S", "sequence_mut": "D", "comment": "Loss of kinase activity.", "evidence": [ { "database": "UniProtKB", "id": "P51955", "url": "https://www.uniprot.org/uniprotkb/P51955" }, { "database": "PubMed", "id": "17197699", "url": "https://pubmed.ncbi.nlm.nih.gov/17197699" } ], "uniprot_canonical_ac": "P51955-1" }, { "start_pos": 37, "end_pos": 37, "sequence_org": "K", "sequence_mut": "R", "comment": "Loss of kinase activity and of ability to activate NEK11. Loss of phosphorylation of CCDC102B.", "evidence": [ { "database": "UniProtKB", "id": "P51955", "url": "https://www.uniprot.org/uniprotkb/P51955" }, { "database": "PubMed", "id": "30404835", "url": "https://pubmed.ncbi.nlm.nih.gov/30404835" }, { "database": "PubMed", "id": "15161910", "url": "https://pubmed.ncbi.nlm.nih.gov/15161910" }, { "database": "PubMed", "id": "17197699", "url": "https://pubmed.ncbi.nlm.nih.gov/17197699" } ], "uniprot_canonical_ac": "P51955-1" } ], "phosphorylation": [ { "start_pos": 170, "end_pos": 170, "kinase_uniprot_canonical_ac": "P51955-1", "kinase_gene_name": "NEK2", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P51955", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P51955" }, { "database": "PubMed", "id": "17197699", "url": "https://pubmed.ncbi.nlm.nih.gov/17197699" }, { "database": "UniProtKB", "id": "P51955", "url": "https://www.uniprot.org/uniprotkb/P51955" } ], "site_lbl": "Thr170", "uniprot_canonical_ac": "P51955-1" }, { "start_pos": 171, "end_pos": 171, "kinase_uniprot_canonical_ac": "P51955-1", "kinase_gene_name": "NEK2", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P51955", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P51955" }, { "database": "PubMed", "id": "17197699", "url": "https://pubmed.ncbi.nlm.nih.gov/17197699" }, { "database": "UniProtKB", "id": "P51955", "url": "https://www.uniprot.org/uniprotkb/P51955" } ], "site_lbl": "Ser171", "uniprot_canonical_ac": "P51955-1" }, { "start_pos": 175, "end_pos": 175, "kinase_uniprot_canonical_ac": "P51955-1", "kinase_gene_name": "NEK2", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P51955", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P51955" }, { "database": "PubMed", "id": "17197699", "url": "https://pubmed.ncbi.nlm.nih.gov/17197699" }, { "database": "UniProtKB", "id": "P51955", "url": "https://www.uniprot.org/uniprotkb/P51955" } ], "site_lbl": "Thr175", "uniprot_canonical_ac": "P51955-1" }, { "start_pos": 179, "end_pos": 179, "kinase_uniprot_canonical_ac": "P51955-1", "kinase_gene_name": "NEK2", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P51955", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P51955" }, { "database": "PubMed", "id": "17197699", "url": "https://pubmed.ncbi.nlm.nih.gov/17197699" }, { "database": "UniProtKB", "id": "P51955", "url": "https://www.uniprot.org/uniprotkb/P51955" } ], "site_lbl": "Thr179", "uniprot_canonical_ac": "P51955-1" }, { "start_pos": 241, "end_pos": 241, "kinase_uniprot_canonical_ac": "P51955-1", "kinase_gene_name": "NEK2", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P51955", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P51955" }, { "database": "PubMed", "id": "17197699", "url": "https://pubmed.ncbi.nlm.nih.gov/17197699" }, { "database": "UniProtKB", "id": "P51955", "url": "https://www.uniprot.org/uniprotkb/P51955" } ], "site_lbl": "Ser241", "uniprot_canonical_ac": "P51955-1" }, { "start_pos": 356, "end_pos": 356, "kinase_uniprot_canonical_ac": "P51955-1", "kinase_gene_name": "NEK2", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P51955", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P51955" }, { "database": "PubMed", "id": "17197699", "url": "https://pubmed.ncbi.nlm.nih.gov/17197699" } ], "site_lbl": "Ser356", "uniprot_canonical_ac": "P51955-1" }, { "start_pos": 356, "end_pos": 356, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by STK3/MST2", "evidence": [ { "database": "UniProtKB", "id": "P51955", "url": "https://www.uniprot.org/uniprotkb/P51955" }, { "database": "iPTMnet", "id": "P51955", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P51955" }, { "database": "PubMed", "id": "17197699", "url": "https://pubmed.ncbi.nlm.nih.gov/17197699" }, { "database": "PubMed", "id": "21076410", "url": "https://pubmed.ncbi.nlm.nih.gov/21076410" } ], "site_lbl": "Ser356", "uniprot_canonical_ac": "P51955-1" }, { "start_pos": 387, "end_pos": 387, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P51955", "url": "https://www.uniprot.org/uniprotkb/P51955" }, { "database": "PubMed", "id": "17197699", "url": "https://pubmed.ncbi.nlm.nih.gov/17197699" }, { "database": "iPTMnet", "id": "P51955", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P51955" } ], "site_lbl": "Ser387", "uniprot_canonical_ac": "P51955-1" }, { "start_pos": 390, "end_pos": 390, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P51955", "url": "https://www.uniprot.org/uniprotkb/P51955" }, { "database": "PubMed", "id": "17197699", "url": "https://pubmed.ncbi.nlm.nih.gov/17197699" }, { "database": "iPTMnet", "id": "P51955", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P51955" } ], "site_lbl": "Ser390", "uniprot_canonical_ac": "P51955-1" }, { "start_pos": 397, "end_pos": 397, "kinase_uniprot_canonical_ac": "P51955-1", "kinase_gene_name": "NEK2", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P51955", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P51955" }, { "database": "PubMed", "id": "17197699", "url": "https://pubmed.ncbi.nlm.nih.gov/17197699" } ], "site_lbl": "Ser397", "uniprot_canonical_ac": "P51955-1" }, { "start_pos": 397, "end_pos": 397, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P51955", "url": "https://www.uniprot.org/uniprotkb/P51955" }, { "database": "PubMed", "id": "18088087", "url": "https://pubmed.ncbi.nlm.nih.gov/18088087" }, { "database": "PubMed", "id": "17197699", "url": "https://pubmed.ncbi.nlm.nih.gov/17197699" }, { "database": "iPTMnet", "id": "P51955", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P51955" } ], "site_lbl": "Ser397", "uniprot_canonical_ac": "P51955-1" }, { "start_pos": 402, "end_pos": 402, "kinase_uniprot_canonical_ac": "P51955-1", "kinase_gene_name": "NEK2", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P51955", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P51955" }, { "database": "PubMed", "id": "17197699", "url": "https://pubmed.ncbi.nlm.nih.gov/17197699" } ], "site_lbl": "Ser402", "uniprot_canonical_ac": "P51955-1" }, { "start_pos": 402, "end_pos": 402, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P51955", "url": "https://www.uniprot.org/uniprotkb/P51955" }, { "database": "PubMed", "id": "17197699", "url": "https://pubmed.ncbi.nlm.nih.gov/17197699" }, { "database": "iPTMnet", "id": "P51955", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P51955" } ], "site_lbl": "Ser402", "uniprot_canonical_ac": "P51955-1" }, { "start_pos": 428, "end_pos": 428, "kinase_uniprot_canonical_ac": "P51955-1", "kinase_gene_name": "NEK2", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P51955", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P51955" }, { "database": "PubMed", "id": "17197699", "url": "https://pubmed.ncbi.nlm.nih.gov/17197699" } ], "site_lbl": "Ser428", "uniprot_canonical_ac": "P51955-1" }, { "start_pos": 428, "end_pos": 428, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P51955", "url": "https://www.uniprot.org/uniprotkb/P51955" }, { "database": "PubMed", "id": "17197699", "url": "https://pubmed.ncbi.nlm.nih.gov/17197699" }, { "database": "iPTMnet", "id": "P51955", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P51955" } ], "site_lbl": "Ser428", "uniprot_canonical_ac": "P51955-1" } ], "record_id": "pubmed.17197699", "abstract": "", "glycosylation": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 15 }, { "field": "total_sites", "count": 11 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Protein phosphatase-1alpha regulates centrosome splitting through Nek2.", "journal": "Cancer research", "date": "2007-02-01", "authors": "Mi Jun, Guo Changyue, Brautigan David L, Larner James M", "reference": { "type": "PubMed", "id": "17283141", "url": "https://pubmed.ncbi.nlm.nih.gov/17283141" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P51955-1", "protein_name": "Serine/threonine-protein kinase Nek2", "gene_name": "NEK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62136-1", "protein_name": "Serine/threonine-protein phosphatase PP1-alpha catalytic subunit", "gene_name": "PPP1CA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P36873-1", "protein_name": "Serine/threonine-protein phosphatase PP1-gamma catalytic subunit", "gene_name": "PPP1CC", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P51955", "url": "https://www.uniprot.org/uniprotkb/P51955" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.17283141", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Phosphorylation of human Sgo1 by NEK2A is essential for chromosome congression in mitosis.", "journal": "Cell research", "date": "2007", "authors": "Fu G, Ding X, Yuan K, Aikhionbare F, Yao J, Cai X, Jiang K, Yao X", "reference": { "type": "PubMed", "id": "17621308", "url": "https://pubmed.ncbi.nlm.nih.gov/17621308" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P51955-1", "protein_name": "Serine/threonine-protein kinase Nek2", "gene_name": "NEK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5FBB7-1", "protein_name": "Shugoshin 