[ { "title": "Analysis of self-antigen specificity of islet-infiltrating T cells from human donors with type 1 diabetes.", "journal": "Nature medicine", "date": "2016-12", "authors": "Babon Jenny Aurielle B, DeNicola Megan E, Blodgett David M, Cr\u00e8vecoeur Inne, Buttrick Thomas S, Maehr Ren\u00e9, Bottino Rita, Naji Ali, Kaddis John, Elyaman Wassim, James Eddie A, Haliyur Rachana, Brissova Marcela, Overbergh Lut, Mathieu Chantal, Delong Thomas, Haskins Kathryn, Pugliese Alberto, Campbell-Thompson Martha, Mathews Clayton, Atkinson Mark A, Powers Alvin C, Harlan David M, Kent Sally C", "reference": { "type": "PubMed", "id": "27798614", "url": "https://pubmed.ncbi.nlm.nih.gov/27798614" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q05329-1", "protein_name": "Glutamate decarboxylase 2", "gene_name": "GAD2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01308-1", "protein_name": "Insulin", "gene_name": "INS", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q05329", "url": "https://www.uniprot.org/uniprotkb/Q05329" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.27798614", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Combinatorial detection of autoreactive CD8+ T cells with HLA-A2 multimers: a multi-centre study by the Immunology of Diabetes Society T Cell Workshop.", "journal": "Diabetologia", "date": "2018-03", "authors": "James Eddie A, Abreu Joana R F, McGinty John W, Odegard Jared M, Filli\u00e9 Yvonne E, Hocter Claire N, Culina Slobodan, Ladell Kristin, Price David A, Alkanani Aimon, Rihanek Marynette, Fitzgerald-Miller Lisa, Skowera Ania, Speake Cate, Gottlieb Peter, Davidson Howard W, Wong F Susan, Roep Bart, Mallone Roberto,", "reference": { "type": "PubMed", "id": "29196783", "url": "https://pubmed.ncbi.nlm.nih.gov/29196783" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q05329-1", "protein_name": "Glutamate decarboxylase 2", "gene_name": "GAD2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P10997-1", "protein_name": "Islet amyloid polypeptide", "gene_name": "IAPP", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NQR9-1", "protein_name": "Glucose-6-phosphatase 2", "gene_name": "G6PC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01308-1", "protein_name": "Insulin", "gene_name": "INS", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16849-1", "protein_name": "Receptor-type tyrosine-protein phosphatase-like N", "gene_name": "PTPRN", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q05329", "url": "https://www.uniprot.org/uniprotkb/Q05329" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.29196783", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 5 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Identification of GAD65 AA 114-122 reactive 'memory-like' NK cells in newly diagnosed Type 1 diabetic patients by HLA-class I pentamers.", "journal": "PloS one", "date": "2017", "authors": "Perri V, Gianchecchi E, Cifaldi L, Pellegrino M, Giorda E, Andreani M, Cappa M, Fierabracci A", "reference": { "type": "PubMed", "id": "29236750", "url": "https://pubmed.ncbi.nlm.nih.gov/29236750" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q05329-1", "protein_name": "Glutamate decarboxylase 2", "gene_name": "GAD2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q05329", "url": "https://www.uniprot.org/uniprotkb/Q05329" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.29236750", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Islet-reactive CD8+ T cell frequencies in the pancreas, but not in blood, distinguish type 1 diabetic patients from healthy donors.", "journal": "Science immunology", "date": "2018-02-02", "authors": "Culina Slobodan, Lalanne Ana Ines, Afonso Georgia, Cerosaletti Karen, Pinto Sheena, Sebastiani Guido, Kuranda Klaudia, Nigi Laura, Eugster Anne, \u00d8sterbye Thomas, Maugein Alicia, McLaren James E, Ladell Kristin, Larger Etienne, Beressi Jean-Paul, Lissina Anna, Appay Victor, Davidson Howard W, Buus S\u00f8ren, Price David A, Kuhn Matthias, Bonifacio Ezio, Battaglia Manuela, Caillat-Zucman Sophie, Dotta Francesco, Scharfmann Raphael, Kyewski Bruno, Mallone Roberto,", "reference": { "type": "PubMed", "id": "29429978", "url": "https://pubmed.ncbi.nlm.nih.gov/29429978" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q05329-1", "protein_name": "Glutamate decarboxylase 2", "gene_name": "GAD2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8IWU4-1", "protein_name": "Proton-coupled zinc antiporter SLC30A8", "gene_name": "SLC30A8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NQR9-1", "protein_name": "Glucose-6-phosphatase 2", "gene_name": "G6PC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01308-1", "protein_name": "Insulin", "gene_name": "INS", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16849-1", "protein_name": "Receptor-type tyrosine-protein phosphatase-like N", "gene_name": "PTPRN", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q05329", "url": "https://www.uniprot.org/uniprotkb/Q05329" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.29429978", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 5 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Autoreactive T effector memory differentiation mirrors \u03b2 cell function in type 1 diabetes.", "journal": "The Journal of clinical investigation", "date": "2018-08-01", "authors": "Yeo Lorraine, Woodwyk Alyssa, Sood Sanjana, Lorenc Anna, Eichmann Martin, Pujol-Autonell Irma, Melchiotti Rosella, Skowera Ania, Fidanis Efthymios, Dolton Garry M, Tungatt Katie, Sewell Andrew K, Heck Susanne, Saxena Alka, Beam Craig A, Peakman Mark", "reference": { "type": "PubMed", "id": "29851415", "url": "https://pubmed.ncbi.nlm.nih.gov/29851415" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q05329-1", "protein_name": "Glutamate decarboxylase 2", "gene_name": "GAD2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NQR9-1", "protein_name": "Glucose-6-phosphatase 2", "gene_name": "G6PC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01308-1", "protein_name": "Insulin", "gene_name": "INS", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16849-1", "protein_name": "Receptor-type tyrosine-protein phosphatase-like N", "gene_name": "PTPRN", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q05329", "url": "https://www.uniprot.org/uniprotkb/Q05329" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.29851415", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 4 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Humanized Mouse Model to Study Type 1 Diabetes.", "journal": "Diabetes", "date": "2018-09", "authors": "Luce Sandrine, Guinoiseau Sophie, Gadault Alexis, Letourneur Franck, Blondeau Bertrand, Nitschke Patrick, Pasmant Eric, Vidaud Michel, Lemonnier Fran\u00e7ois, Boitard Christian", "reference": { "type": "PubMed", "id": "29967002", "url": "https://pubmed.ncbi.nlm.nih.gov/29967002" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q05329-1", "protein_name": "Glutamate decarboxylase 2", "gene_name": "GAD2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8BGG0-1", "protein_name": "Proton-coupled zinc antiporter SLC30A8", "gene_name": "Slc30a8", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "P01308-1", "protein_name": "Insulin", "gene_name": "INS", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q05329", "url": "https://www.uniprot.org/uniprotkb/Q05329" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.29967002", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Optimized Peptide-MHC Multimer Protocols for Detection and Isolation of Autoimmune T-Cells.", "journal": "Frontiers in immunology", "date": "2018", "authors": "Dolton Garry, Zervoudi Efthalia, Rius Cristina, Wall Aaron, Thomas Hannah L, Fuller Anna, Yeo Lorraine, Legut Mateusz, Wheeler Sophie, Attaf Meriem, Chudakov Dmitriy M, Choy Ernest, Peakman Mark, Sewell Andrew K", "reference": { "type": "PubMed", "id": "30008714", "url": "https://pubmed.ncbi.nlm.nih.gov/30008714" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q05329-1", "protein_name": "Glutamate decarboxylase 2", "gene_name": "GAD2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NQR9-1", "protein_name": "Glucose-6-phosphatase 2", "gene_name": "G6PC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y6M1-2", "protein_name": "Insulin-like growth factor 2 mRNA-binding protein 2", "gene_name": "IGF2BP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P32241-1", "protein_name": "Vasoactive intestinal polypeptide receptor 1", "gene_name": "VIPR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01308-1", "protein_name": "Insulin", "gene_name": "INS", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16655-1", "protein_name": "Melanoma antigen recognized by T-cells 1", "gene_name": "MLANA", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q05329", "url": "https://www.uniprot.org/uniprotkb/Q05329" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.30008714", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 6 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Analysis of pancreatic beta cell specific CD4+ T cells reveals a predominance of proinsulin specific cells.", "journal": "Cellular immunology", "date": "2019-01", "authors": "Blahnik Gabriele, Uchtenhagen Hannes, Chow I-Ting, Speake Cate, Greenbaum Carla, Kwok William W, James Eddie A", "reference": { "type": "PubMed", "id": "30428974", "url": "https://pubmed.ncbi.nlm.nih.gov/30428974" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q05329-1", "protein_name": "Glutamate decarboxylase 2", "gene_name": "GAD2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NQR9-1", "protein_name": "Glucose-6-phosphatase 2", "gene_name": "G6PC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01308-1", "protein_name": "Insulin", "gene_name": "INS", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16849-1", "protein_name": "Receptor-type tyrosine-protein phosphatase-like N", "gene_name": "PTPRN", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q05329", "url": "https://www.uniprot.org/uniprotkb/Q05329" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.30428974", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 4 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "A Novel Approach of Identifying Immunodominant Self and Viral Antigen Cross-Reactive T Cells and Defining the Epitopes They Recognize.", "journal": "Frontiers in immunology", "date": "2018", "authors": "Yang Junbao, Jing Lichen, James Eddie A, Gebe John A, Koelle David M, Kwok William W", "reference": { "type": "PubMed", "id": "30619245", "url": "https://pubmed.ncbi.nlm.nih.gov/30619245" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q05329-1", "protein_name": "Glutamate decarboxylase 2", "gene_name": "GAD2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q05329", "url": "https://www.uniprot.org/uniprotkb/Q05329" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.30619245", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Fine Mapping of Glutamate Decarboxylase 65 Epitopes Reveals Dependency on Hydrophobic Amino Acids for Specific Interactions.", "journal": "International journal of molecular sciences", "date": "2019-06-14", "authors": "Valdarnini Niccol\u00f2, Holm Bettina, Hansen Paul, Rovero Paolo, Houen Gunnar, Trier Nicole", "reference": { "type": "PubMed", "id": "31207885", "url": "https://pubmed.ncbi.nlm.nih.gov/31207885" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q05329-1", "protein_name": "Glutamate decarboxylase 2", "gene_name": "GAD2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q05329", "url": "https://www.uniprot.org/uniprotkb/Q05329" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.31207885", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Slow progressors to type 1 diabetes lose islet autoantibodies over time, have few islet antigen-specific CD8+ T cells and exhibit a distinct CD95hi B cell phenotype.", "journal": "Diabetologia", "date": "2020-06", "authors": "Hanna Stephanie J, Powell Wendy E, Long Anna E, Robinson Emma J S, Davies Joanne, Megson Clare, Howell Alexandra, Jones Taz J, Ladell Kristin, Price David A, Dayan Colin M, Williams Alistair J K, Gillespie Kathleen M, Wong F Susan", "reference": { "type": "PubMed", "id": "32157332", "url": "https://pubmed.ncbi.nlm.nih.gov/32157332" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q05329-1", "protein_name": "Glutamate decarboxylase 2", "gene_name": "GAD2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P10997-1", "protein_name": "Islet amyloid polypeptide", "gene_name": "IAPP", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NQR9-1", "protein_name": "Glucose-6-phosphatase 2", "gene_name": "G6PC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01308-1", "protein_name": "Insulin", "gene_name": "INS", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16849-1", "protein_name": "Receptor-type tyrosine-protein phosphatase-like N", "gene_name": "PTPRN", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q05329", "url": "https://www.uniprot.org/uniprotkb/Q05329" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.32157332", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 5 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "In vitro and ex vivo functional characterization of human HLA-DRB1\u221704 restricted T cell receptors.", "journal": "Journal of translational autoimmunity", "date": "2021", "authors": "Boddul Sanjaykumar V, Sharma Ravi Kumar, Dubnovitsky Anatoly, Raposo Bruno, Gerstner Christina, Shen Yunbing, Iyer Vaishnavi Srinivasan, Kasza Zsolt, Kwok William W, Winkler Aaron R, Klareskog Lars, Malmstr\u00f6m Vivianne, Bettini Maria, Wermeling Fredrik", "reference": { "type": "PubMed", "id": "33768201", "url": "https://pubmed.ncbi.nlm.nih.gov/33768201" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q05329-1", "protein_name": "Glutamate decarboxylase 2", "gene_name": "GAD2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q05329", "url": "https://www.uniprot.org/uniprotkb/Q05329" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.33768201", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Similarities between bacterial GAD and human GAD65: Implications in gut mediated autoimmune type 1 diabetes.", "journal": "PloS one", "date": "2022", "authors": "Bedi S, Richardson TM, Jia B, Saab H, Brinkman FSL, Westley M", "reference": { "type": "PubMed", "id": "35196314", "url": "https://pubmed.ncbi.nlm.nih.gov/35196314" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q05329-1", "protein_name": "Glutamate decarboxylase 2", "gene_name": "GAD2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q05329", "url": "https://www.uniprot.org/uniprotkb/Q05329" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.35196314", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The plasma level of glutamic acid decarboxylase 65 (GAD65) increased in severely autistic Iranian children.", "journal": "Bratislavske lekarske listy", "date": "2022", "authors": "Vazifekhah S, Barfi S, Soleimany F, Aliakbar A, Zavvari F, Karimzadeh F", "reference": { "type": "PubMed", "id": "35420879", "url": "https://pubmed.ncbi.nlm.nih.gov/35420879" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q05329-1", "protein_name": "Glutamate decarboxylase 2", "gene_name": "GAD2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q05329", "url": "https://www.uniprot.org/uniprotkb/Q05329" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.35420879", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Heterogeneity of circulating CXCR5-PD-1hiTph cells in patients of type 2 and type 1 diabetes in Chinese population.", "journal": "Acta diabetologica", "date": "2023-03-06", "authors": "Su Zhangyao, Ma Chenggong, Zhao Ruiling, Jiang Yin, Cai Yun, Yong Gu, Yang Tao, Xu Xinyu", "reference": { "type": "PubMed", "id": "36879107", "url": "https://pubmed.ncbi.nlm.nih.gov/36879107" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q05329-1", "protein_name": "Glutamate decarboxylase 2", "gene_name": "GAD2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P32302-1", "protein_name": "C-X-C chemokine receptor type 5", "gene_name": "CXCR5", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q05329", "url": "https://www.uniprot.org/uniprotkb/Q05329" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.36879107", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Technical Validation and Utility of an HLA Class II Tetramer Assay for Type 1 Diabetes: A Multicenter Study.", "journal": "The Journal of clinical endocrinology and metabolism", "date": "2023-12-21", "authors": "Ettinger Ruth A, Buitinga Mijke, Vandamme C\u00e9line, Afonso Georgia, Gomez Rebecca, Arribas-Layton David, Bissenova Samal, Speake Cate, Reijonen Helena, Kinnunen Tuure, Overbergh Lut, Mallone Roberto, Kwok William W, James Eddie A", "reference": { "type": "PubMed", "id": "37474341", "url": "https://pubmed.ncbi.nlm.nih.gov/37474341" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q05329-1", "protein_name": "Glutamate decarboxylase 2", "gene_name": "GAD2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8IWU4-1", "protein_name": "Proton-coupled zinc antiporter SLC30A8", "gene_name": "SLC30A8", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q05329", "url": "https://www.uniprot.org/uniprotkb/Q05329" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.37474341", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Coxsackievirus infection induces direct pancreatic \u03b2 cell killing but poor antiviral CD8+ T cell responses.", "journal": "Science advances", "date": "2024-03-08", "authors": "Vecchio Federica, Carr\u00e9 Alexia, Korenkov Daniil, Zhou Zhicheng, Apaolaza Paola, Tuomela Soile, Burgos-Morales Orlando, Snowhite Isaac, Perez-Hernandez Javier, Brandao Barbara, Afonso Georgia, Halliez Cl\u00e9mentine, Kaddis John, Kent Sally C, Nakayama Maki, Richardson Sarah J, Vinh Joelle, Verdier Yann, Laiho Jutta, Scharfmann Raphael, Solimena Michele, Marinicova Zuzana, Bismuth Elise, Lucidarme Nadine, Sanchez Janine, Bustamante Carmen, Gomez Patricia, Buus Soren, , You Sylvaine, Pugliese Alberto, Hyoty Heikki, Rodriguez-Calvo Teresa, Flodstrom-Tullberg Malin, Mallone Roberto", "reference": { "type": "PubMed", "id": "38446892", "url": "https://pubmed.ncbi.nlm.nih.gov/38446892" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q05329-1", "protein_name": "Glutamate decarboxylase 2", "gene_name": "GAD2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8IWU4-1", "protein_name": "Proton-coupled zinc antiporter SLC30A8", "gene_name": "SLC30A8", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q05329", "url": "https://www.uniprot.org/uniprotkb/Q05329" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.38446892", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "GAD65 tunes the functions of Best1 as a GABA receptor and a neurotransmitter conducting channel.", "journal": "Nature communications", "date": "2024-09-14", "authors": "Wang Jiali, Owji Aaron P, Kittredge Alec, Clark Zada, Zhang Yu, Yang Tingting", "reference": { "type": "PubMed", "id": "39277606", "url": "https://pubmed.ncbi.nlm.nih.gov/39277606" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q05329-1", "protein_name": "Glutamate decarboxylase 2", "gene_name": "GAD2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O76090-1", "protein_name": "Bestrophin-1", "gene_name": "BEST1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q05329", "url": "https://www.uniprot.org/uniprotkb/Q05329" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.39277606", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Characterization of a linear epitope within the human pancreatic 64-kDa glutamic acid decarboxylase and its autoimmune recognition by sera from insulin-dependent diabetes mellitus patients.", "journal": "Eur. J. Biochem.", "date": "1993", "authors": "Mauch L, Abney C C, Berg H, Scherbaum W A, Liedvogel B, Northemann W", "reference": { "type": "PubMed", "id": "7680313", "url": "https://pubmed.ncbi.nlm.nih.gov/7680313" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q05329-1", "protein_name": "Glutamate decarboxylase 2", "gene_name": "GAD2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q05329", "url": "https://www.uniprot.org/uniprotkb/Q05329" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.7680313", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Cytotoxic T cells specific for glutamic acid decarboxylase in autoimmune diabetes.", "journal": "The Journal of experimental medicine", "date": "1995-05-01", "authors": "Panina-Bordignon P, Lang R, van Endert P M, Benazzi E, Felix A M, Pastore R M, Spinas G A, Sinigaglia F", "reference": { "type": "PubMed", "id": "7722468", "url": "https://pubmed.ncbi.nlm.nih.gov/7722468" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q05329-1", "protein_name": "Glutamate decarboxylase 2", "gene_name": "GAD2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q05329", "url": "https://www.uniprot.org/uniprotkb/Q05329" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.7722468", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The exon-intron organization of the genes (GAD1 and GAD2) encoding two human glutamate decarboxylases (GAD67 and GAD65) suggests that they derive from a common ancestral GAD.", "journal": "Genomics", "date": "1994", "authors": "Bu D F, Tobin A J", "reference": { "type": "PubMed", "id": "8088791", "url": "https://pubmed.ncbi.nlm.nih.gov/8088791" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q05329-1", "protein_name": "Glutamate decarboxylase 2", "gene_name": "GAD2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99259-1", "protein_name": "Glutamate decarboxylase 1", "gene_name": "GAD1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q05329", "url": "https://www.uniprot.org/uniprotkb/Q05329" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.8088791", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Differential expression of GAD65 and GAD67 in human, rat, and mouse pancreatic islets.", "journal": "Diabetes", "date": "1993", "authors": "Kim J, Richter W, Aanstoot H J, Shi Y, Fu Q, Rajotte R, Warnock G, Baekkeskov S", "reference": { "type": "PubMed", "id": "8243826", "url": "https://pubmed.ncbi.nlm.nih.gov/8243826" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q05329-1", "protein_name": "Glutamate decarboxylase 2", "gene_name": "GAD2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q05329", "url": "https://www.uniprot.org/uniprotkb/Q05329" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.8243826", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Similar peptides from two beta cell autoantigens, proinsulin and glutamic acid decarboxylase, stimulate T cells of individuals at risk for insulin-dependent diabetes.", "journal": "Molecular medicine (Cambridge, Mass.)", "date": "1995-09", "authors": "Rudy G, Stone N, Harrison L C, Colman P G, McNair P, Brusic V, French M B, Honeyman M C, Tait B, Lew A M", "reference": { "type": "PubMed", "id": "8529129", "url": "https://pubmed.ncbi.nlm.nih.gov/8529129" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q05329-1", "protein_name": "Glutamate decarboxylase 2", "gene_name": "GAD2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01308-1", "protein_name": "Insulin", "gene_name": "INS", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q05329", "url": "https://www.uniprot.org/uniprotkb/Q05329" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.8529129", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "T cell clones to epitopes of glutamic acid decarboxylase 65 raised from normal subjects and patients with insulin-dependent diabetes.", "journal": "Journal of autoimmunity", "date": "1996-06", "authors": "Lohmann T, Leslie R D, Londei M", "reference": { "type": "PubMed", "id": "8816975", "url": "https://pubmed.ncbi.nlm.nih.gov/8816975" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q05329-1", "protein_name": "Glutamate decarboxylase 2", "gene_name": "GAD2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q05329", "url": "https://www.uniprot.org/uniprotkb/Q05329" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.8816975", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Naturally processed T cell epitopes from human glutamic acid decarboxylase identified using mice transgenic for the type 1 diabetes-associated human MHC class II allele, DRB1*0401.", "journal": "The Journal of clinical investigation", "date": "1996-12-01", "authors": "Wicker L S, Chen S L, Nepom G T, Elliott J F, Freed D C, Bansal A, Zheng S, Herman A, Lernmark A, Zaller D M, Peterson L B, Rothbard J B, Cummings R, Whiteley P J", "reference": { "type": "PubMed", "id": "8958223", "url": "https://pubmed.ncbi.nlm.nih.gov/8958223" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q05329-1", "protein_name": "Glutamate decarboxylase 2", "gene_name": "GAD2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q05329", "url": "https://www.uniprot.org/uniprotkb/Q05329" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.8958223", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Phosphorylation of serine residues 3, 6, 10, and 13 distinguishes membrane anchored from soluble glutamic acid decarboxylase 65 and is restricted to glutamic acid decarboxylase 65alpha.", "journal": "The Journal of biological chemistry", "date": "1997", "authors": "Namchuk M, Lindsay L, Turck CW, Kanaani J, Baekkeskov S", "reference": { "type": "PubMed", "id": "8999827", "url": "https://pubmed.ncbi.nlm.nih.gov/8999827" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q05329-1", "protein_name": "Glutamate decarboxylase 2", "gene_name": "GAD2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q05683-1", "protein_name": "Glutamate decarboxylase 2", "gene_name": "Apbb1ip; Gad2", "tax_name": "Rat" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q05329", "url": "https://www.uniprot.org/uniprotkb/Q05329" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 3, "end_pos": 13, "sequence_org": "SPGSGFWSFGS", "sequence_mut": "APGAGFWAFGA", "comment": "No effect on glutamate decarboxylase activity.", "evidence": [ { "database": "UniProtKB", "id": "Q05329", "url": "https://www.uniprot.org/uniprotkb/Q05329" }, { "database": "PubMed", "id": "8999827", "url": "https://pubmed.ncbi.nlm.nih.gov/8999827" } ], "uniprot_canonical_ac": "Q05329-1" }, { "start_pos": 10, "end_pos": 17, "sequence_org": "SFGSEDGS", "sequence_mut": "AFGAEDGA", "comment": "No effect on glutamate decarboxylase activity.", "evidence": [ { "database": "UniProtKB", "id": "Q05683", "url": "https://www.uniprot.org/uniprotkb/Q05683" }, { "database": "PubMed", "id": "8999827", "url": "https://pubmed.ncbi.nlm.nih.gov/8999827" } ], "uniprot_canonical_ac": "Q05683-1" }, { "start_pos": 30, "end_pos": 30, "sequence_org": "C", "sequence_mut": "A", "comment": "Abolishes palmitoylation but not membrane-association; when associates with A-45. No effect on glutamate decarboxylase activity; when associated with A-45.", "evidence": [ { "database": "UniProtKB", "id": "Q05683", "url": "https://www.uniprot.org/uniprotkb/Q05683" }, { "database": "PubMed", "id": "8132714", "url": "https://pubmed.ncbi.nlm.nih.gov/8132714" }, { "database": "PubMed", "id": "8999827", "url": "https://pubmed.ncbi.nlm.nih.gov/8999827" } ], "uniprot_canonical_ac": "Q05683-1" }, { "start_pos": 45, "end_pos": 45, "sequence_org": "C", "sequence_mut": "A", "comment": "Abolishes palmitoylation but not membrane-association; when associates with A-30. No effect on glutamate decarboxylase activity; when associated with A-30.", "evidence": [ { "database": "UniProtKB", "id": "Q05683", "url": "https://www.uniprot.org/uniprotkb/Q05683" }, { "database": "PubMed", "id": "8132714", "url": "https://pubmed.ncbi.nlm.nih.gov/8132714" }, { "database": "PubMed", "id": "8999827", "url": "https://pubmed.ncbi.nlm.nih.gov/8999827" } ], "uniprot_canonical_ac": "Q05683-1" } ], "phosphorylation": [ { "start_pos": 10, "end_pos": 10, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "Q05329", "url": "https://www.uniprot.org/uniprotkb/Q05329" }, { "database": "PubMed", "id": "8999827", "url": "https://pubmed.ncbi.nlm.nih.gov/8999827" }, { "database": "iPTMnet", "id": "Q05329", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q05329" } ], "site_lbl": "Ser10", "uniprot_canonical_ac": "Q05329-1" }, { "start_pos": 13, "end_pos": 13, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "Q05329", "url": "https://www.uniprot.org/uniprotkb/Q05329" }, { "database": "PubMed", "id": "8999827", "url": "https://pubmed.ncbi.nlm.nih.gov/8999827" }, { "database": "iPTMnet", "id": "Q05329", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q05329" } ], "site_lbl": "Ser13", "uniprot_canonical_ac": "Q05329-1" }, { "start_pos": 3, "end_pos": 3, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "Q05329", "url": "https://www.uniprot.org/uniprotkb/Q05329" }, { "database": "PubMed", "id": "8999827", "url": "https://pubmed.ncbi.nlm.nih.gov/8999827" }, { "database": "iPTMnet", "id": "Q05329", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q05329" } ], "site_lbl": "Ser3", "uniprot_canonical_ac": "Q05329-1" }, { "start_pos": 6, "end_pos": 6, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "Q05329", "url": "https://www.uniprot.org/uniprotkb/Q05329" }, { "database": "PubMed", "id": "8999827", "url": "https://pubmed.ncbi.nlm.nih.gov/8999827" }, { "database": "iPTMnet", "id": "Q05329", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q05329" } ], "site_lbl": "Ser6", "uniprot_canonical_ac": "Q05329-1" }, { "start_pos": 10, "end_pos": 10, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "Q05683", "url": "https://www.uniprot.org/uniprotkb/Q05683" }, { "database": "PubMed", "id": "8999827", "url": "https://pubmed.ncbi.nlm.nih.gov/8999827" }, { "database": "iPTMnet", "id": "Q05683", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q05683" } ], "site_lbl": "Ser10", "uniprot_canonical_ac": "Q05683-1" }, { "start_pos": 13, "end_pos": 13, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "Q05683", "url": "https://www.uniprot.org/uniprotkb/Q05683" }, { "database": "PubMed", "id": "22673903", "url": "https://pubmed.ncbi.nlm.nih.gov/22673903" }, { "database": "PubMed", "id": "8999827", "url": "https://pubmed.ncbi.nlm.nih.gov/8999827" }, { "database": "iPTMnet", "id": "Q05683", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q05683" } ], "site_lbl": "Ser13", "uniprot_canonical_ac": "Q05683-1" }, { "start_pos": 17, "end_pos": 17, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "Q05683", "url": "https://www.uniprot.org/uniprotkb/Q05683" }, { "database": "PubMed", "id": "8999827", "url": "https://pubmed.ncbi.nlm.nih.gov/8999827" }, { "database": "iPTMnet", "id": "Q05683", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q05683" } ], "site_lbl": "Ser17", "uniprot_canonical_ac": "Q05683-1" }, { "start_pos": 3, "end_pos": 3, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "Q05683", "url": "https://www.uniprot.org/uniprotkb/Q05683" }, { "database": "PubMed", "id": "8999827", "url": "https://pubmed.ncbi.nlm.nih.gov/8999827" }, { "database": "PubMed", "id": "22673903", "url": "https://pubmed.ncbi.nlm.nih.gov/22673903" }, { "database": "iPTMnet", "id": "Q05683", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q05683" } ], "site_lbl": "Ser3", "uniprot_canonical_ac": "Q05683-1" }, { "start_pos": 6, "end_pos": 6, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "Q05683", "url": "https://www.uniprot.org/uniprotkb/Q05683" }, { "database": "PubMed", "id": "8999827", "url": "https://pubmed.ncbi.nlm.nih.gov/8999827" }, { "database": "iPTMnet", "id": "Q05683", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q05683" } ], "site_lbl": "Ser6", "uniprot_canonical_ac": "Q05683-1" } ], "record_id": "pubmed.8999827", "abstract": "", "glycosylation": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 9 }, { "field": "total_sites", "count": 5 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Identification of immunogenic epitopes of GAD 65 presented by Ag7 in non-obese diabetic mice.", "journal": "Immunogenetics", "date": "1997", "authors": "Chao C C, McDevitt H O", "reference": { "type": "PubMed", "id": "9148785", "url": "https://pubmed.ncbi.nlm.nih.gov/9148785" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q05329-1", "protein_name": "Glutamate decarboxylase 2", "gene_name": "GAD2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q05329", "url": "https://www.uniprot.org/uniprotkb/Q05329" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.9148785", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Identification of naturally processed T cell epitopes from glutamic acid decarboxylase presented in the context of HLA-DR alleles by T lymphocytes of recent onset IDDM patients.", "journal": "The Journal of clinical investigation", "date": "1997-05-15", "authors": "Endl J, Otto H, Jung G, Dreisbusch B, Donie F, Stahl P, Elbracht R, Schmitz G, Meinl E, Hummel M, Ziegler A G, Wank R, Schendel D J", "reference": { "type": "PubMed", "id": "9153283", "url": "https://pubmed.ncbi.nlm.nih.gov/9153283" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q05329-1", "protein_name": "Glutamate decarboxylase 2", "gene_name": "GAD2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q05329", "url": "https://www.uniprot.org/uniprotkb/Q05329" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.9153283", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Identification of immunodominant T cell epitopes of human glutamic acid decarboxylase 65 by using HLA-DR(alpha1*0101,beta1*0401) transgenic mice.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1997-07-22", "authors": "Patel S D, Cope A P, Congia M, Chen T T, Kim E, Fugger L, Wherrett D, Sonderstrup-McDevitt G", "reference": { "type": "PubMed", "id": "9223318", "url": "https://pubmed.ncbi.nlm.nih.gov/9223318" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q05329-1", "protein_name": "Glutamate decarboxylase 2", "gene_name": "GAD2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q05329", "url": "https://www.uniprot.org/uniprotkb/Q05329" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.9223318", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "High affinity presentation of an autoantigenic peptide in type I diabetes by an HLA class II protein encoded in a haplotype protecting from disease.", "journal": "Journal of autoimmunity", "date": "1997-08", "authors": "Bach J M, Otto H, Nepom G T, Jung G, Cohen H, Timsit J, Boitard C, van Endert P M", "reference": { "type": "PubMed", "id": "9237801", "url": "https://pubmed.ncbi.nlm.nih.gov/9237801" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q05329-1", "protein_name": "Glutamate decarboxylase 2", "gene_name": "GAD2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q05329", "url": "https://www.uniprot.org/uniprotkb/Q05329" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.9237801", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Identification of mimicry peptides based on sequential motifs of epitopes derived from 65-kDa glutamic acid decarboxylase.", "journal": "European journal of immunology", "date": "1998-06", "authors": "Bach J M, Otto H, Jung G, Cohen H, Boitard C, Bach J F, van Endert P M", "reference": { "type": "PubMed", "id": "9645372", "url": "https://pubmed.ncbi.nlm.nih.gov/9645372" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q05329-1", "protein_name": "Glutamate decarboxylase 2", "gene_name": "GAD2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q05329", "url": "https://www.uniprot.org/uniprotkb/Q05329" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.9645372", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "HLA-DR4 (DRB1*0401) transgenic mice expressing an altered CD4-binding site: specificity and magnitude of DR4-restricted T cell response.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "1998-09-15", "authors": "Pan S, Trejo T, Hansen J, Smart M, David C S", "reference": { "type": "PubMed", "id": "9743354", "url": "https://pubmed.ncbi.nlm.nih.gov/9743354" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q05329-1", "protein_name": "Glutamate decarboxylase 2", "gene_name": "GAD2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q05329", "url": "https://www.uniprot.org/uniprotkb/Q05329" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.9743354", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Characterization of self-glutamic acid decarboxylase 65-reactive CD4+ T-cell clones established from Japanese patients with insulin-dependent diabetes mellitus.", "journal": "Human immunology", "date": "1998-09", "authors": "Tabata H, Kanai T, Yoshizumi H, Nishiyama S, Fujimoto S, Matsuda I, Yasukawa M, Matsushita S, Nishimura Y", "reference": { "type": "PubMed", "id": "9757911", "url": "https://pubmed.ncbi.nlm.nih.gov/9757911" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q05329-1", "protein_name": "Glutamate decarboxylase 2", "gene_name": "GAD2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q05329", "url": "https://www.uniprot.org/uniprotkb/Q05329" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.9757911", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Definition of natural T cell antigens with mimicry epitopes obtained from dedicated synthetic peptide libraries.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "1998-10-15", "authors": "Hiemstra H S, van Veelen P A, Schloot N C, Geluk A, van Meijgaarden K E, Willemen S J, Leunissen J A, Benckhuijsen W E, Amons R, de Vries R R, Roep B O, Ottenhoff T H, Drijfhout J W", "reference": { "type": "PubMed", "id": "9780178", "url": "https://pubmed.ncbi.nlm.nih.gov/9780178" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q05329-1", "protein_name": "Glutamate decarboxylase 2", "gene_name": "GAD2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q05329", "url": "https://www.uniprot.org/uniprotkb/Q05329" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.9780178", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Glutamic acid decarboxylase T lymphocyte responses associated with susceptibility or resistance to type I diabetes: analysis in disease discordant human twins, non-obese diabetic mice and HLA-DQ transgenic mice.", "journal": "International immunology", "date": "1998-12", "authors": "Boyton R J, Lohmann T, Londei M, Kalbacher H, Halder T, Frater A J, Douek D C, Leslie D G, Flavell R A, Altmann D M", "reference": { "type": "PubMed", "id": "9885897", "url": "https://pubmed.ncbi.nlm.nih.gov/9885897" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q05329-1", "protein_name": "Glutamate decarboxylase 2", "gene_name": "GAD2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q05329", "url": "https://www.uniprot.org/uniprotkb/Q05329" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.9885897", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "CFAP45 deficiency causes situs abnormalities and asthenospermia by disrupting an axonemal adenine nucleotide homeostasis module.", "journal": "Nat. Commun.", "date": "2020", "authors": "Dougherty GW, Mizuno K, Nothe-Menchen T, Ikawa Y, Boldt K, Ta-Shma A, Aprea I, Minegishi K, Pang YP, Pennekamp P, Loges NT, Raidt J, Hjeij R, Wallmeier J, Mussaffi H, Perles Z, Elpeleg O, Rabert F, Shiratori H, Letteboer SJ, Horn N, Young S, Strunker T, Stumme F, Werner C, Olbrich H, Takaoka K, Ide T, Twan WK, Biebach L, Grosse-Onnebrink J, Klinkenbusch JA, Praveen K, Bracht DC, Hoben IM, Junger K, Gutzlaff J, Cindric S, Aviram M, Kaiser T, Memari Y, Dzeja PP, Dworniczak B, Ueffing M, Roepman R, Bartscherer K, Katsanis N, Davis EE, Amirav I, Hamada H, Omran H", "reference": { "type": "PubMed", "id": "33139725", "url": "https://pubmed.ncbi.nlm.nih.gov/33139725" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q96MA6-1", "protein_name": "Adenylate kinase 8", "gene_name": "AK8", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14645-1", "protein_name": "Axonemal dynein light intermediate polypeptide 1", "gene_name": "DNALI1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TC29-1", "protein_name": "Enkurin", "gene_name": "ENKUR", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N1V2-1", "protein_name": "Cilia- and flagella-associated protein 52", "gene_name": "CFAP52", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UL16-1", "protein_name": "Cilia- and flagella-associated protein 45", "gene_name": "CFAP45", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9GZS0-1", "protein_name": "Dynein axonemal intermediate chain 2", "gene_name": "DNAI2", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A4X1TZW7-1", "protein_name": "Enkurin", "gene_name": "ENKUR", "tax_name": "Pig" }, { "uniprot_canonical_ac": "F1SS88-1", "protein_name": "Cilia- and flagella-associated protein 52", "gene_name": "CFAP52", "tax_name": "Pig" }, { "uniprot_canonical_ac": "F1RKB1-1", "protein_name": "Dynein regulatory complex subunit 10", "gene_name": "DRC10", "tax_name": "Pig" }, { "uniprot_canonical_ac": "F1SC07-1", "protein_name": "Dynein axonemal heavy chain 11", "gene_name": "DNAH11", "tax_name": "Pig" }, { "uniprot_canonical_ac": "A0A4X1T4U3-1", "protein_name": "Adenylate kinase 8", "gene_name": "AK8", "tax_name": "Pig" }, { "uniprot_canonical_ac": "Q9D9U9-1", "protein_name": "Cilia- and flagella-associated protein 45", "gene_name": "Cfap45", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "A0A480NP79-1", "protein_name": "Cilia- and flagella-associated protein 45", "gene_name": "CFAP45", "tax_name": "Pig" }, { "uniprot_canonical_ac": "Q96DT5-1", "protein_name": "Dynein axonemal heavy chain 11", "gene_name": "DNAH11", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UI46-1", "protein_name": "Dynein axonemal intermediate chain 1", "gene_name": "DNAI1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q96MA6", "url": "https://www.uniprot.org/uniprotkb/Q96MA6" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.33139725", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 15 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "A novel tumour associated leucine zipper protein targeting to sites of gene transcription and splicing.", "journal": "Oncogene", "date": "2002", "authors": "Tureci O, Sahin U, Koslowski M, Buss B, Bell C, Ballweber P, Zwick C, Eberle T, Zuber M, Villena-Heinsen C, Seitz G, Pfreundschuh M", "reference": { "type": "PubMed", "id": "12032826", "url": "https://pubmed.ncbi.nlm.nih.gov/12032826" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9P127-1", "protein_name": "Leucine zipper protein 4", "gene_name": "LUZP4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q0D2I5-1", "protein_name": "Non-homologous end joining factor IFFO1", "gene_name": "IFFO1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9P127", "url": "https://www.uniprot.org/uniprotkb/Q9P127" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.12032826", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Genetic risk reclassification for type 2 diabetes by age below or above 50 years using 40 type 2 diabetes risk single nucleotide polymorphisms.", "journal": "Diabetes care", "date": "2011", "authors": "de Miguel-Yanes JM, Shrader P, Pencina MJ, Fox CS, Manning AK, Grant RW, Dupuis J, Florez JC, D'Agostino RB Sr, Cupples LA, Meigs JB", "reference": { "type": "PubMed", "id": "20889853", "url": "https://pubmed.ncbi.nlm.nih.gov/20889853" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9P242-1", "protein_name": "Neuronal tyrosine-phosphorylated phosphoinositide-3-kinase adapter 2", "gene_name": "NYAP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6FIF0-1", "protein_name": "AN1-type zinc finger protein 6", "gene_name": "ZFAND6", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9P242", "url": "https://www.uniprot.org/uniprotkb/Q9P242" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.20889853", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "A SMAD ubiquitin ligase targets the BMP pathway and affects embryonic pattern formation.", "journal": "Nature", "date": "1999", "authors": "Zhu H, Kavsak P, Abdollah S, Wrana JL, Thomsen GH", "reference": { "type": "PubMed", "id": "10458166", "url": "https://pubmed.ncbi.nlm.nih.gov/10458166" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q12841-1", "protein_name": "Follistatin-related protein 1", "gene_name": "FSTL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15198-1", "protein_name": "SMAD family member 9", "gene_name": "SMAD9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13485-1", "protein_name": "SMAD family member 4", "gene_name": "SMAD4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P03971-1", "protein_name": "Anti-Muellerian hormone", "gene_name": "AMH", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43541-1", "protein_name": "SMAD family member 6", "gene_name": "SMAD6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9CUN6-1", "protein_name": "E3 ubiquitin-protein ligase SMURF1", "gene_name": "Smurf1", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "Q99717-1", "protein_name": "SMAD family member 5", "gene_name": "SMAD5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61077-1", "protein_name": "Ubiquitin-conjugating enzyme E2 D3", "gene_name": "UBE2D3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51668-1", "protein_name": "Ubiquitin-conjugating enzyme E2 D1", "gene_name": "UBE2D1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95393-1", "protein_name": "Bone morphogenetic protein 10", "gene_name": "BMP10", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95813-1", "protein_name": "Cerberus", "gene_name": "CER1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BU40-6", "protein_name": "Chordin-like protein 1", "gene_name": "CHRDL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05111-1", "protein_name": "Inhibin alpha chain", "gene_name": "INHA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q7Z3T8-1", "protein_name": "Zinc finger FYVE domain-containing protein 16", "gene_name": "ZFYVE16", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15105-1", "protein_name": "SMAD family member 7", "gene_name": "SMAD7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P37023-1", "protein_name": "Activin receptor type-1-like", "gene_name": "ACVRL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16671-1", "protein_name": "Anti-Muellerian hormone type-2 receptor", "gene_name": "AMHR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15797-1", "protein_name": "SMAD family member 1", "gene_name": "SMAD1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HCE7-1", "protein_name": "E3 ubiquitin-protein ligase SMURF1", "gene_name": "SMURF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HAU4-1", "protein_name": "E3 ubiquitin-protein ligase SMURF2", "gene_name": "SMURF2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UK05-1", "protein_name": "Growth/differentiation factor 2", "gene_name": "GDF2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13705-1", "protein_name": "Activin receptor type-2B", "gene_name": "ACVR2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00238-1", "protein_name": "Bone morphogenetic protein receptor type-1B", "gene_name": "BMPR1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P12643-1", "protein_name": "Bone morphogenetic protein 2", "gene_name": "BMP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P36894-1", "protein_name": "Bone morphogenetic protein receptor type-1A", "gene_name": "BMPR1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13253-1", "protein_name": "Noggin", "gene_name": "NOG", "tax_name": "Human" }, { "uniprot_canonical_ac": "P12755-1", "protein_name": "Ski oncogene", "gene_name": "SKI", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27037-1", "protein_name": "Activin