1", "gene_name": "SGO1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P51955", "url": "https://www.uniprot.org/uniprotkb/P51955" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 14, "end_pos": 14, "sequence_org": "S", "sequence_mut": "A", "comment": "Loss of phosphorylation and presence of misaligned chromosomes; when associated with A-507.", "evidence": [ { "database": "UniProtKB", "id": "Q5FBB7", "url": "https://www.uniprot.org/uniprotkb/Q5FBB7" }, { "database": "PubMed", "id": "17621308", "url": "https://pubmed.ncbi.nlm.nih.gov/17621308" } ], "uniprot_canonical_ac": "Q5FBB7-1" }, { "start_pos": 507, "end_pos": 507, "sequence_org": "S", "sequence_mut": "A", "comment": "Loss of phosphorylation; and presence of misaligned chromosomes; when associated with A-14.", "evidence": [ { "database": "UniProtKB", "id": "Q5FBB7", "url": "https://www.uniprot.org/uniprotkb/Q5FBB7" }, { "database": "PubMed", "id": "17621308", "url": "https://pubmed.ncbi.nlm.nih.gov/17621308" } ], "uniprot_canonical_ac": "Q5FBB7-1" } ], "phosphorylation": [ { "start_pos": 14, "end_pos": 14, "kinase_uniprot_canonical_ac": "P51955-1", "kinase_gene_name": "NEK2", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q5FBB7", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q5FBB7" }, { "database": "PubMed", "id": "17621308", "url": "https://pubmed.ncbi.nlm.nih.gov/17621308" } ], "site_lbl": "Ser14", "uniprot_canonical_ac": "Q5FBB7-1" }, { "start_pos": 14, "end_pos": 14, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by NEK2", "evidence": [ { "database": "UniProtKB", "id": "Q5FBB7", "url": "https://www.uniprot.org/uniprotkb/Q5FBB7" }, { "database": "iPTMnet", "id": "Q5FBB7", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q5FBB7" }, { "database": "PubMed", "id": "17621308", "url": "https://pubmed.ncbi.nlm.nih.gov/17621308" } ], "site_lbl": "Ser14", "uniprot_canonical_ac": "Q5FBB7-1" }, { "start_pos": 507, "end_pos": 507, "kinase_uniprot_canonical_ac": "P51955-1", "kinase_gene_name": "NEK2", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q5FBB7", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q5FBB7" }, { "database": "PubMed", "id": "17621308", "url": "https://pubmed.ncbi.nlm.nih.gov/17621308" } ], "site_lbl": "Ser507", "uniprot_canonical_ac": "Q5FBB7-1" }, { "start_pos": 507, "end_pos": 507, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by NEK2", "evidence": [ { "database": "UniProtKB", "id": "Q5FBB7", "url": "https://www.uniprot.org/uniprotkb/Q5FBB7" }, { "database": "iPTMnet", "id": "Q5FBB7", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q5FBB7" }, { "database": "PubMed", "id": "18669648", "url": "https://pubmed.ncbi.nlm.nih.gov/18669648" }, { "database": "PubMed", "id": "20068231", "url": "https://pubmed.ncbi.nlm.nih.gov/20068231" }, { "database": "PubMed", "id": "17621308", "url": "https://pubmed.ncbi.nlm.nih.gov/17621308" } ], "site_lbl": "Ser507", "uniprot_canonical_ac": "Q5FBB7-1" } ], "record_id": "pubmed.17621308", "abstract": "", "glycosylation": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 4 }, { "field": "total_sites", "count": 2 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Alternative splicing controls nuclear translocation of the cell cycle-regulated Nek2 kinase.", "journal": "The Journal of biological chemistry", "date": "2007-09-07", "authors": "Wu Wenjuan, Baxter Joanne E, Wattam Samantha L, Hayward Daniel G, Fardilha Margarida, Knebel Axel, Ford Eleanor M, da Cruz e Silva Edgar F, Fry Andrew M", "reference": { "type": "PubMed", "id": "17626005", "url": "https://pubmed.ncbi.nlm.nih.gov/17626005" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P51955-1", "protein_name": "Serine/threonine-protein kinase Nek2", "gene_name": "NEK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62136-1", "protein_name": "Serine/threonine-protein phosphatase PP1-alpha catalytic subunit", "gene_name": "PPP1CA", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P51955", "url": "https://www.uniprot.org/uniprotkb/P51955" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.17626005", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "beta-Catenin is a Nek2 substrate involved in centrosome separation.", "journal": "Genes & development", "date": "2008", "authors": "Bahmanyar S, Kaplan DD, Deluca JG, Giddings TH Jr, O'Toole ET, Winey M, Salmon ED, Casey PJ, Nelson WJ, Barth AI", "reference": { "type": "PubMed", "id": "18086858", "url": "https://pubmed.ncbi.nlm.nih.gov/18086858" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P51955-1", "protein_name": "Serine/threonine-protein kinase Nek2", "gene_name": "NEK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35222-1", "protein_name": "Catenin beta-1", "gene_name": "CTNNB1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P51955", "url": "https://www.uniprot.org/uniprotkb/P51955" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.18086858", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The mitotic checkpoint kinase NEK2A regulates kinetochore microtubule attachment stability.", "journal": "Oncogene", "date": "2008", "authors": "Du J, Cai X, Yao J, Ding X, Wu Q, Pei S, Jiang K, Zhang Y, Wang W, Shi Y, Lai Y, Shen J, Teng M, Huang H, Fei Q, Reddy ES, Zhu J, Jin C, Yao X", "reference": { "type": "PubMed", "id": "18297113", "url": "https://pubmed.ncbi.nlm.nih.gov/18297113" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P51955-1", "protein_name": "Serine/threonine-protein kinase Nek2", "gene_name": "NEK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14777-1", "protein_name": "Kinetochore protein NDC80 homolog", "gene_name": "NDC80", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P51955", "url": "https://www.uniprot.org/uniprotkb/P51955" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 165, "end_pos": 165, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by NEK2", "evidence": [ { "database": "UniProtKB", "id": "O14777", "url": "https://www.uniprot.org/uniprotkb/O14777" }, { "database": "iPTMnet", "id": "O14777", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O14777" }, { "database": "PubMed", "id": "18297113", "url": "https://pubmed.ncbi.nlm.nih.gov/18297113" }, { "database": "PubMed", "id": "21832156", "url": "https://pubmed.ncbi.nlm.nih.gov/21832156" }, { "database": "PubMed", "id": "24662830", "url": "https://pubmed.ncbi.nlm.nih.gov/24662830" }, { "database": "PubMed", "id": "26595804", "url": "https://pubmed.ncbi.nlm.nih.gov/26595804" }, { "database": "PubMed", "id": "27764815", "url": "https://pubmed.ncbi.nlm.nih.gov/27764815" }, { "database": "PubMed", "id": "12386167", "url": "https://pubmed.ncbi.nlm.nih.gov/12386167" } ], "site_lbl": "Ser165", "uniprot_canonical_ac": "O14777-1" } ], "record_id": "pubmed.18297113", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "An autoinhibitory tyrosine motif in the cell-cycle-regulated Nek7 kinase is released through binding of Nek9.", "journal": "Mol. Cell", "date": "2009", "authors": "Richards MW, O'Regan L, Mas-Droux C, Blot JM, Cheung J, Hoelder S, Fry AM, Bayliss R", "reference": { "type": "PubMed", "id": "19941817", "url": "https://pubmed.ncbi.nlm.nih.gov/19941817" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P51955-1", "protein_name": "Serine/threonine-protein kinase Nek2", "gene_name": "NEK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P53350-1", "protein_name": "Serine/threonine-protein kinase PLK1", "gene_name": "PLK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06493-1", "protein_name": "Cyclin-dependent kinase 1", "gene_name": "CDK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HC98-1", "protein_name": "Serine/threonine-protein kinase Nek6", "gene_name": "NEK6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TDX7-1", "protein_name": "Serine/threonine-protein kinase Nek7", "gene_name": "NEK7", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95067-1", "protein_name": "G2/mitotic-specific cyclin-B2", "gene_name": "CCNB2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P14635-1", "protein_name": "G2/mitotic-specific cyclin-B1", "gene_name": "CCNB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TD19-1", "protein_name": "Serine/threonine-protein kinase Nek9", "gene_name": "NEK9", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P51955", "url": "https://www.uniprot.org/uniprotkb/P51955" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 108, "end_pos": 108, "sequence_org": "Y", "sequence_mut": "A", "comment": "Increase in catalytic activity.", "evidence": [ { "database": "UniProtKB", "id": "Q9HC98", "url": "https://www.uniprot.org/uniprotkb/Q9HC98" }, { "database": "PubMed", "id": "19941817", "url": "https://pubmed.ncbi.nlm.nih.gov/19941817" } ], "uniprot_canonical_ac": "Q9HC98-1" }, { "start_pos": 28, "end_pos": 28, "sequence_org": "Y", "sequence_mut": "A", "comment": "Significant decrease in catalytic activity; when associated with A-31.", "evidence": [ { "database": "UniProtKB", "id": "Q8TDX7", "url": "https://www.uniprot.org/uniprotkb/Q8TDX7" }, { "database": "PubMed", "id": "19941817", "url": "https://pubmed.ncbi.nlm.nih.gov/19941817" } ], "uniprot_canonical_ac": "Q8TDX7-1" }, { "start_pos": 31, "end_pos": 31, "sequence_org": "L", "sequence_mut": "A", "comment": "Significant decrease in catalytic activity; when associated with A-28.", "evidence": [ { "database": "UniProtKB", "id": "Q8TDX7", "url": "https://www.uniprot.org/uniprotkb/Q8TDX7" }, { "database": "PubMed", "id": "19941817", "url": "https://pubmed.ncbi.nlm.nih.gov/19941817" } ], "uniprot_canonical_ac": "Q8TDX7-1" }, { "start_pos": 