receptor type-2A", "gene_name": "ACVR2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13873-1", "protein_name": "Bone morphogenetic protein receptor type-2", "gene_name": "BMPR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q03167-1", "protein_name": "Transforming growth factor beta receptor type 3", "gene_name": "TGFBR3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H772-1", "protein_name": "Gremlin-2", "gene_name": "GREM2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P08476-1", "protein_name": "Inhibin beta A chain", "gene_name": "INHBA", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q12841", "url": "https://www.uniprot.org/uniprotkb/Q12841" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.10458166", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 32 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "SMAD destruction turns off signalling.", "journal": "Nature cell biology", "date": "1999", "authors": "Heldin CH, ten Dijke P", "reference": { "type": "PubMed", "id": "10587654", "url": "https://pubmed.ncbi.nlm.nih.gov/10587654" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q12841-1", "protein_name": "Follistatin-related protein 1", "gene_name": "FSTL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y618-1", "protein_name": "Nuclear receptor corepressor 2", "gene_name": "NCOR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15198-1", "protein_name": "SMAD family member 9", "gene_name": "SMAD9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13485-1", "protein_name": "SMAD family member 4", "gene_name": "SMAD4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15796-1", "protein_name": "SMAD family member 2", "gene_name": "SMAD2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P28482-1", "protein_name": "Mitogen-activated protein kinase 1", "gene_name": "MAPK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35813-1", "protein_name": "Protein phosphatase 1A", "gene_name": "PPM1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13547-1", "protein_name": "Histone deacetylase 1", "gene_name": "HDAC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P03971-1", "protein_name": "Anti-Muellerian hormone", "gene_name": "AMH", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43541-1", "protein_name": "SMAD family member 6", "gene_name": "SMAD6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UPN9-1", "protein_name": "E3 ubiquitin-protein ligase TRIM33", "gene_name": "TRIM33", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15583-1", "protein_name": "Homeobox protein TGIF1", "gene_name": "TGIF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99717-1", "protein_name": "SMAD family member 5", "gene_name": "SMAD5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61077-1", "protein_name": "Ubiquitin-conjugating enzyme E2 D3", "gene_name": "UBE2D3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51668-1", "protein_name": "Ubiquitin-conjugating enzyme E2 D1", "gene_name": "UBE2D1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95393-1", "protein_name": "Bone morphogenetic protein 10", "gene_name": "BMP10", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UN42-1", "protein_name": "Protein ATP1B4", "gene_name": "ATP1B4", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95813-1", "protein_name": "Cerberus", "gene_name": "CER1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BU40-6", "protein_name": "Chordin-like protein 1", "gene_name": "CHRDL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05111-1", "protein_name": "Inhibin alpha chain", "gene_name": "INHA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q7Z3T8-1", "protein_name": "Zinc finger FYVE domain-containing protein 16", "gene_name": "ZFYVE16", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15105-1", "protein_name": "SMAD family member 7", "gene_name": "SMAD7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P37023-1", "protein_name": "Activin receptor type-1-like", "gene_name": "ACVRL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P09874-1", "protein_name": "Poly [ADP-ribose] polymerase 1", "gene_name": "PARP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16671-1", "protein_name": "Anti-Muellerian hormone type-2 receptor", "gene_name": "AMHR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P84022-1", "protein_name": "SMAD family member 3", "gene_name": "SMAD3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P12757-1", "protein_name": "Ski-like protein", "gene_name": "SKIL", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15797-1", "protein_name": "SMAD family member 1", "gene_name": "SMAD1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HCE7-1", "protein_name": "E3 ubiquitin-protein ligase SMURF1", "gene_name": "SMURF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HAU4-1", "protein_name": "E3 ubiquitin-protein ligase SMURF2", "gene_name": "SMURF2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UK05-1", "protein_name": "Growth/differentiation factor 2", "gene_name": "GDF2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13705-1", "protein_name": "Activin receptor type-2B", "gene_name": "ACVR2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00238-1", "protein_name": "Bone morphogenetic protein receptor type-1B", "gene_name": "BMPR1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62979-1", "protein_name": "Ubiquitin-ribosomal protein eS31 fusion protein", "gene_name": "RPS27A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P12643-1", "protein_name": "Bone morphogenetic protein 2", "gene_name": "BMP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P36894-1", "protein_name": "Bone morphogenetic protein receptor type-1A", "gene_name": "BMPR1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13253-1", "protein_name": "Noggin", "gene_name": "NOG", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6ZNA4-1", "protein_name": "E3 ubiquitin-protein ligase Arkadia", "gene_name": "RNF111", "tax_name": "Human" }, { "uniprot_canonical_ac": "P12755-1", "protein_name": "Ski oncogene", "gene_name": "SKI", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q93008-1", "protein_name": "Ubiquitin carboxyl-terminal hydrolase 9X", "gene_name": "USP9X", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27037-1", "protein_name": "Activin receptor type-2A", "gene_name": "ACVR2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13873-1", "protein_name": "Bone morphogenetic protein receptor type-2", "gene_name": "BMPR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG47-1", "protein_name": "Polyubiquitin-B", "gene_name": "UBB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96PU5-1", "protein_name": "E3 ubiquitin-protein ligase NEDD4-like", "gene_name": "NEDD4L", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27361-1", "protein_name": "Mitogen-activated protein kinase 3", "gene_name": "MAPK3", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75376-1", "protein_name": "Nuclear receptor corepressor 1", "gene_name": "NCOR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13573-1", "protein_name": "SNW domain-containing protein 1", "gene_name": "SNW1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62987-1", "protein_name": "Ubiquitin-ribosomal protein eL40 fusion protein", "gene_name": "UBA52", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q03167-1", "protein_name": "Transforming growth factor beta receptor type 3", "gene_name": "TGFBR3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H772-1", "protein_name": "Gremlin-2", "gene_name": "GREM2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P08476-1", "protein_name": "Inhibin beta A chain", "gene_name": "INHBA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9GZN2-1", "protein_name": "Homeobox protein TGIF2", "gene_name": "TGIF2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG48-1", "protein_name": "Polyubiquitin-C", "gene_name": "UBC", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9GZV5-1", "protein_name": "WW domain-containing transcription regulator protein 1", "gene_name": "WWTR1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q12841", "url": "https://www.uniprot.org/uniprotkb/Q12841" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.10587654", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 54 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Bone morphogenetic protein receptor complexes on the surface of live cells: a new oligomerization mode for serine/threonine kinase receptors.", "journal": "Molecular biology of the cell", "date": "2000", "authors": "Gilboa L, Nohe A, Geissendorfer T, Sebald W, Henis YI, Knaus P", "reference": { "type": "PubMed", "id": "10712517", "url": "https://pubmed.ncbi.nlm.nih.gov/10712517" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q12841-1", "protein_name": "Follistatin-related protein 1", "gene_name": "FSTL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15198-1", "protein_name": "SMAD family member 9", "gene_name": "SMAD9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13485-1", "protein_name": "SMAD family member 4", "gene_name": "SMAD4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P03971-1", "protein_name": "Anti-Muellerian hormone", "gene_name": "AMH", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43541-1", "protein_name": "SMAD family member 6", "gene_name": "SMAD6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99717-1", "protein_name": "SMAD family member 5", "gene_name": "SMAD5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61077-1", "protein_name": "Ubiquitin-conjugating enzyme E2 D3", "gene_name": "UBE2D3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51668-1", "protein_name": "Ubiquitin-conjugating enzyme E2 D1", "gene_name": "UBE2D1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95393-1", "protein_name": "Bone morphogenetic protein 10", "gene_name": "BMP10", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95813-1", "protein_name": "Cerberus", "gene_name": "CER1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BU40-6", "protein_name": "Chordin-like protein 1", "gene_name": "CHRDL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05111-1", "protein_name": "Inhibin alpha chain", "gene_name": "INHA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q7Z3T8-1", "protein_name": "Zinc finger FYVE domain-containing protein 16", "gene_name": "ZFYVE16", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15105-1", "protein_name": "SMAD family member 7", "gene_name": "SMAD7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P37023-1", "protein_name": "Activin receptor type-1-like", "gene_name": "ACVRL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16671-1", "protein_name": "Anti-Muellerian hormone type-2 receptor", "gene_name": "AMHR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15797-1", "protein_name": "SMAD family member 1", "gene_name": "SMAD1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HCE7-1", "protein_name": "E3 ubiquitin-protein ligase SMURF1", "gene_name": "SMURF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HAU4-1", "protein_name": "E3 ubiquitin-protein ligase SMURF2", "gene_name": "SMURF2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UK05-1", "protein_name": "Growth/differentiation factor 2", "gene_name": "GDF2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13705-1", "protein_name": "Activin receptor type-2B", "gene_name": "ACVR2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00238-1", "protein_name": "Bone morphogenetic protein receptor type-1B", "gene_name": "BMPR1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P12643-1", "protein_name": "Bone morphogenetic protein 2", "gene_name": "BMP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P36894-1", "protein_name": "Bone morphogenetic protein receptor type-1A", "gene_name": "BMPR1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13253-1", "protein_name": "Noggin", "gene_name": "NOG", "tax_name": "Human" }, { "uniprot_canonical_ac": "P12755-1", "protein_name": "Ski oncogene", "gene_name": "SKI", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27037-1", "protein_name": "Activin receptor type-2A", "gene_name": "ACVR2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13873-1", "protein_name": "Bone morphogenetic protein receptor type-2", "gene_name": "BMPR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q03167-1", "protein_name": "Transforming growth factor beta receptor type 3", "gene_name": "TGFBR3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H772-1", "protein_name": "Gremlin-2", "gene_name": "GREM2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P08476-1", "protein_name": "Inhibin beta A chain", "gene_name": "INHBA", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q12841", "url": "https://www.uniprot.org/uniprotkb/Q12841" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.10712517", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 31 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Smurf2 is a ubiquitin E3 ligase mediating proteasome-dependent degradation of Smad2 in transforming growth factor-beta signaling.", "journal": "The Journal of biological chemistry", "date": "2000", "authors": "Lin X, Liang M, Feng XH", "reference": { "type": "PubMed", "id": "11016919", "url": "https://pubmed.ncbi.nlm.nih.gov/11016919" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q12841-1", "protein_name": "Follistatin-related protein 1", "gene_name": "FSTL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15198-1", "protein_name": "SMAD family member 9", "gene_name": "SMAD9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13485-1", "protein_name": "SMAD family member 4", "gene_name": "SMAD4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P03971-1", "protein_name": "Anti-Muellerian hormone", "gene_name": "AMH", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43541-1", "protein_name": "SMAD family member 6", "gene_name": "SMAD6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99717-1", "protein_name": "SMAD family member 5", "gene_name": "SMAD5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61077-1", "protein_name": "Ubiquitin-conjugating enzyme E2 D3", "gene_name": "UBE2D3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51668-1", "protein_name": "Ubiquitin-conjugating enzyme E2 D1", "gene_name": "UBE2D1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95393-1", "protein_name": "Bone morphogenetic protein 10", "gene_name": "BMP10", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95813-1", "protein_name": "Cerberus", "gene_name": "CER1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BU40-6", "protein_name": "Chordin-like protein 1", "gene_name": "CHRDL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05111-1", "protein_name": "Inhibin alpha chain", "gene_name": "INHA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q7Z3T8-1", "protein_name": "Zinc finger FYVE domain-containing protein 16", "gene_name": "ZFYVE16", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15105-1", "protein_name": "SMAD family member 7", "gene_name": "SMAD7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P37023-1", "protein_name": "Activin receptor type-1-like", "gene_name": "ACVRL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16671-1", "protein_name": "Anti-Muellerian hormone type-2 receptor", "gene_name": "AMHR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15797-1", "protein_name": "SMAD family member 1", "gene_name": "SMAD1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HCE7-1", "protein_name": "E3 ubiquitin-protein ligase SMURF1", "gene_name": "SMURF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HAU4-1", "protein_name": "E3 ubiquitin-protein ligase SMURF2", "gene_name": "SMURF2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UK05-1", "protein_name": "Growth/differentiation factor 2", "gene_name": "GDF2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13705-1", "protein_name": "Activin receptor type-2B", "gene_name": "ACVR2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00238-1", "protein_name": "Bone morphogenetic protein receptor type-1B", "gene_name": "BMPR1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P12643-1", "protein_name": "Bone morphogenetic protein 2", "gene_name": "BMP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P36894-1", "protein_name": "Bone morphogenetic protein receptor type-1A", "gene_name": "BMPR1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13253-1", "protein_name": "Noggin", "gene_name": "NOG", "tax_name": "Human" }, { "uniprot_canonical_ac": "P12755-1", "protein_name": "Ski oncogene", "gene_name": "SKI", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27037-1", "protein_name": "Activin receptor type-2A", "gene_name": "ACVR2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13873-1", "protein_name": "Bone morphogenetic protein receptor type-2", "gene_name": "BMPR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q03167-1", "protein_name": "Transforming growth factor beta receptor type 3", "gene_name": "TGFBR3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H772-1", "protein_name": "Gremlin-2", "gene_name": "GREM2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P08476-1", "protein_name": "Inhibin beta A chain", "gene_name": "INHBA", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q12841", "url": "https://www.uniprot.org/uniprotkb/Q12841" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 251, "end_pos": 284, "sequence_org": "PDLPEGYEQRTTQQGQVYFLHTQTGVSTWHDPRV", "sequence_mut": "", "comment": "Abolishes interaction with SMAD2 and SMAD7.", "evidence": [ { "database": "UniProtKB", "id": "Q9HAU4", "url": "https://www.uniprot.org/uniprotkb/Q9HAU4" }, { "database": "PubMed", "id": "11163210", "url": "https://pubmed.ncbi.nlm.nih.gov/11163210" }, { "database": "PubMed", "id": "11016919", "url": "https://pubmed.ncbi.nlm.nih.gov/11016919" } ], "uniprot_canonical_ac": "Q9HAU4-1" }, { "start_pos": 716, "end_pos": 716, "sequence_org": "C", "sequence_mut": "A", "comment": "Loss of catalytic activity. Increases SMAD7-bound TGF-beta receptors in membrane rafts. Decreases interaction with TTC3. Decreased VP40 virus-like particle budding.", "evidence": [ { "database": "UniProtKB", "id": "Q9HAU4", "url": "https://www.uniprot.org/uniprotkb/Q9HAU4" }, { "database": "PubMed", "id": "12717440", "url": "https://pubmed.ncbi.nlm.nih.gov/12717440" }, { "database": "PubMed", "id": "11158580", "url": "https://pubmed.ncbi.nlm.nih.gov/11158580" }, { "database": "PubMed", "id": "33673144", "url": "https://pubmed.ncbi.nlm.nih.gov/33673144" }, { "database": "PubMed", "id": "30696809", "url": "https://pubmed.ncbi.nlm.nih.gov/30696809" }, { "database": "PubMed", "id": "11016919", "url": "https://pubmed.ncbi.nlm.nih.gov/11016919" }, { "database": "PubMed", "id": "38016474", "url": "https://pubmed.ncbi.nlm.nih.gov/38016474" } ], "uniprot_canonical_ac": "Q9HAU4-1" }, { "start_pos": 716, "end_pos": 716, "sequence_org": "C", "sequence_mut": "G", "comment": "Loss of activity. Loss of ability to ubiquitinate SMAD1 and SMAD2 and no down-regulation of SMAD1 and SMAD2 protein levels.", "evidence": [ { "database": "UniProtKB", "id": "Q9HAU4", "url": "https://www.uniprot.org/uniprotkb/Q9HAU4" }, { "database": "PubMed", "id": "12717440", "url": "https://pubmed.ncbi.nlm.nih.gov/12717440" }, { "database": "PubMed", "id": "11158580", "url": "https://pubmed.ncbi.nlm.nih.gov/11158580" }, { "database": "PubMed", "id": "11016919", "url": "https://pubmed.ncbi.nlm.nih.gov/11016919" } ], "uniprot_canonical_ac": "Q9HAU4-1" } ], "record_id": "pubmed.11016919", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 31 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Ski represses bone morphogenic protein signaling in Xenopus and mammalian cells.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2000", "authors": "Wang W, Mariani FV, Harland RM, Luo K", "reference": { "type": "PubMed", "id": "11121043", "url": "https://pubmed.ncbi.nlm.nih.gov/11121043" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q12841-1", "protein_name": "Follistatin-related protein 1", "gene_name": "FSTL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15198-1", "protein_name": "SMAD family member 9", "gene_name": "SMAD9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13485-1", "protein_name": "SMAD family member 4", "gene_name": "SMAD4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P03971-1", "protein_name": "Anti-Muellerian hormone", "gene_name": "AMH", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43541-1", "protein_name": "SMAD family member 6", "gene_name": "SMAD6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99717-1", "protein_name": "SMAD family member 5", "gene_name": "SMAD5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61077-1", "protein_name": "Ubiquitin-conjugating enzyme E2 D3", "gene_name": "UBE2D3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51668-1", "protein_name": "Ubiquitin-conjugating enzyme E2 D1", "gene_name": "UBE2D1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95393-1", "protein_name": "Bone morphogenetic protein 10", "gene_name": "BMP10", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95813-1", "protein_name": "Cerberus", "gene_name": "CER1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BU40-6", "protein_name": "Chordin-like protein 1", "gene_name": "CHRDL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05111-1", "protein_name": "Inhibin alpha chain", "gene_name": "INHA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q7Z3T8-1", "protein_name": "Zinc finger FYVE domain-containing protein 16", "gene_name": "ZFYVE16", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15105-1", "protein_name": "SMAD family member 7", "gene_name": "SMAD7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P37023-1", "protein_name": "Activin receptor type-1-like", "gene_name": "ACVRL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16671-1", "protein_name": "Anti-Muellerian hormone type-2 receptor", "gene_name": "AMHR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15797-1", "protein_name": "SMAD family member 1", "gene_name": "SMAD1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HCE7-1", "protein_name": "E3 ubiquitin-protein ligase SMURF1", "gene_name": "SMURF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HAU4-1", "protein_name": "E3 ubiquitin-protein ligase SMURF2", "gene_name": "SMURF2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UK05-1", "protein_name": "Growth/differentiation factor 2", "gene_name": "GDF2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13705-1", "protein_name": "Activin receptor type-2B", "gene_name": "ACVR2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00238-1", "protein_name": "Bone morphogenetic protein receptor type-1B", "gene_name": "BMPR1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P12643-1", "protein_name": "Bone morphogenetic protein 2", "gene_name": "BMP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P36894-1", "protein_name": "Bone morphogenetic protein receptor type-1A", "gene_name": "BMPR1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13253-1", "protein_name": "Noggin", "gene_name": "NOG", "tax_name": "Human" }, { "uniprot_canonical_ac": "P12755-1", "protein_name": "Ski oncogene", "gene_name": "SKI", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27037-1", "protein_name": "Activin receptor type-2A", "gene_name": "ACVR2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13873-1", "protein_name": "Bone morphogenetic protein receptor type-2", "gene_name": "BMPR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q03167-1", "protein_name": "Transforming growth factor beta receptor type 3", "gene_name": "TGFBR3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H772-1", "protein_name": "Gremlin-2", "gene_name": "GREM2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P08476-1", "protein_name": "Inhibin beta A chain", "gene_name": "INHBA", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q12841", "url": "https://www.uniprot.org/uniprotkb/Q12841" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.11121043", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 31 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Regulation of Smad degradation and activity by Smurf2, an E3 ubiquitin ligase.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2001", "authors": "Zhang Y, Chang C, Gehling DJ, Hemmati-Brivanlou A, Derynck R", "reference": { "type": "PubMed", "id": "11158580", "url": "https://pubmed.ncbi.nlm.nih.gov/11158580" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q12841-1", "protein_name": "Follistatin-related protein 1", "gene_name": "FSTL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62136-1", "protein_name": "Serine/threonine-protein phosphatase PP1-alpha catalytic subunit", "gene_name": "PPP1CA", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15198-1", "protein_name": "SMAD family member 9", "gene_name": "SMAD9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y5K5-1", "protein_name": "Ubiquitin carboxyl-terminal hydrolase isozyme L5", "gene_name": "UCHL5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13485-1", "protein_name": "SMAD family member 4", "gene_name": "SMAD4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15796-1", "protein_name": "SMAD family member 2", "gene_name": "SMAD2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NYA4-1", "protein_name": "Phosphatidylinositol-3,5-bisphosphate 3-phosphatase MTMR4", "gene_name": "MTMR4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P03971-1", "protein_name": "Anti-Muellerian hormone", "gene_name": "AMH", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43541-1", "protein_name": "SMAD family member 6", "gene_name": "SMAD6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99717-1", "protein_name": "SMAD family member 5", "gene_name": "SMAD5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61077-1", "protein_name": "Ubiquitin-conjugating enzyme E2 D3", "gene_name": "UBE2D3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51668-1", "protein_name": "Ubiquitin-conjugating enzyme E2 D1", "gene_name": "UBE2D1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P36873-1", "protein_name": "Serine/threonine-protein phosphatase PP1-gamma catalytic subunit", "gene_name": "PPP1CC", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13145-1", "protein_name": "BMP and activin membrane-bound inhibitor homolog", "gene_name": "BAMBI", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95393-1", "protein_name": "Bone morphogenetic protein 10", "gene_name": "BMP10", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95813-1", "protein_name": "Cerberus", "gene_name": "CER1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75807-1", "protein_name": "Protein phosphatase 1 regulatory subunit 15A", "gene_name": "PPP1R15A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BU40-6", "protein_name": "Chordin-like protein 1", "gene_name": "CHRDL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05111-1", "protein_name": "Inhibin alpha chain", "gene_name": "INHA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q7Z3T8-1", "protein_name": "Zinc finger FYVE domain-containing protein 16", "gene_name": "ZFYVE16", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14980-1", "protein_name": "Exportin-1", "gene_name": "XPO1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P36897-1", "protein_name": "TGF-beta receptor type-1", "gene_name": "TGFBR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15105-1", "protein_name": "SMAD family member 7", "gene_name": "SMAD7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P37023-1", "protein_name": "Activin receptor type-1-like", "gene_name": "ACVRL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62140-1", "protein_name": "Serine/threonine-protein phosphatase PP1-beta catalytic subunit", "gene_name": "PPP1CB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16671-1", "protein_name": "Anti-Muellerian hormone type-2 receptor", "gene_name": "AMHR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P84022-1", "protein_name": "SMAD family member 3", "gene_name": "SMAD3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15797-1", "protein_name": "SMAD family member 1", "gene_name": "SMAD1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HCE7-1", "protein_name": "E3 ubiquitin-protein ligase SMURF1", "gene_name": "SMURF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HAU4-1", "protein_name": "E3 ubiquitin-protein ligase SMURF2", "gene_name": "SMURF2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UK05-1", "protein_name": "Growth/differentiation factor 2", "gene_name": "GDF2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13705-1", "protein_name": "Activin receptor type-2B", "gene_name": "ACVR2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00238-1", "protein_name": "Bone morphogenetic protein receptor type-1B", "gene_name": "BMPR1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62979-1", "protein_name": "Ubiquitin-ribosomal protein eS31 fusion protein", "gene_name": "RPS27A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P12643-1", "protein_name": "Bone morphogenetic protein 2", "gene_name": "BMP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P36894-1", "protein_name": "Bone morphogenetic protein receptor type-1A", "gene_name": "BMPR1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13253-1", "protein_name": "Noggin", "gene_name": "NOG", "tax_name": "Human" }, { "uniprot_canonical_ac": "P37173-1", "protein_name": "TGF-beta receptor type-2", "gene_name": "TGFBR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P12755-1", "protein_name": "Ski oncogene", "gene_name": "SKI", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q969W9-1", "protein_name": "Protein TMEPAI", "gene_name": "PMEPA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27037-1", "protein_name": "Activin receptor type-2A", "gene_name": "ACVR2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13873-1", "protein_name": "Bone morphogenetic protein receptor type-2", "gene_name": "BMPR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y4E8-1", "protein_name": "Ubiquitin carboxyl-terminal hydrolase 15", "gene_name": "USP15", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG47-1", "protein_name": "Polyubiquitin-B", "gene_name": "UBB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96PU5-1", "protein_name": "E3 ubiquitin-protein ligase NEDD4-like", "gene_name": "NEDD4L", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62987-1", "protein_name": "Ubiquitin-ribosomal protein eL40 fusion protein", "gene_name": "UBA52", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q03167-1", "protein_name": "Transforming growth factor beta receptor type 3", "gene_name": "TGFBR3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H772-1", "protein_name": "Gremlin-2", "gene_name": "GREM2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P08476-1", "protein_name": "Inhibin beta A chain", "gene_name": "INHBA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y3F4-1", "protein_name": "Serine-threonine kinase receptor-associated protein", "gene_name": "STRAP", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01137-1", "protein_name": "Transforming growth factor beta-1 proprotein", "gene_name": "TGFB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG48-1", "protein_name": "Polyubiquitin-C", "gene_name": "UBC", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UNE7-1", "protein_name": "E3 ubiquitin-protein ligase CHIP", "gene_name": "STUB1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q12841", "url": "https://www.uniprot.org/uniprotkb/Q12841" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 716, "end_pos": 716, "sequence_org": "C", "sequence_mut": "A", "comment": "Loss of catalytic activity. Increases SMAD7-bound TGF-beta receptors in membrane rafts. Decreases interaction with TTC3. Decreased VP40 virus-like particle budding.", "evidence": [ { "database": "UniProtKB", "id": "Q9HAU4", "url": "https://www.uniprot.org/uniprotkb/Q9HAU4" }, { "database": "PubMed", "id": "12717440", "url": "https://pubmed.ncbi.nlm.nih.gov/12717440" }, { "database": "PubMed", "id": "11158580", "url": "https://pubmed.ncbi.nlm.nih.gov/11158580" }, { "database": "PubMed", "id": "33673144", "url": "https://pubmed.ncbi.nlm.nih.gov/33673144" }, { "database": "PubMed", "id": "30696809", "url": "https://pubmed.ncbi.nlm.nih.gov/30696809" }, { "database": "PubMed", "id": "11016919", "url": "https://pubmed.ncbi.nlm.nih.gov/11016919" }, { "database": "PubMed", "id": "38016474", "url": "https://pubmed.ncbi.nlm.nih.gov/38016474" } ], "uniprot_canonical_ac": "Q9HAU4-1" }, { "start_pos": 716, "end_pos": 716, "sequence_org": "C", "sequence_mut": "G", "comment": "Loss of activity. Loss of ability to ubiquitinate SMAD1 and SMAD2 and no down-regulation of SMAD1 and SMAD2 protein levels.", "evidence": [ { "database": "UniProtKB", "id": "Q9HAU4", "url": "https://www.uniprot.org/uniprotkb/Q9HAU4" }, { "database": "PubMed", "id": "12717440", "url": "https://pubmed.ncbi.nlm.nih.gov/12717440" }, { "database": "PubMed", "id": "11158580", "url": "https://pubmed.ncbi.nlm.nih.gov/11158580" }, { "database": "PubMed", "id": "11016919", "url": "https://pubmed.ncbi.nlm.nih.gov/11016919" } ], "uniprot_canonical_ac": "Q9HAU4-1" } ], "record_id": "pubmed.11158580", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 53 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Smurf1 interacts with transforming growth factor-beta type I receptor through Smad7 and induces receptor degradation.", "journal": "The Journal of biological chemistry", "date": "2001", "authors": "Ebisawa T, Fukuchi M, Murakami G, Chiba T, Tanaka K, Imamura T, Miyazono K", "reference": { "type": "PubMed", "id": "11278251", "url": "https://pubmed.ncbi.nlm.nih.gov/11278251" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q12841-1", "protein_name": "Follistatin-related protein 1", "gene_name": "FSTL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62136-1", "protein_name": "Serine/threonine-protein phosphatase PP1-alpha catalytic subunit", "gene_name": "PPP1CA", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15198-1", "protein_name": "SMAD family member 9", "gene_name": "SMAD9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y5K5-1", "protein_name": "Ubiquitin carboxyl-terminal hydrolase isozyme L5", "gene_name": "UCHL5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13485-1", "protein_name": "SMAD family member 4", "gene_name": "SMAD4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15796-1", "protein_name": "SMAD family member 2", "gene_name": "SMAD2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NYA4-1", "protein_name": "Phosphatidylinositol-3,5-bisphosphate 3-phosphatase MTMR4", "gene_name": "MTMR4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P03971-1", "protein_name": "Anti-Muellerian hormone", "gene_name": "AMH", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43541-1", "protein_name": "SMAD family member 6", "gene_name": "SMAD6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99717-1", "protein_name": "SMAD family member 5", "gene_name": "SMAD5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61077-1", "protein_name": "Ubiquitin-conjugating enzyme E2 D3", "gene_name": "UBE2D3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51668-1", "protein_name": "Ubiquitin-conjugating enzyme E2 D1", "gene_name": "UBE2D1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P36873-1", "protein_name": "Serine/threonine-protein phosphatase PP1-gamma catalytic subunit", "gene_name": "PPP1CC", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13145-1", "protein_name": "BMP and activin membrane-bound inhibitor homolog", "gene_name": "BAMBI", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95393-1", "protein_name": "Bone morphogenetic protein 10", "gene_name": "BMP10", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95813-1", "protein_name": "Cerberus", "gene_name": "CER1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75807-1", "protein_name": "Protein phosphatase 1 regulatory subunit 15A", "gene_name": "PPP1R15A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BU40-6", "protein_name": "Chordin-like protein 1", "gene_name": "CHRDL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05111-1", "protein_name": "Inhibin alpha chain", "gene_name": "INHA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q7Z3T8-1", "protein_name": "Zinc finger FYVE domain-containing protein 16", "gene_name": "ZFYVE16", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14980-1", "protein_name": "Exportin-1", "gene_name": "XPO1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P36897-1", "protein_name": "TGF-beta receptor type-1", "gene_name": "TGFBR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15105-1", "protein_name": "SMAD family member 7", "gene_name": "SMAD7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P37023-1", "protein_name": "Activin receptor type-1-like", "gene_name": "ACVRL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62140-1", "protein_name": "Serine/threonine-protein phosphatase PP1-beta catalytic subunit", "gene_name": "PPP1CB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16671-1", "protein_name": "Anti-Muellerian hormone type-2 receptor", "gene_name": "AMHR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P84022-1", "protein_name": "SMAD family member 3", "gene_name": "SMAD3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15797-1", "protein_name": "SMAD family member 1", "gene_name": "SMAD1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HCE7-1", "protein_name": "E3 ubiquitin-protein ligase SMURF1", "gene_name": "SMURF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HAU4-1", "protein_name": "E3 ubiquitin-protein ligase SMURF2", "gene_name": "SMURF2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UK05-1", "protein_name": "Growth/differentiation factor 2", "gene_name": "GDF2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13705-1", "protein_name": "Activin receptor type-2B", "gene_name": "ACVR2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00238-1", "protein_name": "Bone morphogenetic protein receptor type-1B", "gene_name": "BMPR1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62979-1", "protein_name": "Ubiquitin-ribosomal protein eS31 fusion protein", "gene_name": "RPS27A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P12643-1", "protein_name": "Bone morphogenetic protein 2", "gene_name": "BMP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P36894-1", "protein_name": "Bone morphogenetic protein receptor type-1A", "gene_name": "BMPR1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13253-1", "protein_name": "Noggin", "gene_name": "NOG", "tax_name": "Human" }, { "uniprot_canonical_ac": "P37173-1", "protein_name": "TGF-beta receptor type-2", "gene_name": "TGFBR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P12755-1", "protein_name": "Ski oncogene", "gene_name": "SKI", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q969W9-1", "protein_name": "Protein TMEPAI", "gene_name": "PMEPA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27037-1", "protein_name": "Activin receptor type-2A", "gene_name": "ACVR2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13873-1", "protein_name": "Bone morphogenetic protein receptor type-2", "gene_name": "BMPR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y4E8-1", "protein_name": "Ubiquitin carboxyl-terminal hydrolase 15", "gene_name": "USP15", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG47-1", "protein_name": "Polyubiquitin-B", "gene_name": "UBB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96PU5-1", "protein_name": "E3 ubiquitin-protein ligase NEDD4-like", "gene_name": "NEDD4L", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62987-1", "protein_name": "Ubiquitin-ribosomal protein eL40 fusion protein", "gene_name": "UBA52", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q03167-1", "protein_name": "Transforming growth factor beta receptor type 3", "gene_name": "TGFBR3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H772-1", "protein_name": "Gremlin-2", "gene_name": "GREM2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P08476-1", "protein_name": "Inhibin beta A chain", "gene_name": "INHBA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y3F4-1", "protein_name": "Serine-threonine kinase receptor-associated protein", "gene_name": "STRAP", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01137-1", "protein_name": "Transforming growth factor beta-1 proprotein", "gene_name": "TGFB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG48-1", "protein_name": "Polyubiquitin-C", "gene_name": "UBC", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UNE7-1", "protein_name": "E3 ubiquitin-protein ligase CHIP", "gene_name": "STUB1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q12841", "url": "https://www.uniprot.org/uniprotkb/Q12841" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.11278251", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 53 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Nucleocytoplasmic shuttling of Smad1 conferred by its nuclear localization and nuclear export signals.", "journal": "The Journal of biological chemistry", "date": "2001", "authors": "Xiao Z, Watson N, Rodriguez C, Lodish HF", "reference": { "type": "PubMed", "id": "11509558", "url": "https://pubmed.ncbi.nlm.nih.gov/11509558" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q12841-1", "protein_name": "Follistatin-related protein 1", "gene_name": "FSTL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15198-1", "protein_name": "SMAD family member 9", "gene_name": "SMAD9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13485-1", "protein_name": "SMAD family member 4", "gene_name": "SMAD4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P03971-1", "protein_name": "Anti-Muellerian hormone", "gene_name": "AMH", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43541-1", "protein_name": "SMAD family member 6", "gene_name": "SMAD6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99717-1", "protein_name": "SMAD family member 5", "gene_name": "SMAD5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61077-1", "protein_name": "Ubiquitin-conjugating enzyme E2 D3", "gene_name": "UBE2D3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51668-1", "protein_name": "Ubiquitin-conjugating enzyme E2 D1", "gene_name": "UBE2D1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95393-1", "protein_name": "Bone morphogenetic protein 10", "gene_name": "BMP10", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95813-1", "protein_name": "Cerberus", "gene_name": "CER1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BU40-6", "protein_name": "Chordin-like protein 1", "gene_name": "CHRDL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05111-1", "protein_name": "Inhibin alpha chain", "gene_name": "INHA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q7Z3T8-1", "protein_name": "Zinc finger FYVE domain-containing protein 16", "gene_name": "ZFYVE16", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15105-1", "protein_name": "SMAD family member 7", "gene_name": "SMAD7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P37023-1", "protein_name": "Activin receptor type-1-like", "gene_name": "ACVRL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16671-1", "protein_name": "Anti-Muellerian hormone type-2 receptor", "gene_name": "AMHR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15797-1", "protein_name": "SMAD family member 1", "gene_name": "SMAD1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HCE7-1", "protein_name": "E3 ubiquitin-protein ligase SMURF1", "gene_name": "SMURF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HAU4-1", "protein_name": "E3 ubiquitin-protein ligase SMURF2", "gene_name": "SMURF2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UK05-1", "protein_name": "Growth/differentiation factor 2", "gene_name": "GDF2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13705-1", "protein_name": "Activin receptor type-2B", "gene_name": "ACVR2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00238-1", "protein_name": "Bone morphogenetic protein receptor type-1B", "gene_name": "BMPR1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P12643-1", "protein_name": "Bone morphogenetic protein 2", "gene_name": "BMP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P36894-1", "protein_name": "Bone morphogenetic protein receptor type-1A", "gene_name": "BMPR1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13253-1", "protein_name": "Noggin", "gene_name": "NOG", "tax_name": "Human" }, { "uniprot_canonical_ac": "P12755-1", "protein_name": "Ski oncogene", "gene_name": "SKI", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27037-1", "protein_name": "Activin receptor type-2A", "gene_name": "ACVR2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13873-1", "protein_name": "Bone morphogenetic protein receptor type-2", "gene_name": "BMPR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q03167-1", "protein_name": "Transforming growth factor beta receptor type 3", "gene_name": "TGFBR3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H772-1", "protein_name": "Gremlin-2", "gene_name": "GREM2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P08476-1", "protein_name": "Inhibin beta A chain", "gene_name": "INHBA", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q12841", "url": "https://www.uniprot.org/uniprotkb/Q12841" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.11509558", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 31 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Proteasomal degradation of Smad1 induced by bone morphogenetic proteins.", "journal": "The Journal of biological chemistry", "date": "2001", "authors": "Gruendler C, Lin Y, Farley J, Wang T", "reference": { "type": "PubMed", "id": "11571290", "url": "https://pubmed.ncbi.nlm.nih.gov/11571290" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q12841-1", "protein_name": "Follistatin-related protein 1", "gene_name": "FSTL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15198-1", "protein_name": "SMAD family member 9", "gene_name": "SMAD9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13485-1", "protein_name": "SMAD family member 4", "gene_name": "SMAD4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P03971-1", "protein_name": "Anti-Muellerian hormone", "gene_name": "AMH", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43541-1", "protein_name": "SMAD family member 6", "gene_name": "SMAD6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99717-1", "protein_name": "SMAD family member 5", "gene_name": "SMAD5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61077-1", "protein_name": "Ubiquitin-conjugating enzyme E2 D3", "gene_name": "UBE2D3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51668-1", "protein_name": "Ubiquitin-conjugating enzyme E2 D1", "gene_name": "UBE2D1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95393-1", "protein_name": "Bone morphogenetic protein 10", "gene_name": "BMP10", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95813-1", "protein_name": "Cerberus", "gene_name": "CER1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BU40-6", "protein_name": "Chordin-like protein 