33, "end_pos": 33, "sequence_org": "N", "sequence_mut": "D", "comment": "Significant decrease in catalytic activity.", "evidence": [ { "database": "UniProtKB", "id": "Q8TDX7", "url": "https://www.uniprot.org/uniprotkb/Q8TDX7" }, { "database": "PubMed", "id": "19941817", "url": "https://pubmed.ncbi.nlm.nih.gov/19941817" } ], "uniprot_canonical_ac": "Q8TDX7-1" }, { "start_pos": 97, "end_pos": 97, "sequence_org": "Y", "sequence_mut": "A", "comment": "5-fold increase in catalytic activity.", "evidence": [ { "database": "UniProtKB", "id": "Q8TDX7", "url": "https://www.uniprot.org/uniprotkb/Q8TDX7" }, { "database": "PubMed", "id": "19941817", "url": "https://pubmed.ncbi.nlm.nih.gov/19941817" }, { "database": "PubMed", "id": "26522158", "url": "https://pubmed.ncbi.nlm.nih.gov/26522158" } ], "uniprot_canonical_ac": "Q8TDX7-1" }, { "start_pos": 97, "end_pos": 97, "sequence_org": "Y", "sequence_mut": "F", "comment": "Moderate increase in catalytic activity.", "evidence": [ { "database": "UniProtKB", "id": "Q8TDX7", "url": "https://www.uniprot.org/uniprotkb/Q8TDX7" }, { "database": "PubMed", "id": "19941817", "url": "https://pubmed.ncbi.nlm.nih.gov/19941817" } ], "uniprot_canonical_ac": "Q8TDX7-1" }, { "start_pos": 97, "end_pos": 97, "sequence_org": "Y", "sequence_mut": "L", "comment": "Moderate increase in catalytic activity.", "evidence": [ { "database": "UniProtKB", "id": "Q8TDX7", "url": "https://www.uniprot.org/uniprotkb/Q8TDX7" }, { "database": "PubMed", "id": "19941817", "url": "https://pubmed.ncbi.nlm.nih.gov/19941817" } ], "uniprot_canonical_ac": "Q8TDX7-1" } ], "record_id": "pubmed.19941817", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 8 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Involvement of a centrosomal protein kendrin in the maintenance of centrosome cohesion by modulating Nek2A kinase activity.", "journal": "Biochem. Biophys. Res. Commun.", "date": "2010", "authors": "Matsuo Kazuhiko, Nishimura Tamako, Hayakawa Akihide, Ono Yoshitaka, Takahashi Mikiko", "reference": { "type": "PubMed", "id": "20599736", "url": "https://pubmed.ncbi.nlm.nih.gov/20599736" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P51955-1", "protein_name": "Serine/threonine-protein kinase Nek2", "gene_name": "NEK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95613-1", "protein_name": "Pericentrin", "gene_name": "PCNT", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P51955", "url": "https://www.uniprot.org/uniprotkb/P51955" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.20599736", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Aminopyrazine inhibitors binding to an unusual inactive conformation of the mitotic kinase Nek2: SAR and structural characterization.", "journal": "Journal of medicinal chemistry", "date": "2010", "authors": "Whelligan DK, Solanki S, Taylor D, Thomson DW, Cheung KM, Boxall K, Mas-Droux C, Barillari C, Burns S, Grummitt CG, Collins I, van Montfort RL, Aherne GW, Bayliss R, Hoelder S", "reference": { "type": "PubMed", "id": "20936789", "url": "https://pubmed.ncbi.nlm.nih.gov/20936789" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P51955-1", "protein_name": "Serine/threonine-protein kinase Nek2", "gene_name": "NEK2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P51955", "url": "https://www.uniprot.org/uniprotkb/P51955" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 175, "end_pos": 175, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine; by autocatalysis", "evidence": [ { "database": "UniProtKB", "id": "P51955", "url": "https://www.uniprot.org/uniprotkb/P51955" }, { "database": "iPTMnet", "id": "P51955", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P51955" }, { "database": "PubMed", "id": "20936789", "url": "https://pubmed.ncbi.nlm.nih.gov/20936789" } ], "site_lbl": "Thr175", "uniprot_canonical_ac": "P51955-1" } ], "record_id": "pubmed.20936789", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Components of the Hippo pathway cooperate with Nek2 kinase to regulate centrosome disjunction.", "journal": "Nature cell biology", "date": "2010", "authors": "Mardin BR, Lange C, Baxter JE, Hardy T, Scholz SR, Fry AM, Schiebel E", "reference": { "type": "PubMed", "id": "21076410", "url": "https://pubmed.ncbi.nlm.nih.gov/21076410" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P51955-1", "protein_name": "Serine/threonine-protein kinase Nek2", "gene_name": "NEK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BV73-1", "protein_name": "Centrosome-associated protein CEP250", "gene_name": "CEP250", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H4B6-1", "protein_name": "Protein salvador homolog 1", "gene_name": "SAV1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13188-1", "protein_name": "Serine/threonine-protein kinase 3", "gene_name": "STK3", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P51955", "url": "https://www.uniprot.org/uniprotkb/P51955" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 356, "end_pos": 356, "kinase_uniprot_canonical_ac": "Q13188-1", "kinase_gene_name": "STK3", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P51955", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P51955" }, { "database": "PubMed", "id": "21076410", "url": "https://pubmed.ncbi.nlm.nih.gov/21076410" } ], "site_lbl": "Ser356", "uniprot_canonical_ac": "P51955-1" }, { "start_pos": 356, "end_pos": 356, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by STK3/MST2", "evidence": [ { "database": "UniProtKB", "id": "P51955", "url": "https://www.uniprot.org/uniprotkb/P51955" }, { "database": "iPTMnet", "id": "P51955", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P51955" }, { "database": "PubMed", "id": "17197699", "url": "https://pubmed.ncbi.nlm.nih.gov/17197699" }, { "database": "PubMed", "id": "21076410", "url": "https://pubmed.ncbi.nlm.nih.gov/21076410" } ], "site_lbl": "Ser356", "uniprot_canonical_ac": "P51955-1" }, { "start_pos": 365, "end_pos": 365, "kinase_uniprot_canonical_ac": "Q13188-1", "kinase_gene_name": "STK3", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P51955", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P51955" }, { "database": "PubMed", "id": "21076410", "url": "https://pubmed.ncbi.nlm.nih.gov/21076410" } ], "site_lbl": "Ser365", "uniprot_canonical_ac": "P51955-1" }, { "start_pos": 365, "end_pos": 365, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by STK3/MST2", "evidence": [ { "database": "UniProtKB", "id": "P51955", "url": "https://www.uniprot.org/uniprotkb/P51955" }, { "database": "iPTMnet", "id": "P51955", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P51955" }, { "database": "PubMed", "id": "21076410", "url": "https://pubmed.ncbi.nlm.nih.gov/21076410" } ], "site_lbl": "Ser365", "uniprot_canonical_ac": "P51955-1" }, { "start_pos": 406, "end_pos": 406, "kinase_uniprot_canonical_ac": "Q13188-1", "kinase_gene_name": "STK3", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P51955", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P51955" }, { "database": "PubMed", "id": "21076410", "url": "https://pubmed.ncbi.nlm.nih.gov/21076410" } ], "site_lbl": "Ser406", "uniprot_canonical_ac": "P51955-1" }, { "start_pos": 406, "end_pos": 406, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by STK3/MST2", "evidence": [ { "database": "UniProtKB", "id": "P51955", "url": "https://www.uniprot.org/uniprotkb/P51955" }, { "database": "iPTMnet", "id": "P51955", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P51955" }, { "database": "PubMed", "id": "21076410", "url": "https://pubmed.ncbi.nlm.nih.gov/21076410" } ], "site_lbl": "Ser406", "uniprot_canonical_ac": "P51955-1" }, { "start_pos": 438, "end_pos": 438, "kinase_uniprot_canonical_ac": "Q13188-1", "kinase_gene_name": "STK3", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P51955", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P51955" }, { "database": "PubMed", "id": "21076410", "url": "https://pubmed.ncbi.nlm.nih.gov/21076410" } ], "site_lbl": "Ser438", "uniprot_canonical_ac": "P51955-1" }, { "start_pos": 438, "end_pos": 438, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by STK3/MST2", "evidence": [ { "database": "UniProtKB", "id": "P51955", "url": "https://www.uniprot.org/uniprotkb/P51955" }, { "database": "iPTMnet", "id": "P51955", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P51955" }, { "database": "PubMed", "id": "21076410", "url": "https://pubmed.ncbi.nlm.nih.gov/21076410" } ], "site_lbl": "Ser438", "uniprot_canonical_ac": "P51955-1" }, { "start_pos": 2417, "end_pos": 2417, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by NEK2", "evidence": [ { "database": "UniProtKB", "id": "Q9BV73", "url": "https://www.uniprot.org/uniprotkb/Q9BV73" }, { "database": "iPTMnet", "id": "Q9BV73", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9BV73" }, { "database": "PubMed", "id": "24695856", "url": "https://pubmed.ncbi.nlm.nih.gov/24695856" }, { "database": "PubMed", "id": "25660448", "url": "https://pubmed.ncbi.nlm.nih.gov/25660448" }, { "database": "PubMed", "id": "21076410", "url": "https://pubmed.ncbi.nlm.nih.gov/21076410" } ], "site_lbl": "Ser2417", "uniprot_canonical_ac": "Q9BV73-1" }, { "start_pos": 2421, "end_pos": 2421, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by NEK2", "evidence": [ { "database": "UniProtKB", "id": "Q9BV73", "url": "https://www.uniprot.org/uniprotkb/Q9BV73" }, { "database": "iPTMnet", "id": "Q9BV73", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9BV73" }, { "database": "PubMed", "id": "24695856", "url": "https://pubmed.ncbi.nlm.nih.gov/24695856" }, { "database": "PubMed", "id": "25660448", "url": "https://pubmed.ncbi.nlm.nih.gov/25660448" }, { "database": "PubMed", "id": "21076410", "url": "https://pubmed.ncbi.nlm.nih.gov/21076410" } ], "site_lbl": "Ser2421", "uniprot_canonical_ac": "Q9BV73-1" } ], "record_id": "pubmed.21076410", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 4 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 10 }, { "field": "total_sites", "count": 6 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "An undecided coiled-coil: the leucine zipper of NEK2 kinase exhibits atypical conformational exchange dynamics.", "journal": "J. Biol. Chem.", "date": "2011", "authors": "Croasdale Rebecca, Ivins Frank J, Muskett Fred, Daviter Tina, Scott David J, Hardy Tara, Smerdon Steven J, Fry Andrew M, Pfuhl Mark", "reference": { "type": "PubMed", "id": "21669869", "url": "https://pubmed.ncbi.nlm.nih.gov/21669869" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P51955-1", "protein_name": "Serine/threonine-protein kinase Nek2", "gene_name": "NEK2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P51955", "url": "https://www.uniprot.org/uniprotkb/P51955" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.21669869", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Whole genome sequencing in patients with retinitis pigmentosa reveals pathogenic DNA structural changes and NEK2 as a new disease gene.", "journal": "Proc. Natl. Acad. Sci. U.S.A.", "date": "2013", "authors": "Nishiguchi Koji M, Tearle Richard G, Liu Yangfan P, Oh Edwin C, Miyake Noriko, Benaglio Paola, Harper Shyana, Koskiniemi-Kuendig Hanna, Venturini Giulia, Sharon Dror, Koenekoop Robert K, Nakamura Makoto, Kondo Mineo, Ueno Shinji, Yasuma Tetsuhiro R, Beckmann Jacques S, Ikegawa Shiro, Matsumoto Naomichi, Terasaki Hiroko, Berson Eliot L, Katsanis Nicholas, Rivolta Carlo", "reference": { "type": "PubMed", "id": "24043777", "url": "https://pubmed.ncbi.nlm.nih.gov/24043777" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P51955-1", "protein_name": "Serine/threonine-protein kinase Nek2", "gene_name": "NEK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "F1QM29-1", "protein_name": "X-linked retinitis pigmentosa GTPase regulator", "gene_name": "rpgrb", "tax_name": "Zebrafish" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P51955", "url": "https://www.uniprot.org/uniprotkb/P51955" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.24043777", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Centlein mediates an interaction between C-Nap1 and Cep68 to maintain centrosome cohesion.", "journal": "Journal of cell science", "date": "2014", "authors": "Fang G, Zhang D, Yin H, Zheng L, Bi X, Yuan L", "reference": { "type": "PubMed", "id": "24554434", "url": "https://pubmed.ncbi.nlm.nih.gov/24554434" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P51955-1", "protein_name": "Serine/threonine-protein kinase Nek2", "gene_name": "NEK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NXG0-1", "protein_name": "Centlein", "gene_name": "CNTLN", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BV73-1", "protein_name": "Centrosome-associated protein CEP250", "gene_name": "CEP250", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q76N32-1", "protein_name": "Centrosomal protein of 68 kDa", "gene_name": "CEP68", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P51955", "url": "https://www.uniprot.org/uniprotkb/P51955" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.24554434", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 4 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Cep68 can be regulated by Nek2 and SCF complex.", "journal": "European journal of cell biology", "date": "2015", "authors": "Man X, Megraw TL, Lim YP", "reference": { "type": "PubMed", "id": "25704143", "url": "https://pubmed.ncbi.nlm.nih.gov/25704143" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P51955-1", "protein_name": "Serine/threonine-protein kinase Nek2", "gene_name": "NEK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13616-1", "protein_name": "Cullin-1", "gene_name": "CUL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q76N32-1", "protein_name": "Centrosomal protein of 68 kDa", "gene_name": "CEP68", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y297-1", "protein_name": "F-box/WD repeat-containing protein 1A", "gene_name": "BTRC", "tax_name": "Human" }, { "uniprot_canonical_ac": "P63208-1", "protein_name": "S-phase kinase-associated protein 1", "gene_name": "SKP1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P51955", "url": "https://www.uniprot.org/uniprotkb/P51955" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.25704143", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 5 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Characterization of Cep85 - a new antagonist of Nek2A that is involved in the regulation of centrosome disjunction.", "journal": "Journal of cell science", "date": "2015", "authors": "Chen C, Tian F, Lu L, Wang Y, Xiao Z, Yu C, Yu X", "reference": { "type": "PubMed", "id": "26220856", "url": "https://pubmed.ncbi.nlm.nih.gov/26220856" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P51955-1", "protein_name": "Serine/threonine-protein kinase Nek2", "gene_name": "NEK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8BMK0-1", "protein_name": "Centrosomal protein of 85 kDa", "gene_name": "Cep85", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "Q6P2H3-1", "protein_name": "Centrosomal protein of 85 kDa", "gene_name": "CEP85", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P51955", "url": "https://www.uniprot.org/uniprotkb/P51955" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.26220856", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "CCDC102B functions in centrosome linker assembly and centrosome cohesion.", "journal": "Journal of cell science", "date": "2018", "authors": "Xia Y, Huang N, Chen Z, Li F, Fan G, Ma D, Chen J, Teng J", "reference": { "type": "PubMed", "id": "30404835", "url": "https://pubmed.ncbi.nlm.nih.gov/30404835" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P51955-1", "protein_name": "Serine/threonine-protein kinase Nek2", "gene_name": "NEK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BV73-1", "protein_name": "Centrosome-associated protein CEP250", "gene_name": "CEP250", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q76N32-1", "protein_name": "Centrosomal protein of 68 kDa", "gene_name": "CEP68", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q68D86-1", "protein_name": "Coiled-coil domain-containing protein 102B", "gene_name": "CCDC102B", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P51955", "url": "https://www.uniprot.org/uniprotkb/P51955" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 37, "end_pos": 37, "sequence_org": "K", "sequence_mut": "R", "comment": "Loss of kinase activity and of ability to activate NEK11. Loss of phosphorylation of CCDC102B.", "evidence": [ { "database": "UniProtKB", "id": "P51955", "url": "https://www.uniprot.org/uniprotkb/P51955" }, { "database": "PubMed", "id": "30404835", "url": "https://pubmed.ncbi.nlm.nih.gov/30404835" }, { "database": "PubMed", "id": "15161910", "url": "https://pubmed.ncbi.nlm.nih.gov/15161910" }, { "database": "PubMed", "id": "17197699", "url": "https://pubmed.ncbi.nlm.nih.gov/17197699" } ], "uniprot_canonical_ac": "P51955-1" }, { "start_pos": 135, "end_pos": 135, "sequence_org": "S", "sequence_mut": "A", "comment": "Substantial decrease in phosphorylation; when associated with A-21, A-22, A-34, A-142, A-194, A-210, A-401, A-404 and A-406.", "evidence": [ { "database": "UniProtKB", "id": "Q68D86", "url": "https://www.uniprot.org/uniprotkb/Q68D86" }, { "database": "PubMed", "id": "30404835", "url": "https://pubmed.ncbi.nlm.nih.gov/30404835" } ], "uniprot_canonical_ac": "Q68D86-1" }, { "start_pos": 142, "end_pos": 142, "sequence_org": "S", "sequence_mut": "A", "comment": "Substantial decrease in phosphorylation; when associated with A-21, A-22, A-34, A-135, A-194, A-210, A-401, A-404 and A-406.", "evidence": [ { "database": "UniProtKB", "id": "Q68D86", "url": "https://www.uniprot.org/uniprotkb/Q68D86" }, { "database": "PubMed", "id": "30404835", "url": "https://pubmed.ncbi.nlm.nih.gov/30404835" } ], "uniprot_canonical_ac": "Q68D86-1" }, { "start_pos": 194, "end_pos": 194, "sequence_org": "S", "sequence_mut": "A", "comment": "Substantial decrease in phosphorylation; when associated with A-21, A-22, A-34, A-135, A-142, A-210, A-401, A-404 and A-406.", "evidence": [ { "database": "UniProtKB", "id": "Q68D86", "url": "https://www.uniprot.org/uniprotkb/Q68D86" }, { "database": "PubMed", "id": "30404835", "url": "https://pubmed.ncbi.nlm.nih.gov/30404835" } ], "uniprot_canonical_ac": "Q68D86-1" }, { "start_pos": 210, "end_pos": 210, "sequence_org": "S", "sequence_mut": "A", "comment": "Substantial decrease in phosphorylation; when associated with A-21, A-22, A-34, A-135, A-142, A-194, A-401, A-404 and A-406.", "evidence": [ { "database": "UniProtKB", "id": "Q68D86", "url": "https://www.uniprot.org/uniprotkb/Q68D86" }, { "database": "PubMed", "id": "30404835", "url": "https://pubmed.ncbi.nlm.nih.gov/30404835" } ], "uniprot_canonical_ac": "Q68D86-1" }, { "start_pos": 