1", "gene_name": "CHRDL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P28070-1", "protein_name": "Proteasome subunit beta type-4", "gene_name": "PSMB4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05111-1", "protein_name": "Inhibin alpha chain", "gene_name": "INHA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q7Z3T8-1", "protein_name": "Zinc finger FYVE domain-containing protein 16", "gene_name": "ZFYVE16", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15105-1", "protein_name": "SMAD family member 7", "gene_name": "SMAD7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P37023-1", "protein_name": "Activin receptor type-1-like", "gene_name": "ACVRL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16671-1", "protein_name": "Anti-Muellerian hormone type-2 receptor", "gene_name": "AMHR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15797-1", "protein_name": "SMAD family member 1", "gene_name": "SMAD1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HCE7-1", "protein_name": "E3 ubiquitin-protein ligase SMURF1", "gene_name": "SMURF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HAU4-1", "protein_name": "E3 ubiquitin-protein ligase SMURF2", "gene_name": "SMURF2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UK05-1", "protein_name": "Growth/differentiation factor 2", "gene_name": "GDF2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13705-1", "protein_name": "Activin receptor type-2B", "gene_name": "ACVR2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00238-1", "protein_name": "Bone morphogenetic protein receptor type-1B", "gene_name": "BMPR1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P12643-1", "protein_name": "Bone morphogenetic protein 2", "gene_name": "BMP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P36894-1", "protein_name": "Bone morphogenetic protein receptor type-1A", "gene_name": "BMPR1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13253-1", "protein_name": "Noggin", "gene_name": "NOG", "tax_name": "Human" }, { "uniprot_canonical_ac": "P12755-1", "protein_name": "Ski oncogene", "gene_name": "SKI", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27037-1", "protein_name": "Activin receptor type-2A", "gene_name": "ACVR2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13873-1", "protein_name": "Bone morphogenetic protein receptor type-2", "gene_name": "BMPR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q03167-1", "protein_name": "Transforming growth factor beta receptor type 3", "gene_name": "TGFBR3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H772-1", "protein_name": "Gremlin-2", "gene_name": "GREM2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P08476-1", "protein_name": "Inhibin beta A chain", "gene_name": "INHBA", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q12841", "url": "https://www.uniprot.org/uniprotkb/Q12841" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.11571290", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 32 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The mode of bone morphogenetic protein (BMP) receptor oligomerization determines different BMP-2 signaling pathways.", "journal": "The Journal of biological chemistry", "date": "2002", "authors": "Nohe A, Hassel S, Ehrlich M, Neubauer F, Sebald W, Henis YI, Knaus P", "reference": { "type": "PubMed", "id": "11714695", "url": "https://pubmed.ncbi.nlm.nih.gov/11714695" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q12841-1", "protein_name": "Follistatin-related protein 1", "gene_name": "FSTL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15198-1", "protein_name": "SMAD family member 9", "gene_name": "SMAD9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13485-1", "protein_name": "SMAD family member 4", "gene_name": "SMAD4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P03971-1", "protein_name": "Anti-Muellerian hormone", "gene_name": "AMH", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43541-1", "protein_name": "SMAD family member 6", "gene_name": "SMAD6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99717-1", "protein_name": "SMAD family member 5", "gene_name": "SMAD5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61077-1", "protein_name": "Ubiquitin-conjugating enzyme E2 D3", "gene_name": "UBE2D3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51668-1", "protein_name": "Ubiquitin-conjugating enzyme E2 D1", "gene_name": "UBE2D1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95393-1", "protein_name": "Bone morphogenetic protein 10", "gene_name": "BMP10", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95813-1", "protein_name": "Cerberus", "gene_name": "CER1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BU40-6", "protein_name": "Chordin-like protein 1", "gene_name": "CHRDL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05111-1", "protein_name": "Inhibin alpha chain", "gene_name": "INHA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q7Z3T8-1", "protein_name": "Zinc finger FYVE domain-containing protein 16", "gene_name": "ZFYVE16", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15105-1", "protein_name": "SMAD family member 7", "gene_name": "SMAD7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P37023-1", "protein_name": "Activin receptor type-1-like", "gene_name": "ACVRL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16671-1", "protein_name": "Anti-Muellerian hormone type-2 receptor", "gene_name": "AMHR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15797-1", "protein_name": "SMAD family member 1", "gene_name": "SMAD1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HCE7-1", "protein_name": "E3 ubiquitin-protein ligase SMURF1", "gene_name": "SMURF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HAU4-1", "protein_name": "E3 ubiquitin-protein ligase SMURF2", "gene_name": "SMURF2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UK05-1", "protein_name": "Growth/differentiation factor 2", "gene_name": "GDF2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13705-1", "protein_name": "Activin receptor type-2B", "gene_name": "ACVR2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00238-1", "protein_name": "Bone morphogenetic protein receptor type-1B", "gene_name": "BMPR1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P12643-1", "protein_name": "Bone morphogenetic protein 2", "gene_name": "BMP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P36894-1", "protein_name": "Bone morphogenetic protein receptor type-1A", "gene_name": "BMPR1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13253-1", "protein_name": "Noggin", "gene_name": "NOG", "tax_name": "Human" }, { "uniprot_canonical_ac": "P12755-1", "protein_name": "Ski oncogene", "gene_name": "SKI", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27037-1", "protein_name": "Activin receptor type-2A", "gene_name": "ACVR2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13873-1", "protein_name": "Bone morphogenetic protein receptor type-2", "gene_name": "BMPR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q03167-1", "protein_name": "Transforming growth factor beta receptor type 3", "gene_name": "TGFBR3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H772-1", "protein_name": "Gremlin-2", "gene_name": "GREM2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P08476-1", "protein_name": "Inhibin beta A chain", "gene_name": "INHBA", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q12841", "url": "https://www.uniprot.org/uniprotkb/Q12841" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.11714695", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 31 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Structural basis of Smad1 activation by receptor kinase phosphorylation.", "journal": "Molecular cell", "date": "2001", "authors": "Qin BY, Chacko BM, Lam SS, de Caestecker MP, Correia JJ, Lin K", "reference": { "type": "PubMed", "id": "11779505", "url": "https://pubmed.ncbi.nlm.nih.gov/11779505" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q12841-1", "protein_name": "Follistatin-related protein 1", "gene_name": "FSTL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15198-1", "protein_name": "SMAD family member 9", "gene_name": "SMAD9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NER5-1", "protein_name": "Activin receptor type-1C", "gene_name": "ACVR1C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13485-1", "protein_name": "SMAD family member 4", "gene_name": "SMAD4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15796-1", "protein_name": "SMAD family member 2", "gene_name": "SMAD2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P28482-1", "protein_name": "Mitogen-activated protein kinase 1", "gene_name": "MAPK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14919-1", "protein_name": "Dr1-associated corepressor", "gene_name": "DRAP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P09958-1", "protein_name": "Furin", "gene_name": "FURIN", "tax_name": "Human" }, { "uniprot_canonical_ac": "P03971-1", "protein_name": "Anti-Muellerian hormone", "gene_name": "AMH", "tax_name": "Human" }, { "uniprot_canonical_ac": "P29122-1", "protein_name": "Proprotein convertase subtilisin/kexin type 6", "gene_name": "PCSK6", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43541-1", "protein_name": "SMAD family member 6", "gene_name": "SMAD6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG37-1", "protein_name": "Cryptic protein", "gene_name": "CFC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99717-1", "protein_name": "SMAD family member 5", "gene_name": "SMAD5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61077-1", "protein_name": "Ubiquitin-conjugating enzyme E2 D3", "gene_name": "UBE2D3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51668-1", "protein_name": "Ubiquitin-conjugating enzyme E2 D1", "gene_name": "UBE2D1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95393-1", "protein_name": "Bone morphogenetic protein 10", "gene_name": "BMP10", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95813-1", "protein_name": "Cerberus", "gene_name": "CER1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BU40-6", "protein_name": "Chordin-like protein 1", "gene_name": "CHRDL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75610-1", "protein_name": "Left-right determination factor 1", "gene_name": "LEFTY1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05111-1", "protein_name": "Inhibin alpha chain", "gene_name": "INHA", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00292-1", "protein_name": "Left-right determination factor 2", "gene_name": "LEFTY2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q7Z3T8-1", "protein_name": "Zinc finger FYVE domain-containing protein 16", "gene_name": "ZFYVE16", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43524-1", "protein_name": "Forkhead box protein O3", "gene_name": "FOXO3", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15105-1", "protein_name": "SMAD family member 7", "gene_name": "SMAD7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P37023-1", "protein_name": "Activin receptor type-1-like", "gene_name": "ACVRL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P36896-1", "protein_name": "Activin receptor type-1B", "gene_name": "ACVR1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16671-1", "protein_name": "Anti-Muellerian hormone type-2 receptor", "gene_name": "AMHR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P84022-1", "protein_name": "SMAD family member 3", "gene_name": "SMAD3", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75593-1", "protein_name": "Forkhead box protein H1", "gene_name": "FOXH1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15797-1", "protein_name": "SMAD family member 1", "gene_name": "SMAD1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HCE7-1", "protein_name": "E3 ubiquitin-protein ligase SMURF1", "gene_name": "SMURF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HAU4-1", "protein_name": "E3 ubiquitin-protein ligase SMURF2", "gene_name": "SMURF2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UK05-1", "protein_name": "Growth/differentiation factor 2", "gene_name": "GDF2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13705-1", "protein_name": "Activin receptor type-2B", "gene_name": "ACVR2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00238-1", "protein_name": "Bone morphogenetic protein receptor type-1B", "gene_name": "BMPR1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P12643-1", "protein_name": "Bone morphogenetic protein 2", "gene_name": "BMP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P36894-1", "protein_name": "Bone morphogenetic protein receptor type-1A", "gene_name": "BMPR1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13253-1", "protein_name": "Noggin", "gene_name": "NOG", "tax_name": "Human" }, { "uniprot_canonical_ac": "P12755-1", "protein_name": "Ski oncogene", "gene_name": "SKI", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96S42-1", "protein_name": "Nodal homolog", "gene_name": "NODAL", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27037-1", "protein_name": "Activin receptor type-2A", "gene_name": "ACVR2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13873-1", "protein_name": "Bone morphogenetic protein receptor type-2", "gene_name": "BMPR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27361-1", "protein_name": "Mitogen-activated protein kinase 3", "gene_name": "MAPK3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N907-1", "protein_name": "DAN domain family member 5", "gene_name": "DAND5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27539-1", "protein_name": "Embryonic growth/differentiation factor 1", "gene_name": "GDF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q03167-1", "protein_name": "Transforming growth factor beta receptor type 3", "gene_name": "TGFBR3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H772-1", "protein_name": "Gremlin-2", "gene_name": "GREM2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P08476-1", "protein_name": "Inhibin beta A chain", "gene_name": "INHBA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P13385-1", "protein_name": "Protein Cripto", "gene_name": "CRIPTO", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51864-1", "protein_name": "Protein CRIPTO3", "gene_name": "CRIPTO3", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q12841", "url": "https://www.uniprot.org/uniprotkb/Q12841" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 297, "end_pos": 297, "sequence_org": "D", "sequence_mut": "H", "comment": "Reduced trimerization.", "evidence": [ { "database": "UniProtKB", "id": "Q15797", "url": "https://www.uniprot.org/uniprotkb/Q15797" }, { "database": "PubMed", "id": "11779505", "url": "https://pubmed.ncbi.nlm.nih.gov/11779505" } ], "uniprot_canonical_ac": "Q15797-1" }, { "start_pos": 317, "end_pos": 317, "sequence_org": "V", "sequence_mut": "D", "comment": "Reduced trimerization.", "evidence": [ { "database": "UniProtKB", "id": "Q15797", "url": "https://www.uniprot.org/uniprotkb/Q15797" }, { "database": "PubMed", "id": "11779505", "url": "https://pubmed.ncbi.nlm.nih.gov/11779505" } ], "uniprot_canonical_ac": "Q15797-1" }, { "start_pos": 373, "end_pos": 373, "sequence_org": "K", "sequence_mut": "S", "comment": "Reduced trimerization.", "evidence": [ { "database": "UniProtKB", "id": "Q15797", "url": "https://www.uniprot.org/uniprotkb/Q15797" }, { "database": "PubMed", "id": "11779505", "url": "https://pubmed.ncbi.nlm.nih.gov/11779505" } ], "uniprot_canonical_ac": "Q15797-1" }, { "start_pos": 418, "end_pos": 418, "sequence_org": "K", "sequence_mut": "S", "comment": "Reduced trimerization.", "evidence": [ { "database": "UniProtKB", "id": "Q15797", "url": "https://www.uniprot.org/uniprotkb/Q15797" }, { "database": "PubMed", "id": "11779505", "url": "https://pubmed.ncbi.nlm.nih.gov/11779505" } ], "uniprot_canonical_ac": "Q15797-1" }, { "start_pos": 424, "end_pos": 424, "sequence_org": "Y", "sequence_mut": "F", "comment": "Reduced trimerization.", "evidence": [ { "database": "UniProtKB", "id": "Q15797", "url": "https://www.uniprot.org/uniprotkb/Q15797" }, { "database": "PubMed", "id": "11779505", "url": "https://pubmed.ncbi.nlm.nih.gov/11779505" } ], "uniprot_canonical_ac": "Q15797-1" }, { "start_pos": 426, "end_pos": 426, "sequence_org": "R", "sequence_mut": "S", "comment": "Reduced trimerization.", "evidence": [ { "database": "UniProtKB", "id": "Q15797", "url": "https://www.uniprot.org/uniprotkb/Q15797" }, { "database": "PubMed", "id": "11779505", "url": "https://pubmed.ncbi.nlm.nih.gov/11779505" } ], "uniprot_canonical_ac": "Q15797-1" }, { "start_pos": 448, "end_pos": 448, "sequence_org": "D", "sequence_mut": "H", "comment": "Reduced trimerization.", "evidence": [ { "database": "UniProtKB", "id": "Q15797", "url": "https://www.uniprot.org/uniprotkb/Q15797" }, { "database": "PubMed", "id": "11779505", "url": "https://pubmed.ncbi.nlm.nih.gov/11779505" } ], "uniprot_canonical_ac": "Q15797-1" } ], "phosphorylation": [ { "start_pos": 463, "end_pos": 463, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "Q15797", "url": "https://www.uniprot.org/uniprotkb/Q15797" }, { "database": "PubMed", "id": "11779505", "url": "https://pubmed.ncbi.nlm.nih.gov/11779505" }, { "database": "PubMed", "id": "9136927", "url": "https://pubmed.ncbi.nlm.nih.gov/9136927" }, { "database": "iPTMnet", "id": "Q15797", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q15797" }, { "database": "PubMed", "id": "19651622", "url": "https://pubmed.ncbi.nlm.nih.gov/19651622" }, { "database": "PRO", "id": "Q15797", "url": "https://proconsortium.org/cgi-bin/entry_pro?id=Q15797" }, { "database": "PubMed", "id": "12857866", "url": "https://pubmed.ncbi.nlm.nih.gov/12857866" }, { "database": "PubMed", "id": "28542453", "url": "https://pubmed.ncbi.nlm.nih.gov/28542453" }, { "database": "PubMed", "id": "30674353", "url": "https://pubmed.ncbi.nlm.nih.gov/30674353" }, { "database": "PubMed", "id": "30854241", "url": "https://pubmed.ncbi.nlm.nih.gov/30854241" } ], "site_lbl": "Ser463", "uniprot_canonical_ac": "Q15797-1" }, { "start_pos": 465, "end_pos": 465, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "Q15797", "url": "https://www.uniprot.org/uniprotkb/Q15797" }, { "database": "PubMed", "id": "9136927", "url": "https://pubmed.ncbi.nlm.nih.gov/9136927" }, { "database": "PubMed", "id": "11779505", "url": "https://pubmed.ncbi.nlm.nih.gov/11779505" }, { "database": "iPTMnet", "id": "Q15797", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q15797" }, { "database": "PubMed", "id": "19651622", "url": "https://pubmed.ncbi.nlm.nih.gov/19651622" }, { "database": "PRO", "id": "Q15797", "url": "https://proconsortium.org/cgi-bin/entry_pro?id=Q15797" }, { "database": "PubMed", "id": "12857866", "url": "https://pubmed.ncbi.nlm.nih.gov/12857866" }, { "database": "PubMed", "id": "28542453", "url": "https://pubmed.ncbi.nlm.nih.gov/28542453" }, { "database": "PubMed", "id": "30674353", "url": "https://pubmed.ncbi.nlm.nih.gov/30674353" }, { "database": "PubMed", "id": "30854241", "url": "https://pubmed.ncbi.nlm.nih.gov/30854241" } ], "site_lbl": "Ser465", "uniprot_canonical_ac": "Q15797-1" } ], "record_id": "pubmed.11779505", "abstract": "", "glycosylation": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 50 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Smurf1 regulates the inhibitory activity of Smad7 by targeting Smad7 to the plasma membrane.", "journal": "The Journal of biological chemistry", "date": "2002", "authors": "Suzuki C, Murakami G, Fukuchi M, Shimanuki T, Shikauchi Y, Imamura T, Miyazono K", "reference": { "type": "PubMed", "id": "12151385", "url": "https://pubmed.ncbi.nlm.nih.gov/12151385" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q12841-1", "protein_name": "Follistatin-related protein 1", "gene_name": "FSTL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62136-1", "protein_name": "Serine/threonine-protein phosphatase PP1-alpha catalytic subunit", "gene_name": "PPP1CA", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15198-1", "protein_name": "SMAD family member 9", "gene_name": "SMAD9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y5K5-1", "protein_name": "Ubiquitin carboxyl-terminal hydrolase isozyme L5", "gene_name": "UCHL5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13485-1", "protein_name": "SMAD family member 4", "gene_name": "SMAD4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15796-1", "protein_name": "SMAD family member 2", "gene_name": "SMAD2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NYA4-1", "protein_name": "Phosphatidylinositol-3,5-bisphosphate 3-phosphatase MTMR4", "gene_name": "MTMR4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P03971-1", "protein_name": "Anti-Muellerian hormone", "gene_name": "AMH", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43541-1", "protein_name": "SMAD family member 6", "gene_name": "SMAD6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99717-1", "protein_name": "SMAD family member 5", "gene_name": "SMAD5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61077-1", "protein_name": "Ubiquitin-conjugating enzyme E2 D3", "gene_name": "UBE2D3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51668-1", "protein_name": "Ubiquitin-conjugating enzyme E2 D1", "gene_name": "UBE2D1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P36873-1", "protein_name": "Serine/threonine-protein phosphatase PP1-gamma catalytic subunit", "gene_name": "PPP1CC", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13145-1", "protein_name": "BMP and activin membrane-bound inhibitor homolog", "gene_name": "BAMBI", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95393-1", "protein_name": "Bone morphogenetic protein 10", "gene_name": "BMP10", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95813-1", "protein_name": "Cerberus", "gene_name": "CER1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75807-1", "protein_name": "Protein phosphatase 1 regulatory subunit 15A", "gene_name": "PPP1R15A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BU40-6", "protein_name": "Chordin-like protein 1", "gene_name": "CHRDL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05111-1", "protein_name": "Inhibin alpha chain", "gene_name": "INHA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q7Z3T8-1", "protein_name": "Zinc finger FYVE domain-containing protein 16", "gene_name": "ZFYVE16", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14980-1", "protein_name": "Exportin-1", "gene_name": "XPO1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P36897-1", "protein_name": "TGF-beta receptor type-1", "gene_name": "TGFBR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15105-1", "protein_name": "SMAD family member 7", "gene_name": "SMAD7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P37023-1", "protein_name": "Activin receptor type-1-like", "gene_name": "ACVRL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62140-1", "protein_name": "Serine/threonine-protein phosphatase PP1-beta catalytic subunit", "gene_name": "PPP1CB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16671-1", "protein_name": "Anti-Muellerian hormone type-2 receptor", "gene_name": "AMHR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P84022-1", "protein_name": "SMAD family member 3", "gene_name": "SMAD3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15797-1", "protein_name": "SMAD family member 1", "gene_name": "SMAD1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HCE7-1", "protein_name": "E3 ubiquitin-protein ligase SMURF1", "gene_name": "SMURF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HAU4-1", "protein_name": "E3 ubiquitin-protein ligase SMURF2", "gene_name": "SMURF2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UK05-1", "protein_name": "Growth/differentiation factor 2", "gene_name": "GDF2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13705-1", "protein_name": "Activin receptor type-2B", "gene_name": "ACVR2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00238-1", "protein_name": "Bone morphogenetic protein receptor type-1B", "gene_name": "BMPR1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62979-1", "protein_name": "Ubiquitin-ribosomal protein eS31 fusion protein", "gene_name": "RPS27A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P12643-1", "protein_name": "Bone morphogenetic protein 2", "gene_name": "BMP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P36894-1", "protein_name": "Bone morphogenetic protein receptor type-1A", "gene_name": "BMPR1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13253-1", "protein_name": "Noggin", "gene_name": "NOG", "tax_name": "Human" }, { "uniprot_canonical_ac": "P37173-1", "protein_name": "TGF-beta receptor type-2", "gene_name": "TGFBR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P12755-1", "protein_name": "Ski oncogene", "gene_name": "SKI", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q969W9-1", "protein_name": "Protein TMEPAI", "gene_name": "PMEPA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27037-1", "protein_name": "Activin receptor type-2A", "gene_name": "ACVR2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13873-1", "protein_name": "Bone morphogenetic protein receptor type-2", "gene_name": "BMPR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y4E8-1", "protein_name": "Ubiquitin carboxyl-terminal hydrolase 15", "gene_name": "USP15", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG47-1", "protein_name": "Polyubiquitin-B", "gene_name": "UBB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96PU5-1", "protein_name": "E3 ubiquitin-protein ligase NEDD4-like", "gene_name": "NEDD4L", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62987-1", "protein_name": "Ubiquitin-ribosomal protein eL40 fusion protein", "gene_name": "UBA52", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q03167-1", "protein_name": "Transforming growth factor beta receptor type 3", "gene_name": "TGFBR3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H772-1", "protein_name": "Gremlin-2", "gene_name": "GREM2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P08476-1", "protein_name": "Inhibin beta A chain", "gene_name": "INHBA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y3F4-1", "protein_name": "Serine-threonine kinase receptor-associated protein", "gene_name": "STRAP", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01137-1", "protein_name": "Transforming growth factor beta-1 proprotein", "gene_name": "TGFB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG48-1", "protein_name": "Polyubiquitin-C", "gene_name": "UBC", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UNE7-1", "protein_name": "E3 ubiquitin-protein ligase CHIP", "gene_name": "STUB1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q12841", "url": "https://www.uniprot.org/uniprotkb/Q12841" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.12151385", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 53 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Chromosomal region maintenance 1 (CRM1)-dependent nuclear export of Smad ubiquitin regulatory factor 1 (Smurf1) is essential for negative regulation of transforming growth factor-beta signaling by Smad7.", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "Tajima Y, Goto K, Yoshida M, Shinomiya K, Sekimoto T, Yoneda Y, Miyazono K, Imamura T", "reference": { "type": "PubMed", "id": "12519765", "url": "https://pubmed.ncbi.nlm.nih.gov/12519765" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q12841-1", "protein_name": "Follistatin-related protein 1", "gene_name": "FSTL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62136-1", "protein_name": "Serine/threonine-protein phosphatase PP1-alpha catalytic subunit", "gene_name": "PPP1CA", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15198-1", "protein_name": "SMAD family member 9", "gene_name": "SMAD9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y5K5-1", "protein_name": "Ubiquitin carboxyl-terminal hydrolase isozyme L5", "gene_name": "UCHL5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13485-1", "protein_name": "SMAD family member 4", "gene_name": "SMAD4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15796-1", "protein_name": "SMAD family member 2", "gene_name": "SMAD2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NYA4-1", "protein_name": "Phosphatidylinositol-3,5-bisphosphate 3-phosphatase MTMR4", "gene_name": "MTMR4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P03971-1", "protein_name": "Anti-Muellerian hormone", "gene_name": "AMH", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43541-1", "protein_name": "SMAD family member 6", "gene_name": "SMAD6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99717-1", "protein_name": "SMAD family member 5", "gene_name": "SMAD5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61077-1", "protein_name": "Ubiquitin-conjugating enzyme E2 D3", "gene_name": "UBE2D3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51668-1", "protein_name": "Ubiquitin-conjugating enzyme E2 D1", "gene_name": "UBE2D1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P36873-1", "protein_name": "Serine/threonine-protein phosphatase PP1-gamma catalytic subunit", "gene_name": "PPP1CC", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13145-1", "protein_name": "BMP and activin membrane-bound inhibitor homolog", "gene_name": "BAMBI", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95393-1", "protein_name": "Bone morphogenetic protein 10", "gene_name": "BMP10", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95813-1", "protein_name": "Cerberus", "gene_name": "CER1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75807-1", "protein_name": "Protein phosphatase 1 regulatory subunit 15A", "gene_name": "PPP1R15A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BU40-6", "protein_name": "Chordin-like protein 1", "gene_name": "CHRDL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05111-1", "protein_name": "Inhibin alpha chain", "gene_name": "INHA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q7Z3T8-1", "protein_name": "Zinc finger FYVE domain-containing protein 16", "gene_name": "ZFYVE16", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14980-1", "protein_name": "Exportin-1", "gene_name": "XPO1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P36897-1", "protein_name": "TGF-beta receptor type-1", "gene_name": "TGFBR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15105-1", "protein_name": "SMAD family member 7", "gene_name": "SMAD7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P37023-1", "protein_name": "Activin receptor type-1-like", "gene_name": "ACVRL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62140-1", "protein_name": "Serine/threonine-protein phosphatase PP1-beta catalytic subunit", "gene_name": "PPP1CB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16671-1", "protein_name": "Anti-Muellerian hormone type-2 receptor", "gene_name": "AMHR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P84022-1", "protein_name": "SMAD family member 3", "gene_name": "SMAD3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15797-1", "protein_name": "SMAD family member 1", "gene_name": "SMAD1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HCE7-1", "protein_name": "E3 ubiquitin-protein ligase SMURF1", "gene_name": "SMURF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HAU4-1", "protein_name": "E3 ubiquitin-protein ligase SMURF2", "gene_name": "SMURF2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UK05-1", "protein_name": "Growth/differentiation factor 2", "gene_name": "GDF2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13705-1", "protein_name": "Activin receptor type-2B", "gene_name": "ACVR2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00238-1", "protein_name": "Bone morphogenetic protein receptor type-1B", "gene_name": "BMPR1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62979-1", "protein_name": "Ubiquitin-ribosomal protein eS31 fusion protein", "gene_name": "RPS27A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P12643-1", "protein_name": "Bone morphogenetic protein 2", "gene_name": "BMP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P36894-1", "protein_name": "Bone morphogenetic protein receptor type-1A", "gene_name": "BMPR1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13253-1", "protein_name": "Noggin", "gene_name": "NOG", "tax_name": "Human" }, { "uniprot_canonical_ac": "P37173-1", "protein_name": "TGF-beta receptor type-2", "gene_name": "TGFBR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P12755-1", "protein_name": "Ski oncogene", "gene_name": "SKI", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q969W9-1", "protein_name": "Protein TMEPAI", "gene_name": "PMEPA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27037-1", "protein_name": "Activin receptor type-2A", "gene_name": "ACVR2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13873-1", "protein_name": "Bone morphogenetic protein receptor type-2", "gene_name": "BMPR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y4E8-1", "protein_name": "Ubiquitin carboxyl-terminal hydrolase 15", "gene_name": "USP15", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG47-1", "protein_name": "Polyubiquitin-B", "gene_name": "UBB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96PU5-1", "protein_name": "E3 ubiquitin-protein ligase NEDD4-like", "gene_name": "NEDD4L", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62987-1", "protein_name": "Ubiquitin-ribosomal protein eL40 fusion protein", "gene_name": "UBA52", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q03167-1", "protein_name": "Transforming growth factor beta receptor type 3", "gene_name": "TGFBR3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H772-1", "protein_name": "Gremlin-2", "gene_name": "GREM2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P08476-1", "protein_name": "Inhibin beta A chain", "gene_name": "INHBA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y3F4-1", "protein_name": "Serine-threonine kinase receptor-associated protein", "gene_name": "STRAP", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01137-1", "protein_name": "Transforming growth factor beta-1 proprotein", "gene_name": "TGFB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG48-1", "protein_name": "Polyubiquitin-C", "gene_name": "UBC", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UNE7-1", "protein_name": "E3 ubiquitin-protein ligase CHIP", "gene_name": "STUB1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q12841", "url": "https://www.uniprot.org/uniprotkb/Q12841" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.12519765", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 53 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "An extended bipartite nuclear localization signal in Smad4 is required for its nuclear import and transcriptional activity.", "journal": "Oncogene", "date": "2003", "authors": "Xiao Z, Latek R, Lodish HF", "reference": { "type": "PubMed", "id": "12592392", "url": "https://pubmed.ncbi.nlm.nih.gov/12592392" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q12841-1", "protein_name": "Follistatin-related protein 1", "gene_name": "FSTL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15198-1", "protein_name": "SMAD family member 9", "gene_name": "SMAD9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NER5-1", "protein_name": "Activin receptor type-1C", "gene_name": "ACVR1C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13485-1", "protein_name": "SMAD family member 4", "gene_name": "SMAD4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15796-1", "protein_name": "SMAD family member 2", "gene_name": "SMAD2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P28482-1", "protein_name": "Mitogen-activated protein kinase 1", "gene_name": "MAPK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14919-1", "protein_name": "Dr1-associated corepressor", "gene_name": "DRAP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P09958-1", "protein_name": "Furin", "gene_name": "FURIN", "tax_name": "Human" }, { "uniprot_canonical_ac": "P03971-1", "protein_name": "Anti-Muellerian hormone", "gene_name": "AMH", "tax_name": "Human" }, { "uniprot_canonical_ac": "P29122-1", "protein_name": "Proprotein convertase subtilisin/kexin type 6", "gene_name": "PCSK6", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43541-1", "protein_name": "SMAD family member 6", "gene_name": "SMAD6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG37-1", "protein_name": "Cryptic protein", "gene_name": "CFC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99717-1", "protein_name": "SMAD family member 5", "gene_name": "SMAD5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61077-1", "protein_name": "Ubiquitin-conjugating enzyme E2 D3", "gene_name": "UBE2D3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51668-1", "protein_name": "Ubiquitin-conjugating enzyme E2 D1", "gene_name": "UBE2D1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95393-1", "protein_name": "Bone morphogenetic protein 10", "gene_name": "BMP10", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95813-1", "protein_name": "Cerberus", "gene_name": "CER1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BU40-6", "protein_name": "Chordin-like protein 1", "gene_name": "CHRDL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75610-1", "protein_name": "Left-right determination factor 1", "gene_name": "LEFTY1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05111-1", "protein_name": "Inhibin alpha chain", "gene_name": "INHA", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00292-1", "protein_name": "Left-right determination factor 2", "gene_name": "LEFTY2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q7Z3T8-1", "protein_name": "Zinc finger FYVE domain-containing protein 16", "gene_name": "ZFYVE16", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43524-1", "protein_name": "Forkhead box protein O3", "gene_name": "FOXO3", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15105-1", "protein_name": "SMAD family member 7", "gene_name": "SMAD7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P37023-1", "protein_name": "Activin receptor type-1-like", "gene_name": "ACVRL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P36896-1", "protein_name": "Activin receptor type-1B", "gene_name": "ACVR1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16671-1", "protein_name": "Anti-Muellerian hormone type-2 receptor", "gene_name": "AMHR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P84022-1", "protein_name": "SMAD family member 3", "gene_name": "SMAD3", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75593-1", "protein_name": "Forkhead box protein H1", "gene_name": "FOXH1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15797-1", "protein_name": "SMAD family member 1", "gene_name": "SMAD1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HCE7-1", "protein_name": "E3 ubiquitin-protein ligase SMURF1", "gene_name": "SMURF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HAU4-1", "protein_name": "E3 ubiquitin-protein ligase SMURF2", "gene_name": "SMURF2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UK05-1", "protein_name": "Growth/differentiation factor 2", "gene_name": "GDF2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13705-1", "protein_name": "Activin receptor type-2B", "gene_name": "ACVR2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00238-1", "protein_name": "Bone morphogenetic protein receptor type-1B", "gene_name": "BMPR1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P12643-1", "protein_name": "Bone morphogenetic protein 2", "gene_name": "BMP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P36894-1", "protein_name": "Bone morphogenetic protein receptor type-1A", "gene_name": "BMPR1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13253-1", "protein_name": "Noggin", "gene_name": "NOG", "tax_name": "Human" }, { "uniprot_canonical_ac": "P12755-1", "protein_name": "Ski oncogene", "gene_name": "SKI", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96S42-1", "protein_name": "Nodal homolog", "gene_name": "NODAL", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27037-1", "protein_name": "Activin receptor type-2A", "gene_name": "ACVR2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13873-1", "protein_name": "Bone morphogenetic protein receptor type-2", "gene_name": "BMPR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27361-1", "protein_name": "Mitogen-activated protein kinase 3", "gene_name": "MAPK3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N907-1", "protein_name": "DAN domain family member 5", "gene_name": "DAND5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27539-1", "protein_name": "Embryonic growth/differentiation factor 1", "gene_name": "GDF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q03167-1", "protein_name": "Transforming growth factor beta receptor type 3", "gene_name": "TGFBR3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H772-1", "protein_name": "Gremlin-2", "gene_name": "GREM2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P08476-1", "protein_name": "Inhibin beta A chain", "gene_name": "INHBA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P13385-1", "protein_name": "Protein Cripto", "gene_name": "CRIPTO", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51864-1", "protein_name": "Protein CRIPTO3", "gene_name": "CRIPTO3", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q12841", "url": "https://www.uniprot.org/uniprotkb/Q12841" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.12592392", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 50 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "A novel nuclear export signal in Smad1 is essential for its signaling activity.", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "Xiao Z, Brownawell AM, Macara IG, Lodish HF", "reference": { "type": "PubMed", "id": "12821673", "url": "https://pubmed.ncbi.nlm.nih.gov/12821673" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q12841-1", "protein_name": "Follistatin-related protein 1", "gene_name": "FSTL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15198-1", "protein_name": "SMAD family member 9", "gene_name": "SMAD9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13485-1", "protein_name": "SMAD family member 4", "gene_name": "SMAD4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P03971-1", "protein_name": "Anti-Muellerian hormone", "gene_name": "AMH", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43541-1", "protein_name": "SMAD family member 6", "gene_name": "SMAD6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99717-1", "protein_name": "SMAD family member 5", "gene_name": "SMAD5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61077-1", "protein_name": "Ubiquitin-conjugating enzyme E2 D3", "gene_name": "UBE2D3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51668-1", "protein_name": "Ubiquitin-conjugating enzyme E2 D1", "gene_name": "UBE2D1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95393-1", "protein_name": "Bone morphogenetic protein 10", "gene_name": "BMP10", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95813-1", "protein_name": "Cerberus", "gene_name": "CER1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BU40-6", "protein_name": "Chordin-like protein 1", "gene_name": "CHRDL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05111-1", "protein_name": "Inhibin alpha chain", "gene_name": "INHA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q7Z3T8-1", "protein_name": "Zinc finger FYVE domain-containing protein 16", "gene_name": "ZFYVE16", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15105-1", "protein_name": "SMAD family member 7", "gene_name": "SMAD7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P37023-1", "protein_name": "Activin receptor type-1-like", "gene_name": "ACVRL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16671-1", "protein_name": "Anti-Muellerian hormone type-2 receptor", "gene_name": "AMHR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15797-1", "protein_name": "SMAD family member 1", "gene_name": "SMAD1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HCE7-1", "protein_name": "E3 ubiquitin-protein ligase SMURF1", "gene_name": "SMURF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HAU4-1", "protein_name": "E3 ubiquitin-protein ligase SMURF2", "gene_name": "SMURF2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UK05-1", "protein_name": "Growth/differentiation factor 2", "gene_name": "GDF2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13705-1", "protein_name": "Activin receptor type-2B", "gene_name": "ACVR2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00238-1", "protein_name": "Bone morphogenetic protein receptor type-1B", "gene_name": "BMPR1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P12643-1", "protein_name": "Bone morphogenetic protein 2", "gene_name": "BMP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P36894-1", "protein_name": "Bone morphogenetic protein receptor type-1A", "gene_name": "BMPR1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13253-1", "protein_name": "Noggin", "gene_name": "NOG", "tax_name": "Human" }, { "uniprot_canonical_ac": "P12755-1", "protein_name": "Ski oncogene", "gene_name": "SKI", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27037-1", "protein_name": "Activin receptor type-2A", "gene_name": "ACVR2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13873-1", "protein_name": "Bone morphogenetic protein receptor type-2", "gene_name": "BMPR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q03167-1", "protein_name": "Transforming growth factor beta receptor type 3", "gene_name": "TGFBR3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H772-1", "protein_name": "Gremlin-2", "gene_name": "GREM2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P08476-1", "protein_name": "Inhibin beta A chain", "gene_name": "INHBA", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q12841", "url": "https://www.uniprot.org/uniprotkb/Q12841" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.12821673", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 31 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Cooperative inhibition of bone morphogenetic protein signaling by Smurf1 and inhibitory Smads.", "journal": "Molecular biology of the cell", "date": "2003", "authors": "Murakami G, Watabe T, Takaoka K, Miyazono K, Imamura T", "reference": { "type": "PubMed", "id": "12857866", "url": "https://pubmed.ncbi.nlm.nih.gov/12857866" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q12841-1", "protein_name": "Follistatin-related protein 1", "gene_name": "FSTL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15198-1", "protein_name": "SMAD family member 9", "gene_name": "SMAD9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13485-1", "protein_name": "SMAD family member 4", "gene_name": "SMAD4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P03971-1", "protein_name": "Anti-Muellerian hormone", "gene_name": "AMH", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43541-1", "protein_name": "SMAD family member 6", "gene_name": "SMAD6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99717-1", "protein_name": "SMAD family member 5", "gene_name": "SMAD5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61077-1", "protein_name": "Ubiquitin-conjugating enzyme E2 