21, "end_pos": 21, "sequence_org": "S", "sequence_mut": "A", "comment": "Substantial decrease in phosphorylation; when associated with A-22, A-34, A-135, A-142, A-194, A-210, A-401, A-404 and A-406.", "evidence": [ { "database": "UniProtKB", "id": "Q68D86", "url": "https://www.uniprot.org/uniprotkb/Q68D86" }, { "database": "PubMed", "id": "30404835", "url": "https://pubmed.ncbi.nlm.nih.gov/30404835" } ], "uniprot_canonical_ac": "Q68D86-1" }, { "start_pos": 22, "end_pos": 22, "sequence_org": "S", "sequence_mut": "A", "comment": "Substantial decrease in phosphorylation; when associated with A-21, A-34, A-135, A-142, A-194, A-210, A-401, A-404 and A-406.", "evidence": [ { "database": "UniProtKB", "id": "Q68D86", "url": "https://www.uniprot.org/uniprotkb/Q68D86" }, { "database": "PubMed", "id": "30404835", "url": "https://pubmed.ncbi.nlm.nih.gov/30404835" } ], "uniprot_canonical_ac": "Q68D86-1" }, { "start_pos": 34, "end_pos": 34, "sequence_org": "S", "sequence_mut": "A", "comment": "Substantial decrease in phosphorylation; when associated with A-21, A-22, A-135, A-142, A-194, A-210, A-401, A-404 and A-406.", "evidence": [ { "database": "UniProtKB", "id": "Q68D86", "url": "https://www.uniprot.org/uniprotkb/Q68D86" }, { "database": "PubMed", "id": "30404835", "url": "https://pubmed.ncbi.nlm.nih.gov/30404835" } ], "uniprot_canonical_ac": "Q68D86-1" }, { "start_pos": 401, "end_pos": 401, "sequence_org": "S", "sequence_mut": "A", "comment": "Substantial decrease in phosphorylation; when associated with A-21, A-22, A-34, A-135, A-142, A-194, A-210, A-404 and A-406.", "evidence": [ { "database": "UniProtKB", "id": "Q68D86", "url": "https://www.uniprot.org/uniprotkb/Q68D86" }, { "database": "PubMed", "id": "30404835", "url": "https://pubmed.ncbi.nlm.nih.gov/30404835" } ], "uniprot_canonical_ac": "Q68D86-1" }, { "start_pos": 404, "end_pos": 404, "sequence_org": "S", "sequence_mut": "A", "comment": "Substantial decrease in phosphorylation; when associated with A-21, A-22, A-34, A-135, A-142, A-194, A-210, A-401 and A-406.", "evidence": [ { "database": "UniProtKB", "id": "Q68D86", "url": "https://www.uniprot.org/uniprotkb/Q68D86" }, { "database": "PubMed", "id": "30404835", "url": "https://pubmed.ncbi.nlm.nih.gov/30404835" } ], "uniprot_canonical_ac": "Q68D86-1" }, { "start_pos": 406, "end_pos": 406, "sequence_org": "S", "sequence_mut": "A", "comment": "Substantial decrease in phosphorylation; when associated with A-21, A-22, A-34, A-135, A-142, A-194, A-210, A-401 and A-404.", "evidence": [ { "database": "UniProtKB", "id": "Q68D86", "url": "https://www.uniprot.org/uniprotkb/Q68D86" }, { "database": "PubMed", "id": "30404835", "url": "https://pubmed.ncbi.nlm.nih.gov/30404835" } ], "uniprot_canonical_ac": "Q68D86-1" } ], "phosphorylation": [ { "start_pos": 135, "end_pos": 135, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "Q68D86", "url": "https://www.uniprot.org/uniprotkb/Q68D86" }, { "database": "PubMed", "id": "30404835", "url": "https://pubmed.ncbi.nlm.nih.gov/30404835" }, { "database": "iPTMnet", "id": "Q68D86", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q68D86" } ], "site_lbl": "Ser135", "uniprot_canonical_ac": "Q68D86-1" }, { "start_pos": 142, "end_pos": 142, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "Q68D86", "url": "https://www.uniprot.org/uniprotkb/Q68D86" }, { "database": "PubMed", "id": "30404835", "url": "https://pubmed.ncbi.nlm.nih.gov/30404835" }, { "database": "iPTMnet", "id": "Q68D86", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q68D86" } ], "site_lbl": "Ser142", "uniprot_canonical_ac": "Q68D86-1" }, { "start_pos": 194, "end_pos": 194, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "Q68D86", "url": "https://www.uniprot.org/uniprotkb/Q68D86" }, { "database": "PubMed", "id": "30404835", "url": "https://pubmed.ncbi.nlm.nih.gov/30404835" }, { "database": "iPTMnet", "id": "Q68D86", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q68D86" } ], "site_lbl": "Ser194", "uniprot_canonical_ac": "Q68D86-1" }, { "start_pos": 210, "end_pos": 210, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "Q68D86", "url": "https://www.uniprot.org/uniprotkb/Q68D86" }, { "database": "PubMed", "id": "30404835", "url": "https://pubmed.ncbi.nlm.nih.gov/30404835" }, { "database": "iPTMnet", "id": "Q68D86", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q68D86" } ], "site_lbl": "Ser210", "uniprot_canonical_ac": "Q68D86-1" }, { "start_pos": 21, "end_pos": 21, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "Q68D86", "url": "https://www.uniprot.org/uniprotkb/Q68D86" }, { "database": "PubMed", "id": "30404835", "url": "https://pubmed.ncbi.nlm.nih.gov/30404835" }, { "database": "iPTMnet", "id": "Q68D86", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q68D86" } ], "site_lbl": "Ser21", "uniprot_canonical_ac": "Q68D86-1" }, { "start_pos": 22, "end_pos": 22, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "Q68D86", "url": "https://www.uniprot.org/uniprotkb/Q68D86" }, { "database": "PubMed", "id": "30404835", "url": "https://pubmed.ncbi.nlm.nih.gov/30404835" }, { "database": "iPTMnet", "id": "Q68D86", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q68D86" } ], "site_lbl": "Ser22", "uniprot_canonical_ac": "Q68D86-1" }, { "start_pos": 34, "end_pos": 34, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "Q68D86", "url": "https://www.uniprot.org/uniprotkb/Q68D86" }, { "database": "PubMed", "id": "30404835", "url": "https://pubmed.ncbi.nlm.nih.gov/30404835" }, { "database": "iPTMnet", "id": "Q68D86", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q68D86" } ], "site_lbl": "Ser34", "uniprot_canonical_ac": "Q68D86-1" }, { "start_pos": 401, "end_pos": 401, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "Q68D86", "url": "https://www.uniprot.org/uniprotkb/Q68D86" }, { "database": "PubMed", "id": "30404835", "url": "https://pubmed.ncbi.nlm.nih.gov/30404835" }, { "database": "iPTMnet", "id": "Q68D86", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q68D86" } ], "site_lbl": "Ser401", "uniprot_canonical_ac": "Q68D86-1" }, { "start_pos": 404, "end_pos": 404, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "Q68D86", "url": "https://www.uniprot.org/uniprotkb/Q68D86" }, { "database": "PubMed", "id": "30404835", "url": "https://pubmed.ncbi.nlm.nih.gov/30404835" }, { "database": "iPTMnet", "id": "Q68D86", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q68D86" } ], "site_lbl": "Ser404", "uniprot_canonical_ac": "Q68D86-1" }, { "start_pos": 406, "end_pos": 406, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "Q68D86", "url": "https://www.uniprot.org/uniprotkb/Q68D86" }, { "database": "PubMed", "id": "30404835", "url": "https://pubmed.ncbi.nlm.nih.gov/30404835" }, { "database": "iPTMnet", "id": "Q68D86", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q68D86" } ], "site_lbl": "Ser406", "uniprot_canonical_ac": "Q68D86-1" } ], "record_id": "pubmed.30404835", "abstract": "", "glycosylation": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 4 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 10 }, { "field": "total_sites", "count": 10 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Abnormal methylation mediated upregulation of LINC00857 boosts malignant progression of lung adenocarcinoma by modulating the miR-486-5p/NEK2 axis.", "journal": "The clinical respiratory journal", "date": "2024-05", "authors": "Fu Haoyu, Zhang Mingming, Liu Xiaohui, Yang Yiming, Xing Ying", "reference": { "type": "PubMed", "id": "38721812", "url": "https://pubmed.ncbi.nlm.nih.gov/38721812" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P51955-1", "protein_name": "Serine/threonine-protein kinase Nek2", "gene_name": "NEK2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P51955", "url": "https://www.uniprot.org/uniprotkb/P51955" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.38721812", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Function of NEK2 in clear cell renal cell carcinoma and its effect on the tumor microenvironment.", "journal": "Medicine", "date": "2024-05-17", "authors": "Tang Peng, Zheng Gangfu, Xu Congcong, Yu Nengfeng, Du Jiaqi, Hu Liqian, Zhou Zhan, Zheng Yichun", "reference": { "type": "PubMed", "id": "38758909", "url": "https://pubmed.ncbi.nlm.nih.gov/38758909" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P51955-1", "protein_name": "Serine/threonine-protein kinase Nek2", "gene_name": "NEK2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P51955", "url": "https://www.uniprot.org/uniprotkb/P51955" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.38758909", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "NEK2 promotes TP53 ubiquitination to enhance the proliferation and migration of TP53 wild-type glioblastoma cells.", "journal": "Neoplasma", "date": "2024-06", "authors": "Zhang Yu, Yu Hao, He Mengyao, Liu Wenchao, Xiao Shengyou, Wang Xiangting, Huang Ping, Huang Qiang", "reference": { "type": "PubMed", "id": "38764296", "url": "https://pubmed.ncbi.nlm.nih.gov/38764296" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P51955-1", "protein_name": "Serine/threonine-protein kinase Nek2", "gene_name": "NEK2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P51955", "url": "https://www.uniprot.org/uniprotkb/P51955" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.38764296", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "NEK2 promotes the development of ovarian endometriosis and