D3", "gene_name": "UBE2D3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51668-1", "protein_name": "Ubiquitin-conjugating enzyme E2 D1", "gene_name": "UBE2D1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95393-1", "protein_name": "Bone morphogenetic protein 10", "gene_name": "BMP10", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95813-1", "protein_name": "Cerberus", "gene_name": "CER1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BU40-6", "protein_name": "Chordin-like protein 1", "gene_name": "CHRDL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05111-1", "protein_name": "Inhibin alpha chain", "gene_name": "INHA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q7Z3T8-1", "protein_name": "Zinc finger FYVE domain-containing protein 16", "gene_name": "ZFYVE16", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15105-1", "protein_name": "SMAD family member 7", "gene_name": "SMAD7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P37023-1", "protein_name": "Activin receptor type-1-like", "gene_name": "ACVRL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16671-1", "protein_name": "Anti-Muellerian hormone type-2 receptor", "gene_name": "AMHR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15797-1", "protein_name": "SMAD family member 1", "gene_name": "SMAD1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HCE7-1", "protein_name": "E3 ubiquitin-protein ligase SMURF1", "gene_name": "SMURF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HAU4-1", "protein_name": "E3 ubiquitin-protein ligase SMURF2", "gene_name": "SMURF2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UK05-1", "protein_name": "Growth/differentiation factor 2", "gene_name": "GDF2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13705-1", "protein_name": "Activin receptor type-2B", "gene_name": "ACVR2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00238-1", "protein_name": "Bone morphogenetic protein receptor type-1B", "gene_name": "BMPR1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P12643-1", "protein_name": "Bone morphogenetic protein 2", "gene_name": "BMP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P36894-1", "protein_name": "Bone morphogenetic protein receptor type-1A", "gene_name": "BMPR1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13253-1", "protein_name": "Noggin", "gene_name": "NOG", "tax_name": "Human" }, { "uniprot_canonical_ac": "P12755-1", "protein_name": "Ski oncogene", "gene_name": "SKI", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27037-1", "protein_name": "Activin receptor type-2A", "gene_name": "ACVR2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13873-1", "protein_name": "Bone morphogenetic protein receptor type-2", "gene_name": "BMPR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q03167-1", "protein_name": "Transforming growth factor beta receptor type 3", "gene_name": "TGFBR3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H772-1", "protein_name": "Gremlin-2", "gene_name": "GREM2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P08476-1", "protein_name": "Inhibin beta A chain", "gene_name": "INHBA", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q12841", "url": "https://www.uniprot.org/uniprotkb/Q12841" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 463, "end_pos": 463, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "Q15797", "url": "https://www.uniprot.org/uniprotkb/Q15797" }, { "database": "PubMed", "id": "11779505", "url": "https://pubmed.ncbi.nlm.nih.gov/11779505" }, { "database": "PubMed", "id": "9136927", "url": "https://pubmed.ncbi.nlm.nih.gov/9136927" }, { "database": "iPTMnet", "id": "Q15797", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q15797" }, { "database": "PubMed", "id": "19651622", "url": "https://pubmed.ncbi.nlm.nih.gov/19651622" }, { "database": "PRO", "id": "Q15797", "url": "https://proconsortium.org/cgi-bin/entry_pro?id=Q15797" }, { "database": "PubMed", "id": "12857866", "url": "https://pubmed.ncbi.nlm.nih.gov/12857866" }, { "database": "PubMed", "id": "28542453", "url": "https://pubmed.ncbi.nlm.nih.gov/28542453" }, { "database": "PubMed", "id": "30674353", "url": "https://pubmed.ncbi.nlm.nih.gov/30674353" }, { "database": "PubMed", "id": "30854241", "url": "https://pubmed.ncbi.nlm.nih.gov/30854241" } ], "site_lbl": "Ser463", "uniprot_canonical_ac": "Q15797-1" }, { "start_pos": 465, "end_pos": 465, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "Q15797", "url": "https://www.uniprot.org/uniprotkb/Q15797" }, { "database": "PubMed", "id": "9136927", "url": "https://pubmed.ncbi.nlm.nih.gov/9136927" }, { "database": "PubMed", "id": "11779505", "url": "https://pubmed.ncbi.nlm.nih.gov/11779505" }, { "database": "iPTMnet", "id": "Q15797", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q15797" }, { "database": "PubMed", "id": "19651622", "url": "https://pubmed.ncbi.nlm.nih.gov/19651622" }, { "database": "PRO", "id": "Q15797", "url": "https://proconsortium.org/cgi-bin/entry_pro?id=Q15797" }, { "database": "PubMed", "id": "12857866", "url": "https://pubmed.ncbi.nlm.nih.gov/12857866" }, { "database": "PubMed", "id": "28542453", "url": "https://pubmed.ncbi.nlm.nih.gov/28542453" }, { "database": "PubMed", "id": "30674353", "url": "https://pubmed.ncbi.nlm.nih.gov/30674353" }, { "database": "PubMed", "id": "30854241", "url": "https://pubmed.ncbi.nlm.nih.gov/30854241" } ], "site_lbl": "Ser465", "uniprot_canonical_ac": "Q15797-1" } ], "record_id": "pubmed.12857866", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 31 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Follistatin-related gene expression, but not follistatin expression, is decreased in human endometrial adenocarcinoma.", "journal": "European journal of endocrinology", "date": "2004", "authors": "Ciarmela P, Florio P, Sigurdardottir M, Toti P, Maguer-Satta V, Rimokh R, Altomare A, Tosi P, Petraglia F", "reference": { "type": "PubMed", "id": "15296481", "url": "https://pubmed.ncbi.nlm.nih.gov/15296481" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q12841-1", "protein_name": "Follistatin-related protein 1", "gene_name": "FSTL1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q12841", "url": "https://www.uniprot.org/uniprotkb/Q12841" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.15296481", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Follistatin-related protein gene (FRP) is expressed in the synovial tissues of rheumatoid arthritis, but its polymorphisms are not associated with genetic susceptibility.", "journal": "Clin. Exp. Rheumatol.", "date": "2004", "authors": "Ehara Y, Sakurai D, Tsuchiya N, Nakano K, Tanaka Y, Yamaguchi A, Tokunaga K", "reference": { "type": "PubMed", "id": "15638044", "url": "https://pubmed.ncbi.nlm.nih.gov/15638044" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q12841-1", "protein_name": "Follistatin-related protein 1", "gene_name": "FSTL1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q12841", "url": "https://www.uniprot.org/uniprotkb/Q12841" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.15638044", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Structure of the ternary signaling complex of a TGF-beta superfamily member.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2006", "authors": "Allendorph GP, Vale WW, Choe S", "reference": { "type": "PubMed", "id": "16672363", "url": "https://pubmed.ncbi.nlm.nih.gov/16672363" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q12841-1", "protein_name": "Follistatin-related protein 1", "gene_name": "FSTL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15198-1", "protein_name": "SMAD family member 9", "gene_name": "SMAD9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13485-1", "protein_name": "SMAD family member 4", "gene_name": "SMAD4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P03971-1", "protein_name": "Anti-Muellerian hormone", "gene_name": "AMH", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43541-1", "protein_name": "SMAD family member 6", "gene_name": "SMAD6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99717-1", "protein_name": "SMAD family member 5", "gene_name": "SMAD5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61077-1", "protein_name": "Ubiquitin-conjugating enzyme E2 D3", "gene_name": "UBE2D3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51668-1", "protein_name": "Ubiquitin-conjugating enzyme E2 D1", "gene_name": "UBE2D1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95393-1", "protein_name": "Bone morphogenetic protein 10", "gene_name": "BMP10", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95813-1", "protein_name": "Cerberus", "gene_name": "CER1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BU40-6", "protein_name": "Chordin-like protein 1", "gene_name": "CHRDL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05111-1", "protein_name": "Inhibin alpha chain", "gene_name": "INHA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q7Z3T8-1", "protein_name": "Zinc finger FYVE domain-containing protein 16", "gene_name": "ZFYVE16", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15105-1", "protein_name": "SMAD family member 7", "gene_name": "SMAD7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P37023-1", "protein_name": "Activin receptor type-1-like", "gene_name": "ACVRL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16671-1", "protein_name": "Anti-Muellerian hormone type-2 receptor", "gene_name": "AMHR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15797-1", "protein_name": "SMAD family member 1", "gene_name": "SMAD1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HCE7-1", "protein_name": "E3 ubiquitin-protein ligase SMURF1", "gene_name": "SMURF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HAU4-1", "protein_name": "E3 ubiquitin-protein ligase SMURF2", "gene_name": "SMURF2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UK05-1", "protein_name": "Growth/differentiation factor 2", "gene_name": "GDF2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13705-1", "protein_name": "Activin receptor type-2B", "gene_name": "ACVR2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00238-1", "protein_name": "Bone morphogenetic protein receptor type-1B", "gene_name": "BMPR1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P12643-1", "protein_name": "Bone morphogenetic protein 2", "gene_name": "BMP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P36894-1", "protein_name": "Bone morphogenetic protein receptor type-1A", "gene_name": "BMPR1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13253-1", "protein_name": "Noggin", "gene_name": "NOG", "tax_name": "Human" }, { "uniprot_canonical_ac": "P12755-1", "protein_name": "Ski oncogene", "gene_name": "SKI", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27037-1", "protein_name": "Activin receptor type-2A", "gene_name": "ACVR2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13873-1", "protein_name": "Bone morphogenetic protein receptor type-2", "gene_name": "BMPR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q03167-1", "protein_name": "Transforming growth factor beta receptor type 3", "gene_name": "TGFBR3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H772-1", "protein_name": "Gremlin-2", "gene_name": "GREM2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P08476-1", "protein_name": "Inhibin beta A chain", "gene_name": "INHBA", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q12841", "url": "https://www.uniprot.org/uniprotkb/Q12841" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.16672363", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 31 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Bone morphogenetic proteins and their antagonists.", "journal": "Reviews in endocrine & metabolic disorders", "date": "2006", "authors": "Gazzerro E, Canalis E", "reference": { "type": "PubMed", "id": "17029022", "url": "https://pubmed.ncbi.nlm.nih.gov/17029022" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q12841-1", "protein_name": "Follistatin-related protein 1", "gene_name": "FSTL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15198-1", "protein_name": "SMAD family member 9", "gene_name": "SMAD9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13485-1", "protein_name": "SMAD family member 4", "gene_name": "SMAD4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P03971-1", "protein_name": "Anti-Muellerian hormone", "gene_name": "AMH", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43541-1", "protein_name": "SMAD family member 6", "gene_name": "SMAD6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99717-1", "protein_name": "SMAD family member 5", "gene_name": "SMAD5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61077-1", "protein_name": "Ubiquitin-conjugating enzyme E2 D3", "gene_name": "UBE2D3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51668-1", "protein_name": "Ubiquitin-conjugating enzyme E2 D1", "gene_name": "UBE2D1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95393-1", "protein_name": "Bone morphogenetic protein 10", "gene_name": "BMP10", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95813-1", "protein_name": "Cerberus", "gene_name": "CER1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BU40-6", "protein_name": "Chordin-like protein 1", "gene_name": "CHRDL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05111-1", "protein_name": "Inhibin alpha chain", "gene_name": "INHA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q7Z3T8-1", "protein_name": "Zinc finger FYVE domain-containing protein 16", "gene_name": "ZFYVE16", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15105-1", "protein_name": "SMAD family member 7", "gene_name": "SMAD7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P37023-1", "protein_name": "Activin receptor type-1-like", "gene_name": "ACVRL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16671-1", "protein_name": "Anti-Muellerian hormone type-2 receptor", "gene_name": "AMHR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15797-1", "protein_name": "SMAD family member 1", "gene_name": "SMAD1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HCE7-1", "protein_name": "E3 ubiquitin-protein ligase SMURF1", "gene_name": "SMURF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HAU4-1", "protein_name": "E3 ubiquitin-protein ligase SMURF2", "gene_name": "SMURF2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UK05-1", "protein_name": "Growth/differentiation factor 2", "gene_name": "GDF2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13705-1", "protein_name": "Activin receptor type-2B", "gene_name": "ACVR2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00238-1", "protein_name": "Bone morphogenetic protein receptor type-1B", "gene_name": "BMPR1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P12643-1", "protein_name": "Bone morphogenetic protein 2", "gene_name": "BMP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P36894-1", "protein_name": "Bone morphogenetic protein receptor type-1A", "gene_name": "BMPR1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13253-1", "protein_name": "Noggin", "gene_name": "NOG", "tax_name": "Human" }, { "uniprot_canonical_ac": "P12755-1", "protein_name": "Ski oncogene", "gene_name": "SKI", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27037-1", "protein_name": "Activin receptor type-2A", "gene_name": "ACVR2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13873-1", "protein_name": "Bone morphogenetic protein receptor type-2", "gene_name": "BMPR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q03167-1", "protein_name": "Transforming growth factor beta receptor type 3", "gene_name": "TGFBR3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H772-1", "protein_name": "Gremlin-2", "gene_name": "GREM2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P08476-1", "protein_name": "Inhibin beta A chain", "gene_name": "INHBA", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q12841", "url": "https://www.uniprot.org/uniprotkb/Q12841" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.17029022", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 31 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Identification of BMP9 and BMP10 as functional activators of the orphan activin receptor-like kinase 1 (ALK1) in endothelial cells.", "journal": "Blood", "date": "2007", "authors": "David L, Mallet C, Mazerbourg S, Feige JJ, Bailly S", "reference": { "type": "PubMed", "id": "17068149", "url": "https://pubmed.ncbi.nlm.nih.gov/17068149" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q12841-1", "protein_name": "Follistatin-related protein 1", "gene_name": "FSTL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15198-1", "protein_name": "SMAD family member 9", "gene_name": "SMAD9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13485-1", "protein_name": "SMAD family member 4", "gene_name": "SMAD4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P03971-1", "protein_name": "Anti-Muellerian hormone", "gene_name": "AMH", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43541-1", "protein_name": "SMAD family member 6", "gene_name": "SMAD6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99717-1", "protein_name": "SMAD family member 5", "gene_name": "SMAD5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61077-1", "protein_name": "Ubiquitin-conjugating enzyme E2 D3", "gene_name": "UBE2D3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51668-1", "protein_name": "Ubiquitin-conjugating enzyme E2 D1", "gene_name": "UBE2D1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95393-1", "protein_name": "Bone morphogenetic protein 10", "gene_name": "BMP10", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95813-1", "protein_name": "Cerberus", "gene_name": "CER1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BU40-6", "protein_name": "Chordin-like protein 1", "gene_name": "CHRDL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05111-1", "protein_name": "Inhibin alpha chain", "gene_name": "INHA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q7Z3T8-1", "protein_name": "Zinc finger FYVE domain-containing protein 16", "gene_name": "ZFYVE16", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15105-1", "protein_name": "SMAD family member 7", "gene_name": "SMAD7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P37023-1", "protein_name": "Activin receptor type-1-like", "gene_name": "ACVRL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16671-1", "protein_name": "Anti-Muellerian hormone type-2 receptor", "gene_name": "AMHR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15797-1", "protein_name": "SMAD family member 1", "gene_name": "SMAD1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HCE7-1", "protein_name": "E3 ubiquitin-protein ligase SMURF1", "gene_name": "SMURF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HAU4-1", "protein_name": "E3 ubiquitin-protein ligase SMURF2", "gene_name": "SMURF2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UK05-1", "protein_name": "Growth/differentiation factor 2", "gene_name": "GDF2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13705-1", "protein_name": "Activin receptor type-2B", "gene_name": "ACVR2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00238-1", "protein_name": "Bone morphogenetic protein receptor type-1B", "gene_name": "BMPR1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P12643-1", "protein_name": "Bone morphogenetic protein 2", "gene_name": "BMP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P36894-1", "protein_name": "Bone morphogenetic protein receptor type-1A", "gene_name": "BMPR1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13253-1", "protein_name": "Noggin", "gene_name": "NOG", "tax_name": "Human" }, { "uniprot_canonical_ac": "P12755-1", "protein_name": "Ski oncogene", "gene_name": "SKI", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27037-1", "protein_name": "Activin receptor type-2A", "gene_name": "ACVR2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13873-1", "protein_name": "Bone morphogenetic protein receptor type-2", "gene_name": "BMPR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q03167-1", "protein_name": "Transforming growth factor beta receptor type 3", "gene_name": "TGFBR3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H772-1", "protein_name": "Gremlin-2", "gene_name": "GREM2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P08476-1", "protein_name": "Inhibin beta A chain", "gene_name": "INHBA", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q12841", "url": "https://www.uniprot.org/uniprotkb/Q12841" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.17068149", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 31 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "BMP-9 signals via ALK1 and inhibits bFGF-induced endothelial cell proliferation and VEGF-stimulated angiogenesis.", "journal": "Journal of cell science", "date": "2007", "authors": "Scharpfenecker M, van Dinther M, Liu Z, van Bezooijen RL, Zhao Q, Pukac L, Lowik CW, ten Dijke P", "reference": { "type": "PubMed", "id": "17311849", "url": "https://pubmed.ncbi.nlm.nih.gov/17311849" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q12841-1", "protein_name": "Follistatin-related protein 1", "gene_name": "FSTL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15198-1", "protein_name": "SMAD family member 9", "gene_name": "SMAD9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13485-1", "protein_name": "SMAD family member 4", "gene_name": "SMAD4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P03971-1", "protein_name": "Anti-Muellerian hormone", "gene_name": "AMH", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43541-1", "protein_name": "SMAD family member 6", "gene_name": "SMAD6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99717-1", "protein_name": "SMAD family member 5", "gene_name": "SMAD5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61077-1", "protein_name": "Ubiquitin-conjugating enzyme E2 D3", "gene_name": "UBE2D3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51668-1", "protein_name": "Ubiquitin-conjugating enzyme E2 D1", "gene_name": "UBE2D1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95393-1", "protein_name": "Bone morphogenetic protein 10", "gene_name": "BMP10", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95813-1", "protein_name": "Cerberus", "gene_name": "CER1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BU40-6", "protein_name": "Chordin-like protein 1", "gene_name": "CHRDL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05111-1", "protein_name": "Inhibin alpha chain", "gene_name": "INHA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q7Z3T8-1", "protein_name": "Zinc finger FYVE domain-containing protein 16", "gene_name": "ZFYVE16", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15105-1", "protein_name": "SMAD family member 7", "gene_name": "SMAD7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P37023-1", "protein_name": "Activin receptor type-1-like", "gene_name": "ACVRL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16671-1", "protein_name": "Anti-Muellerian hormone type-2 receptor", "gene_name": "AMHR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15797-1", "protein_name": "SMAD family member 1", "gene_name": "SMAD1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HCE7-1", "protein_name": "E3 ubiquitin-protein ligase SMURF1", "gene_name": "SMURF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HAU4-1", "protein_name": "E3 ubiquitin-protein ligase SMURF2", "gene_name": "SMURF2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UK05-1", "protein_name": "Growth/differentiation factor 2", "gene_name": "GDF2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13705-1", "protein_name": "Activin receptor