impairs decidualization by phosphorylating FOXO1.", "journal": "Cellular and molecular life sciences : CMLS", "date": "2024-05-25", "authors": "Wang Mengxue, Sun Fangyuan, Zhang Shucai, Zhang Xiaohui, Sun Yujun, Yu Ting, Li Yuanyuan, Jiang Aifang, Qiao Pengyun, Ren Chune, Yang Tingting", "reference": { "type": "PubMed", "id": "38795132", "url": "https://pubmed.ncbi.nlm.nih.gov/38795132" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P51955-1", "protein_name": "Serine/threonine-protein kinase Nek2", "gene_name": "NEK2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P51955", "url": "https://www.uniprot.org/uniprotkb/P51955" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.38795132", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Cell cycle-dependent expression of Nek2, a novel human protein kinase related to the NIMA mitotic regulator of Aspergillus nidulans.", "journal": "Cell Growth Differ.", "date": "1994", "authors": "Schultz S J, Fry A M, S\u00fctterlin C, Ried T, Nigg E A", "reference": { "type": "PubMed", "id": "7522034", "url": "https://pubmed.ncbi.nlm.nih.gov/7522034" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P51955-1", "protein_name": "Serine/threonine-protein kinase Nek2", "gene_name": "NEK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51956-1", "protein_name": "Serine/threonine-protein kinase Nek3", "gene_name": "NEK3", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P51955", "url": "https://www.uniprot.org/uniprotkb/P51955" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.7522034", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Identification of 21 novel human protein kinases, including 3 members of a family related to the cell cycle regulator nimA of Aspergillus nidulans.", "journal": "Cell Growth Differ.", "date": "1993", "authors": "Schultz SJ, Nigg EA", "reference": { "type": "PubMed", "id": "8274451", "url": "https://pubmed.ncbi.nlm.nih.gov/8274451" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P51955-1", "protein_name": "Serine/threonine-protein kinase Nek2", "gene_name": "NEK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51956-1", "protein_name": "Serine/threonine-protein kinase Nek3", "gene_name": "NEK3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13188-1", "protein_name": "Serine/threonine-protein kinase 3", "gene_name": "STK3", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43283-1", "protein_name": "Mitogen-activated protein kinase kinase kinase 13", "gene_name": "MAP3K13", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q7KZI7-1", "protein_name": "Serine/threonine-protein kinase MARK2", "gene_name": "MARK2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P51955", "url": "https://www.uniprot.org/uniprotkb/P51955" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.8274451", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 5 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Nol9 Is a Spatial Regulator for the Human ITS2 Pre-rRNA Endonuclease-Kinase Complex.", "journal": "Journal of molecular biology", "date": "2019", "authors": "Gordon J, Pillon MC, Stanley RE", "reference": { "type": "PubMed", "id": "31288032", "url": "https://pubmed.ncbi.nlm.nih.gov/31288032" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q5SY16-1", "protein_name": "Polynucleotide 5'-hydroxyl-kinase NOL9", "gene_name": "NOL9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y4W2-1", "protein_name": "Ribosomal biogenesis protein LAS1L", "gene_name": "LAS1L", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q5SY16", "url": "https://www.uniprot.org/uniprotkb/Q5SY16" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.31288032", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Mitochondrial transcription factors B1 and B2 activate transcription of human mtDNA.", "journal": "Nature genetics", "date": "2002", "authors": "Falkenberg M, Gaspari M, Rantanen A, Trifunovic A, Larsson NG, Gustafsson CM", "reference": { "type": "PubMed", "id": "12068295", "url": "https://pubmed.ncbi.nlm.nih.gov/12068295" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q00059-1", "protein_name": "Transcription factor A, mitochondrial", "gene_name": "TFAM", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H5Q4-1", "protein_name": "Dimethyladenosine transferase 2, mitochondrial", "gene_name": "TFB2M", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00411-1", "protein_name": "DNA-directed RNA polymerase, mitochondrial", "gene_name": "POLRMT", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8WVM0-1", "protein_name": "Dimethyladenosine transferase 1, mitochondrial", "gene_name": "TFB1M", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8JZM0-1", "protein_name": "Dimethyladenosine transferase 1, mitochondrial", "gene_name": "Tfb1m", "tax_name": "Mouse" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q00059", "url": "https://www.uniprot.org/uniprotkb/Q00059" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.12068295", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 5 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Human mitochondrial transcription factor B1 interacts with the C-terminal activation region of h-mtTFA and stimulates transcription independently of its RNA methyltransferase activity.", "journal": "Mol. Cell. Biol.", "date": "2003", "authors": "McCulloch V, Shadel GS", "reference": { "type": "PubMed", "id": "12897151", "url": "https://pubmed.ncbi.nlm.nih.gov/12897151" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q00059-1", "protein_name": "Transcription factor A, mitochondrial", "gene_name": "TFAM", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H5Q4-1", "protein_name": "Dimethyladenosine transferase 2, mitochondrial", "gene_name": "TFB2M", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8WVM0-1", "protein_name": "Dimethyladenosine transferase 1, mitochondrial", "gene_name": "TFB1M", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q00059", "url": "https://www.uniprot.org/uniprotkb/Q00059" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 141, "end_pos": 141, "sequence_org": "N", "sequence_mut": "A", "comment": "Does not affect SAM-binding, DNA-binding nor transcription activator function.", "evidence": [ { "database": "UniProtKB", "id": "Q8WVM0", "url": "https://www.uniprot.org/uniprotkb/Q8WVM0" }, { "database": "PubMed", "id": "12897151", "url": "https://pubmed.ncbi.nlm.nih.gov/12897151" } ], "uniprot_canonical_ac": "Q8WVM0-1" }, { "start_pos": 220, "end_pos": 220, "sequence_org": "K", "sequence_mut": "A", "comment": "Abolishes methyltransferase activity. Does not affect SAM-binding, DNA-binding nor transcription activator function.", "evidence": [ { "database": "UniProtKB", "id": "Q8WVM0", "url": "https://www.uniprot.org/uniprotkb/Q8WVM0" }, { "database": "PubMed", "id": "12496758", "url": "https://pubmed.ncbi.nlm.nih.gov/12496758" }, { "database": "PubMed", "id": "12897151", "url": "https://pubmed.ncbi.nlm.nih.gov/12897151" } ], "uniprot_canonical_ac": "Q8WVM0-1" }, { "start_pos": 65, "end_pos": 65, "sequence_org": "G", "sequence_mut": "A", "comment": "Abolishes methyltransferase activity, DNA-binding and SAM-binding. Does not abolish transcription activator function.", "evidence": [ { "database": "UniProtKB", "id": "Q8WVM0", "url": "https://www.uniprot.org/uniprotkb/Q8WVM0" }, { "database": "PubMed", "id": "12496758", "url": "https://pubmed.ncbi.nlm.nih.gov/12496758" }, { "database": "PubMed", "id": "12897151", "url": "https://pubmed.ncbi.nlm.nih.gov/12897151" } ], "uniprot_canonical_ac": "Q8WVM0-1" } ], "record_id": "pubmed.12897151", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The mitochondrial RNA polymerase contributes critically to promoter specificity in mammalian cells.", "journal": "The EMBO journal", "date": "2004", "authors": "Gaspari M, Falkenberg M, Larsson NG, Gustafsson CM", "reference": { "type": "PubMed", "id": "15526033", "url": "https://pubmed.ncbi.nlm.nih.gov/15526033" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q00059-1", "protein_name": "Transcription factor A, mitochondrial", "gene_name": "TFAM", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H5Q4-1", "protein_name": "Dimethyladenosine transferase 2, mitochondrial", "gene_name": "TFB2M", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00411-1", "protein_name": "DNA-directed RNA polymerase, mitochondrial", "gene_name": "POLRMT", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8BKF1-1", "protein_name": "DNA-directed RNA polymerase, mitochondrial", "gene_name": "Polrmt", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "Q3TL26-1", "protein_name": "Dimethyladenosine transferase 2, mitochondrial", "gene_name": "Tfb2m", "tax_name": "Mouse" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q00059", "url": "https://www.uniprot.org/uniprotkb/Q00059" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.15526033", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 5 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Upstream region of a genomic gene for human mitochondrial transcription factor 1.", "journal": "Biochim. Biophys. Acta", "date": "1992", "authors": "Tominaga K, Akiyama S, Kagawa Y, Ohta S", "reference": { "type": "PubMed", "id": "1610904", "url": "https://pubmed.ncbi.nlm.nih.gov/1610904" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q00059-1", "protein_name": "Transcription factor A, mitochondrial", "gene_name": "TFAM", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q00059", "url": "https://www.uniprot.org/uniprotkb/Q00059" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.1610904", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "DNA wrapping and bending by a mitochondrial high mobility group-like transcriptional activator protein.", "journal": "The Journal of biological chemistry", "date": "1992-02-15", "authors": "Fisher R P, Lisowsky T, Parisi M A, Clayton D A", "reference": { "type": "PubMed", "id": "1737790", "url": "https://pubmed.ncbi.nlm.nih.gov/1737790" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q00059-1", "protein_name": "Transcription factor A, mitochondrial", "gene_name": "TFAM", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q00059", "url": "https://www.uniprot.org/uniprotkb/Q00059" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.1737790", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Human mitochondrial transcription factor A possesses multiple subcellular targeting signals.", "journal": "The FEBS journal", "date": "2007", "authors": "Pastukh V, Shokolenko I, Wang B, Wilson G, Alexeyev M", "reference": { "type": "PubMed", "id": "18028422", "url": "https://pubmed.ncbi.nlm.nih.gov/18028422" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q00059-1", "protein_name": "Transcription factor A, mitochondrial", "gene_name": "TFAM", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q00059", "url": "https://www.uniprot.org/uniprotkb/Q00059" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.18028422", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Mitochondrial transcription factors TFA, TFB1 and TFB2: a search for DNA variants/haplotypes and the risk of cardiac hypertrophy.", "journal": "Dis. Markers", "date": "2008", "authors": "Alonso-Montes Cristina, Castro M\u00f3nica G, Reguero Juli\u00e1n R, Perrot Andreas, Ozcelik Cemil, Geier Christian, Posch Maximilian G, Mor\u00eds C\u00e9sar, Alvarez Victoria, Ruiz-Ortega Marta, Coto Eliecer", "reference": { "type": "PubMed", "id": "19096125", "url": "https://pubmed.ncbi.nlm.nih.gov/19096125" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q00059-1", "protein_name": "Transcription factor A, mitochondrial", "gene_name": "TFAM", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H5Q4-1", "protein_name": "Dimethyladenosine transferase 2, mitochondrial", "gene_name": "TFB2M", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8WVM0-1", "protein_name": "Dimethyladenosine transferase 1, mitochondrial", "gene_name": "TFB1M", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q00059", "url": "https://www.uniprot.org/uniprotkb/Q00059" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.19096125", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The smaller isoform of the mitochondrial transcription factor A has a role in the mitochondrial transcription.", "journal": "The Italian journal of biochemistry", "date": "2007", "authors": "Bruno S, De Virgilio C, Gadaleta G", "reference": { "type": "PubMed", "id": "19192634", "url": "https://pubmed.ncbi.nlm.nih.gov/19192634" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q00059-1", "protein_name": "Transcription factor A, mitochondrial", "gene_name": "TFAM", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q00059", "url": "https://www.uniprot.org/uniprotkb/Q00059" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.19192634", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Structural analysis and DNA binding of the HMG domains of the human mitochondrial transcription factor A.", "journal": "Nucleic acids research", "date": "2009-06", "authors": "Gangelhoff Todd A, Mungalachetty Purnima S, Nix Jay C, Churchill Mair E A", "reference": { "type": "PubMed", "id": "19304746", "url": "https://pubmed.ncbi.nlm.nih.gov/19304746" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q00059-1", "protein_name": "Transcription factor A, mitochondrial", "gene_name": "TFAM", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q00059", "url": "https://www.uniprot.org/uniprotkb/Q00059" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.19304746", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Similarity of human mitochondrial transcription factor 1 to high mobility group proteins.", "journal": "Science", "date": "1991", "authors": "Parisi MA, Clayton DA", "reference": { "type": "PubMed", "id": "2035027", "url": "https://pubmed.ncbi.nlm.nih.gov/2035027" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q00059-1", "protein_name": "Transcription factor A, mitochondrial", "gene_name": "TFAM", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q00059", "url": "https://www.uniprot.org/uniprotkb/Q00059" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.2035027", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Human mitochondrial transcription revisited: only TFAM and TFB2M are required for transcription of the mitochondrial genes in vitro.", "journal": "The Journal of biological chemistry", "date": "2010-06-11", "authors": "Litonin Dmitry, Sologub Marina, Shi Yonghong, Savkina Maria, Anikin Michael, Falkenberg Maria, Gustafsson Claes M, Temiakov Dmitry", "reference": { "type": "PubMed", "id": "20410300", "url": "https://pubmed.ncbi.nlm.nih.gov/20410300" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q00059-1", "protein_name": "Transcription factor A, mitochondrial", "gene_name": "TFAM", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H5Q4-1", "protein_name": "Dimethyladenosine transferase 2, mitochondrial", "gene_name": "TFB2M", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q00059", "url": "https://www.uniprot.org/uniprotkb/Q00059" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.20410300", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "New isoforms of human mitochondrial transcription factor A detected in normal and tumoral cells.", "journal": "Mitochondrion", "date": "2011", "authors": "De Virgilio C, Pousis C, Bruno S, Gadaleta G", "reference": { "type": "PubMed", "id": "21081181", "url": "https://pubmed.ncbi.nlm.nih.gov/21081181" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q00059-1", "protein_name": "Transcription factor A, mitochondrial", "gene_name": "TFAM", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q00059", "url": "https://www.uniprot.org/uniprotkb/Q00059" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.21081181", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The mitochondrial transcription and packaging factor Tfam imposes a U-turn on mitochondrial DNA.", "journal": "Nature structural & molecular biology", "date": "2011", "authors": "Ngo HB, Kaiser JT, Chan DC", "reference": { "type": "PubMed", "id": "22037171", "url": "https://pubmed.ncbi.nlm.nih.gov/22037171" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q00059-1", "protein_name": "Transcription factor A, mitochondrial", "gene_name": "TFAM", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q00059", "url": "https://www.uniprot.org/uniprotkb/Q00059" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 162, "end_pos": 162, "sequence_org": "Y", "sequence_mut": "A", "comment": "Moderate reduction in DNA bending.", "evidence": [ { "database": "UniProtKB", "id": "Q00059", "url": "https://www.uniprot.org/uniprotkb/Q00059" }, { "database": "PubMed", "id": "22037171", "url": "https://pubmed.ncbi.nlm.nih.gov/22037171" } ], "uniprot_canonical_ac": "Q00059-1" }, { "start_pos": 77, "end_pos": 77, "sequence_org": "T", "sequence_mut": "A", "comment": "Moderate reduction in DNA bending.", "evidence": [ { "database": "UniProtKB", "id": "Q00059", "url": "https://www.uniprot.org/uniprotkb/Q00059" }, { "database": "PubMed", "id": "22037171", "url": "https://pubmed.ncbi.nlm.nih.gov/22037171" } ], "uniprot_canonical_ac": "Q00059-1" } ], "record_id": "pubmed.22037171", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Human mitochondrial transcription factor A induces a U-turn structure in the light strand promoter.", "journal": "Nature structural & molecular biology", "date": "2011-10-30", "authors": "Rubio-Cosials Anna, Sidow Jasmin F, Jim\u00e9nez-Men\u00e9ndez Nereida, Fern\u00e1ndez-Mill\u00e1n Pablo, Montoya Julio, Jacobs Howard T, Coll Miquel, Bernad\u00f3 Pau, Sol\u00e0 Maria", "reference": { "type": "PubMed", "id": "22037172", "url": "https://pubmed.ncbi.nlm.nih.gov/22037172" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q00059-1", "protein_name": "Transcription factor A, mitochondrial", "gene_name": "TFAM", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q00059", "url": "https://www.uniprot.org/uniprotkb/Q00059" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.22037172", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Maintenance of mitochondrial genome distribution by mitochondrial AAA+ protein ClpX.", "journal": "Experimental cell research", "date": "2012", "authors": "Kasashima K, Sumitani M, Endo H", "reference": { "type": "PubMed", "id": "22841477", "url": "https://pubmed.ncbi.nlm.nih.gov/22841477" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q00059-1", "protein_name": "Transcription factor A, mitochondrial", "gene_name": "TFAM", "tax_name": "Human" }, { "uniprot_canonical_ac": "O76031-1", "protein_name": "ATP-dependent clpX-like chaperone, mitochondrial", "gene_name": "CLPX", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q00059", "url": "https://www.uniprot.org/uniprotkb/Q00059" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.22841477", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Mutations in TFAM, encoding mitochondrial transcription factor A, cause neonatal liver failure associated with mtDNA depletion.", "journal": "Molecular genetics and metabolism", "date": "2016", "authors": "Stiles AR, Simon MT, Stover A, Eftekharian S, Khanlou N, Wang HL, Magaki S, Lee H, Partynski K, Dorrani N, Chang R, Martinez-Agosto JA, Abdenur JE", "reference": { "type": "PubMed", "id": "27448789", "url": "https://pubmed.ncbi.nlm.nih.gov/27448789" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q00059-1", "protein_name": "Transcription factor A, mitochondrial", "gene_name": "TFAM", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q00059", "url": "https://www.uniprot.org/uniprotkb/Q00059" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.27448789", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Structural Basis of Mitochondrial Transcription Initiation.", "journal": "Cell", "date": "2017", "authors": "Hillen HS, Morozov YI, Sarfallah A, Temiakov D, Cramer P", "reference": { "type": "PubMed", "id": "29149603", "url": "https://pubmed.ncbi.nlm.nih.gov/29149603" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q00059-1", "protein_name": "Transcription factor A, mitochondrial", "gene_name": "TFAM", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H5Q4-1", "protein_name": "Dimethyladenosine transferase 2, mitochondrial", "gene_name": "TFB2M", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00411-1", "protein_name": "DNA-directed RNA polymerase, mitochondrial", "gene_name": "POLRMT", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q00059", "url": "https://www.uniprot.org/uniprotkb/Q00059" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 330, "end_pos": 330, "sequence_org": "R", "sequence_mut": "A", "comment": "Impairs transcription initiation; when associated with A-331.", "evidence": [ { "database": "UniProtKB", "id": "Q9H5Q4", "url": "https://www.uniprot.org/uniprotkb/Q9H5Q4" }, { "database": "PubMed", "id": "29149603", "url": "https://pubmed.ncbi.nlm.nih.gov/29149603" } ], "uniprot_canonical_ac": "Q9H5Q4-1" }, { "start_pos": 331, "end_pos": 331, "sequence_org": "R", "sequence_mut": "A", "comment": "Impairs transcription initiation; when associated with A-330.", "evidence": [ { "database": "UniProtKB", "id": "Q9H5Q4", "url": "https://www.uniprot.org/uniprotkb/Q9H5Q4" }, { "database": "PubMed", "id": "29149603", "url": "https://pubmed.ncbi.nlm.nih.gov/29149603" } ], "uniprot_canonical_ac": "Q9H5Q4-1" } ], "record_id": "pubmed.29149603", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Uncoupling FoxO3A mitochondrial and nuclear functions in cancer cells undergoing metabolic stress and chemotherapy.", "journal": "Cell death & disease", "date": "2018", "authors": "Celestini V, Tezil T, Russo L, Fasano C, Sanese P, Forte G, Peserico A, Lepore Signorile M, Longo G, De Rasmo D, Signorile A, Gadaleta RM, Scialpi N, Terao M, Garattini E, Cocco T, Villani G, Moschetta A, Grossi V, Simone C", "reference": { "type": "PubMed", "id": "29445193", "url": "https://pubmed.ncbi.nlm.nih.gov/29445193" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q00059-1", "protein_name": "Transcription factor A, mitochondrial", "gene_name": "TFAM", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9WVH4-1", "protein_name": "Forkhead box protein O3", "gene_name": "Foxo3", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "O00411-1", "protein_name": "DNA-directed RNA polymerase, mitochondrial", "gene_name": "POLRMT", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NTG7-1", "protein_name": "NAD-dependent protein deacetylase sirtuin-3, mitochondrial", "gene_name": "SIRT3", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43524-1", "protein_name": "Forkhead box protein O3", "gene_name": "FOXO3", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q00059", "url": "https://www.uniprot.org/uniprotkb/Q00059" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 12, "end_pos": 12, "sequence_org": "S", "sequence_mut": "A", "comment": "In normal cells, no defect in mitochondrion import following metabolic stress. In cancer cells, defective mitochondrion import following metabolic stress and abolition of ERK-mediated phosphorylation.", "evidence": [ { "database": "UniProtKB", "id": "O43524", "url": "https://www.uniprot.org/uniprotkb/O43524" }, { "database": "PubMed", "id": "29445193", "url": "https://pubmed.ncbi.nlm.nih.gov/29445193" } ], "uniprot_canonical_ac": "O43524-1" }, { "start_pos": 242, "end_pos": 271, "sequence_org": "KSGKAPRRRAVSMDNSNKYTKSRGRAAKKK", "sequence_mut": "", "comment": "Loss of nuclear import.", "evidence": [ { "database": "UniProtKB", "id": "O43524", "url": "https://www.uniprot.org/uniprotkb/O43524" }, { "database": "PubMed", "id": "29445193", "url": "https://pubmed.ncbi.nlm.nih.gov/29445193" } ], "uniprot_canonical_ac": "O43524-1" }, { "start_pos": 2, "end_pos": 148, "sequence_org": "AEAPASPAPLSPLEVELDPEFEPQSRPRSCTWPLQRPELQASPAKPSGETAADSMIPEEEDDEDDEDGGGRAGSAMAIGGGGGSGTLGSGLLLEDSARVLAPGGQDPGSGPATAAGGLSGGTQALLQPQQPLPPPQPGAAGGSGQPR", "sequence_mut": "", "comment": "Loss of localization to the mitochondrion outer membrane and loss of translocation into the mitochondrion following metabolic stress.", "evidence": [ { "database": "UniProtKB", "id": "O43524", "url": "https://www.uniprot.org/uniprotkb/O43524" }, { "database": "PubMed", "id": "29445193", "url": "https://pubmed.ncbi.nlm.nih.gov/29445193" } ], "uniprot_canonical_ac": "O43524-1" }, { "start_pos": 2, "end_pos": 30, "sequence_org": "AEAPASPAPLSPLEVELDPEFEPQSRPRS", "sequence_mut": "", "comment": "Loss of translocation into the mitochondrion following metabolic stress.", "evidence": [ { "database": "UniProtKB", "id": "O43524", "url": "https://www.uniprot.org/uniprotkb/O43524" }, { "database": "PubMed", "id": "29445193", "url": "https://pubmed.ncbi.nlm.nih.gov/29445193" } ], "uniprot_canonical_ac": "O43524-1" }, { "start_pos": 30, "end_pos": 30, "sequence_org": "S", "sequence_mut": "A", "comment": "Abolishes phosphorylation. Loss of localization to the mitochondrion outer membrane and loss of translocation into the mitochondrion following metabolic stress.", "evidence": [ { "database": "UniProtKB", "id": "O43524", "url": "https://www.uniprot.org/uniprotkb/O43524" }, { "database": "PubMed", "id": "29445193", "url": "https://pubmed.ncbi.nlm.nih.gov/29445193" } ], "uniprot_canonical_ac": "O43524-1" }, { "start_pos": 80, "end_pos": 108, "sequence_org": "GGGGGSGTLGSGLLLEDSARVLAPGGQDP", "sequence_mut": "", "comment": "Loss of translocation into the mitochondrion following metabolic stress.", "evidence": [ { "database": "UniProtKB", "id": "O43524", "url": "https://www.uniprot.org/uniprotkb/O43524" }, { "database": "PubMed", "id": "29445193", "url": "https://pubmed.ncbi.nlm.nih.gov/29445193" } ], "uniprot_canonical_ac": "O43524-1" } ], "phosphorylation": [ { "start_pos": 12, "end_pos": 12, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O43524", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O43524" }, { "database": "PubMed", "id": "19651622", "url": "https://pubmed.ncbi.nlm.nih.gov/19651622" }, { "database": "PubMed", "id": "20068231", "url": "https://pubmed.ncbi.nlm.nih.gov/20068231" }, { "database": "PubMed", "id": "29445193", "url": "https://pubmed.ncbi.nlm.nih.gov/29445193" } ], "site_lbl": "Ser12", "uniprot_canonical_ac": "O43524-1" }, { "start_pos": 30, "end_pos": 30, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by AMPK", "evidence": [ { "database": "UniProtKB", "id": "O43524", "url": "https://www.uniprot.org/uniprotkb/O43524" }, { "database": "iPTMnet", "id": "O43524", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O43524" }, { "database": "PubMed", "id": "29445193", "url": "https://pubmed.ncbi.nlm.nih.gov/29445193" } ], "site_lbl": "Ser30", "uniprot_canonical_ac": "O43524-1" } ], "record_id": "pubmed.29445193", "abstract": "", "glycosylation": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 5 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "N(6)-Deoxyadenosine Methylation in Mammalian Mitochondrial DNA.", "journal": "Molecular cell", "date": "2020", "authors": "Hao Z, Wu T, Cui X, Zhu P, Tan C, Dou X, Hsu KW, Lin YT, Peng PH, Zhang LS, Gao Y, Hu L, Sun HL, Zhu A, Liu J, Wu KJ, He C", "reference": { "type": "PubMed", "id": "32183942", "url": "https://pubmed.ncbi.nlm.nih.gov/32183942" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q00059-1", "protein_name": "Transcription factor A, mitochondrial", "gene_name": "TFAM", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N3J2-1", "protein_name": "N(6)-adenine-specific methyltransferase METTL4", "gene_name": "METTL4", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q00059", "url": "https://www.uniprot.org/uniprotkb/Q00059" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 287, "end_pos": 290, "sequence_org": "DPPW", "sequence_mut": "APPA", "comment": "Abolished methyltransferase activity.", "evidence": [ { "database": "UniProtKB", "id": "Q8N3J2", "url": "https://www.uniprot.org/uniprotkb/Q8N3J2" }, { "database": "PubMed", "id": "31913360", "url": "https://pubmed.ncbi.nlm.nih.gov/31913360" }, { "database": "PubMed", "id": "32183942", "url": "https://pubmed.ncbi.nlm.nih.gov/32183942" } ], "uniprot_canonical_ac": "Q8N3J2-1" } ], "record_id": "pubmed.32183942", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] } ]