type-2B", "gene_name": "ACVR2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00238-1", "protein_name": "Bone morphogenetic protein receptor type-1B", "gene_name": "BMPR1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P12643-1", "protein_name": "Bone morphogenetic protein 2", "gene_name": "BMP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P36894-1", "protein_name": "Bone morphogenetic protein receptor type-1A", "gene_name": "BMPR1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13253-1", "protein_name": "Noggin", "gene_name": "NOG", "tax_name": "Human" }, { "uniprot_canonical_ac": "P12755-1", "protein_name": "Ski oncogene", "gene_name": "SKI", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27037-1", "protein_name": "Activin receptor type-2A", "gene_name": "ACVR2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13873-1", "protein_name": "Bone morphogenetic protein receptor type-2", "gene_name": "BMPR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q03167-1", "protein_name": "Transforming growth factor beta receptor type 3", "gene_name": "TGFBR3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H772-1", "protein_name": "Gremlin-2", "gene_name": "GREM2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P08476-1", "protein_name": "Inhibin beta A chain", "gene_name": "INHBA", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q12841", "url": "https://www.uniprot.org/uniprotkb/Q12841" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.17311849", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 31 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Endofin acts as a Smad anchor for receptor activation in BMP signaling.", "journal": "Journal of cell science", "date": "2007", "authors": "Shi W, Chang C, Nie S, Xie S, Wan M, Cao X", "reference": { "type": "PubMed", "id": "17356069", "url": "https://pubmed.ncbi.nlm.nih.gov/17356069" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q12841-1", "protein_name": "Follistatin-related protein 1", "gene_name": "FSTL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15198-1", "protein_name": "SMAD family member 9", "gene_name": "SMAD9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13485-1", "protein_name": "SMAD family member 4", "gene_name": "SMAD4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P03971-1", "protein_name": "Anti-Muellerian hormone", "gene_name": "AMH", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43541-1", "protein_name": "SMAD family member 6", "gene_name": "SMAD6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99717-1", "protein_name": "SMAD family member 5", "gene_name": "SMAD5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61077-1", "protein_name": "Ubiquitin-conjugating enzyme E2 D3", "gene_name": "UBE2D3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51668-1", "protein_name": "Ubiquitin-conjugating enzyme E2 D1", "gene_name": "UBE2D1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95393-1", "protein_name": "Bone morphogenetic protein 10", "gene_name": "BMP10", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95813-1", "protein_name": "Cerberus", "gene_name": "CER1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BU40-6", "protein_name": "Chordin-like protein 1", "gene_name": "CHRDL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05111-1", "protein_name": "Inhibin alpha chain", "gene_name": "INHA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q7Z3T8-1", "protein_name": "Zinc finger FYVE domain-containing protein 16", "gene_name": "ZFYVE16", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15105-1", "protein_name": "SMAD family member 7", "gene_name": "SMAD7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P37023-1", "protein_name": "Activin receptor type-1-like", "gene_name": "ACVRL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16671-1", "protein_name": "Anti-Muellerian hormone type-2 receptor", "gene_name": "AMHR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15797-1", "protein_name": "SMAD family member 1", "gene_name": "SMAD1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HCE7-1", "protein_name": "E3 ubiquitin-protein ligase SMURF1", "gene_name": "SMURF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HAU4-1", "protein_name": "E3 ubiquitin-protein ligase SMURF2", "gene_name": "SMURF2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UK05-1", "protein_name": "Growth/differentiation factor 2", "gene_name": "GDF2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13705-1", "protein_name": "Activin receptor type-2B", "gene_name": "ACVR2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00238-1", "protein_name": "Bone morphogenetic protein receptor type-1B", "gene_name": "BMPR1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P12643-1", "protein_name": "Bone morphogenetic protein 2", "gene_name": "BMP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P36894-1", "protein_name": "Bone morphogenetic protein receptor type-1A", "gene_name": "BMPR1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13253-1", "protein_name": "Noggin", "gene_name": "NOG", "tax_name": "Human" }, { "uniprot_canonical_ac": "P12755-1", "protein_name": "Ski oncogene", "gene_name": "SKI", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27037-1", "protein_name": "Activin receptor type-2A", "gene_name": "ACVR2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13873-1", "protein_name": "Bone morphogenetic protein receptor type-2", "gene_name": "BMPR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q03167-1", "protein_name": "Transforming growth factor beta receptor type 3", "gene_name": "TGFBR3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H772-1", "protein_name": "Gremlin-2", "gene_name": "GREM2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P08476-1", "protein_name": "Inhibin beta A chain", "gene_name": "INHBA", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q12841", "url": "https://www.uniprot.org/uniprotkb/Q12841" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.17356069", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 31 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "DIP2A functions as a FSTL1 receptor.", "journal": "The Journal of biological chemistry", "date": "2010", "authors": "Ouchi N, Asaumi Y, Ohashi K, Higuchi A, Sono-Romanelli S, Oshima Y, Walsh K", "reference": { "type": "PubMed", "id": "20054002", "url": "https://pubmed.ncbi.nlm.nih.gov/20054002" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q12841-1", "protein_name": "Follistatin-related protein 1", "gene_name": "FSTL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14689-1", "protein_name": "Disco-interacting protein 2 homolog A", "gene_name": "DIP2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8BWT5-1", "protein_name": "Disco-interacting protein 2 homolog A", "gene_name": "Dip2a", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "Q62356-1", "protein_name": "Follistatin-related protein 1", "gene_name": "Fstl1", "tax_name": "Mouse" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q12841", "url": "https://www.uniprot.org/uniprotkb/Q12841" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.20054002", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 4 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "DIP2 disco-interacting protein 2 homolog A (Drosophila) is a candidate receptor for follistatin-related protein/follistatin-like 1--analysis of their binding with TGF-beta superfamily proteins.", "journal": "FEBS J.", "date": "2010", "authors": "Tanaka M, Murakami K, Ozaki S, Imura Y, Tong XP, Watanabe T, Sawaki T, Kawanami T, Kawabata D, Fujii T, Usui T, Masaki Y, Fukushima T, Jin ZX, Umehara H, Mimori T", "reference": { "type": "PubMed", "id": "20860622", "url": "https://pubmed.ncbi.nlm.nih.gov/20860622" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q12841-1", "protein_name": "Follistatin-related protein 1", "gene_name": "FSTL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14689-1", "protein_name": "Disco-interacting protein 2 homolog A", "gene_name": "DIP2A", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q12841", "url": "https://www.uniprot.org/uniprotkb/Q12841" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.20860622", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Follistatin-related protein/follistatin-like 1 evokes an innate immune response via CD14 and toll-like receptor 4.", "journal": "FEBS letters", "date": "2012-02-17", "authors": "Murakami Kosaku, Tanaka Masao, Usui Takashi, Kawabata Daisuke, Shiomi Aoi, Iguchi-Hashimoto Mikiko, Shimizu Masakazu, Yukawa Naoichiro, Yoshifuji Hajime, Nojima Takaki, Ohmura Koichiro, Fujii Takao, Umehara Hisanori, Mimori Tsuneyo", "reference": { "type": "PubMed", "id": "22265692", "url": "https://pubmed.ncbi.nlm.nih.gov/22265692" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q12841-1", "protein_name": "Follistatin-related protein 1", "gene_name": "FSTL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P08571-1", "protein_name": "Monocyte differentiation antigen CD14", "gene_name": "CD14", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q12841", "url": "https://www.uniprot.org/uniprotkb/Q12841" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.22265692", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Fstl1 Promotes Glioma Growth Through the BMP4/Smad1/5/8 Signaling Pathway.", "journal": "Cellular physiology and biochemistry : international journal of experimental cellular physiology, biochemistry, and pharmacology", "date": "2017", "authors": "Jin X, Nie E, Zhou X, Zeng A, Yu T, Zhi T, Jiang K, Wang Y, Zhang J, You Y", "reference": { "type": "PubMed", "id": "29212066", "url": "https://pubmed.ncbi.nlm.nih.gov/29212066" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q12841-1", "protein_name": "Follistatin-related protein 1", "gene_name": "FSTL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P12644-1", "protein_name": "Bone morphogenetic protein 4", "gene_name": "BMP4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13873-1", "protein_name": "Bone morphogenetic protein receptor type-2", "gene_name": "BMPR2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q12841", "url": "https://www.uniprot.org/uniprotkb/Q12841" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.29212066", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Analysis of the expression and mechanism of follistatin\u2011like protein 1 in cervical cancer.", "journal": "Oncology reports", "date": "2023-12", "authors": "Liu Zhen, Zhang Hong, Hu Xiaoxia", "reference": { "type": "PubMed", "id": "37888756", "url": "https://pubmed.ncbi.nlm.nih.gov/37888756" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q12841-1", "protein_name": "Follistatin-related protein 1", "gene_name": "FSTL1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q12841", "url": "https://www.uniprot.org/uniprotkb/Q12841" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.37888756", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Follistatin-like 1 is a myokine regulating lipid mobilization during endurance exercise and recovery.", "journal": "Obesity (Silver Spring, Md.)", "date": "2024-02", "authors": "Nam Ji Sun, Park Su-Jeong, Ahn Chul Woo, Cho Eun-Suk, Kim Hee-Joo, Kim YuSik", "reference": { "type": "PubMed", "id": "38018497", "url": "https://pubmed.ncbi.nlm.nih.gov/38018497" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q12841-1", "protein_name": "Follistatin-related protein 1", "gene_name": "FSTL1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q12841", "url": "https://www.uniprot.org/uniprotkb/Q12841" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.38018497", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "FSTL1: A double-edged sword in cancer development.", "journal": "Gene", "date": "2024-05-15", "authors": "Du Ruijuan, Li Kai, Guo Kelei, Chen Zhiguo, Han Li, Bian Hua", "reference": { "type": "PubMed", "id": "38346455", "url": "https://pubmed.ncbi.nlm.nih.gov/38346455" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q12841-1", "protein_name": "Follistatin-related protein 1", "gene_name": "FSTL1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q12841", "url": "https://www.uniprot.org/uniprotkb/Q12841" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.38346455", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "THOC7-AS1/OCT1/FSTL1 axis promotes EMT and serves as a therapeutic target in cutaneous squamous cell carcinoma.", "journal": "Journal of translational medicine", "date": "2024-04-11", "authors": "Yu Site, Cui Xu, Zhou Situo, Li Yun, Feng Wenjie, Zhang Xiangjun, Zhong Yuhui, Zhang Pihong", "reference": { "type": "PubMed", "id": "38605354", "url": "https://pubmed.ncbi.nlm.nih.gov/38605354" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q12841-1", "protein_name": "Follistatin-related protein 1", "gene_name": "FSTL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15245-1", "protein_name": "Solute carrier family 22 member 1", "gene_name": "SLC22A1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q12841", "url": "https://www.uniprot.org/uniprotkb/Q12841" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.38605354", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "A site-specific phosphorylation in FSTL1 determines its promigratory role in wound healing.", "journal": "Biochimie", "date": "2024-10", "authors": "Suresh Anagha Priya, Vijayarengan Monisha, Aggarwal Pooja, Soundaram Rajendran, Gnanesh Kumar B S, Sundaram Gopinath M", "reference": { "type": "PubMed", "id": "38768802", "url": "https://pubmed.ncbi.nlm.nih.gov/38768802" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q12841-1", "protein_name": "Follistatin-related protein 1", "gene_name": "FSTL1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q12841", "url": "https://www.uniprot.org/uniprotkb/Q12841" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "glycosylation": [ { "glytoucan_ac": "", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true, "automatic_literature_mining": true }, "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "icn3d_view": {}, "start_pos": 144, "start_aa": "Asn", "end_pos": 144, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn144", "evidence": [ { "id": "Q12841", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/Q12841#ptm_processing" }, { "id": "23090970", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23090970" }, { "id": "GLY_000143", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000143" }, { "id": "24190977", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24190977" }, { "id": "38768802", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/38768802" }, { "id": "GLY_000481", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000481" } ], "mining_tool": "GlycoSiteMiner_1.0", "mining_tool_list": [ { "label": "GlycoSiteMiner_1.0" } ], "filter_code": "001000000000000000000.00010000000000.00.01001", "uniprot_canonical_ac": "Q12841-1" }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true, "automatic_literature_mining": true }, "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "icn3d_view": {}, "start_pos": 175, "start_aa": "Asn", "end_pos": 175, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn175", "evidence": [ { "id": "Q12841", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/Q12841#ptm_processing" }, { "id": "16335952", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/16335952" }, { "id": "38768802", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/38768802" }, { "id": "GLY_000481", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000481" } ], "mining_tool": "GlycoSiteMiner_1.0", "mining_tool_list": [ { "label": "GlycoSiteMiner_1.0" } ], "filter_code": "001000000000000000000.00010000000000.00.01001", "uniprot_canonical_ac": "Q12841-1" }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true, "automatic_literature_mining": true }, "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "icn3d_view": {}, "start_pos": 180, "start_aa": "Asn", "end_pos": 180, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn180", "evidence": [ { "id": "Q12841", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/Q12841#ptm_processing" }, { "id": "16335952", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/16335952" }, { "id": "38768802", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/38768802" }, { "id": "GLY_000481", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000481" } ], "mining_tool": "GlycoSiteMiner_1.0", "mining_tool_list": [ { "label": "GlycoSiteMiner_1.0" } ], "filter_code": "001000000000000000000.00010000000000.00.01001", "uniprot_canonical_ac": "Q12841-1" } ], "record_id": "pubmed.38768802", "abstract": "", "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 3 }, { "field": "total_sites", "count": 3 }, { "field": "n_linked_sites", "count": 3 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "exact_sites", "count": 3 }, { "field": "exact_n_linked_sites", "count": 3 }, { "field": "fuzzy_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl", "mining_tool", "filter_code", "uniprot_canonical_ac" ] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 3 }, { "field": "total_sites", "count": 3 }, { "field": "n_linked_sites", "count": 3 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "exact_sites", "count": 3 }, { "field": "exact_n_linked_sites", "count": 3 }, { "field": "fuzzy_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl", "mining_tool", "filter_code", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 3 }, { "field": "total_sites", "count": 3 }, { "field": "n_linked_sites", "count": 3 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "exact_sites", "count": 3 }, { "field": "exact_n_linked_sites", "count": 3 }, { "field": "fuzzy_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl", "mining_tool", "filter_code", "uniprot_canonical_ac" ] } ] }, { "title": "Cloning and characterization of a human type II receptor for bone morphogenetic proteins.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1995", "authors": "Rosenzweig BL, Imamura T, Okadome T, Cox GN, Yamashita H, ten Dijke P, Heldin CH, Miyazono K", "reference": { "type": "PubMed", "id": "7644468", "url": "https://pubmed.ncbi.nlm.nih.gov/7644468" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q12841-1", "protein_name": "Follistatin-related protein 1", "gene_name": "FSTL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15198-1", "protein_name": "SMAD family member 9", "gene_name": "SMAD9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13485-1", "protein_name": "SMAD family member 4", "gene_name": "SMAD4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P03971-1", "protein_name": "Anti-Muellerian hormone", "gene_name": "AMH", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43541-1", "protein_name": "SMAD family member 6", "gene_name": "SMAD6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99717-1", "protein_name": "SMAD family member 5", "gene_name": "SMAD5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61077-1", "protein_name": "Ubiquitin-conjugating enzyme E2 D3", "gene_name": "UBE2D3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51668-1", "protein_name": "Ubiquitin-conjugating enzyme E2 D1", "gene_name": "UBE2D1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95393-1", "protein_name": "Bone morphogenetic protein 10", "gene_name": "BMP10", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95813-1", "protein_name": "Cerberus", "gene_name": "CER1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BU40-6", "protein_name": "Chordin-like protein 1", "gene_name": "CHRDL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05111-1", "protein_name": "Inhibin alpha chain", "gene_name": "INHA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q7Z3T8-1", "protein_name": "Zinc finger FYVE domain-containing protein 16", "gene_name": "ZFYVE16", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15105-1", "protein_name": "SMAD family member 7", "gene_name": "SMAD7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P37023-1", "protein_name": "Activin receptor type-1-like", "gene_name": "ACVRL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16671-1", "protein_name": "Anti-Muellerian hormone type-2 receptor", "gene_name": "AMHR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15797-1", "protein_name": "SMAD family member 1", "gene_name": "SMAD1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HCE7-1", "protein_name": "E3 ubiquitin-protein ligase SMURF1", "gene_name": "SMURF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HAU4-1", "protein_name": "E3 ubiquitin-protein ligase SMURF2", "gene_name": "SMURF2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UK05-1", "protein_name": "Growth/differentiation factor 2", "gene_name": "GDF2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13705-1", "protein_name": "Activin receptor type-2B", "gene_name": "ACVR2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00238-1", "protein_name": "Bone morphogenetic protein receptor type-1B", "gene_name": "BMPR1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P12643-1", "protein_name": "Bone morphogenetic protein 2", "gene_name": "BMP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P36894-1", "protein_name": "Bone morphogenetic protein receptor type-1A", "gene_name": "BMPR1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13253-1", "protein_name": "Noggin", "gene_name": "NOG", "tax_name": "Human" }, { "uniprot_canonical_ac": "P12755-1", "protein_name": "Ski oncogene", "gene_name": "SKI", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27037-1", "protein_name": "Activin receptor type-2A", "gene_name": "ACVR2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13873-1", "protein_name": "Bone morphogenetic protein receptor type-2", "gene_name": "BMPR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q03167-1", "protein_name": "Transforming growth factor beta receptor type 3", "gene_name": "TGFBR3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H772-1", "protein_name": "Gremlin-2", "gene_name": "GREM2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P08476-1", "protein_name": "Inhibin beta A chain", "gene_name": "INHBA", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q12841", "url": "https://www.uniprot.org/uniprotkb/Q12841" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.7644468", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 31 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Human type II receptor for bone morphogenic proteins (BMPs): extension of the two-kinase receptor model to the BMPs.", "journal": "Molecular and cellular biology", "date": "1995", "authors": "Liu F, Ventura F, Doody J, Massague J", "reference": { "type": "PubMed", "id": "7791754", "url": "https://pubmed.ncbi.nlm.nih.gov/7791754" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q12841-1", "protein_name": "Follistatin-related protein 1", "gene_name": "FSTL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15198-1", "protein_name": "SMAD family member 9", "gene_name": "SMAD9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13485-1", "protein_name": "SMAD family member 4", "gene_name": "SMAD4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P03971-1", "protein_name": "Anti-Muellerian hormone", "gene_name": "AMH", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43541-1", "protein_name": "SMAD family member 6", "gene_name": "SMAD6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99717-1", "protein_name": "SMAD family member 5", "gene_name": "SMAD5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61077-1", "protein_name": "Ubiquitin-conjugating enzyme E2 D3", "gene_name": "UBE2D3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51668-1", "protein_name": "Ubiquitin-conjugating enzyme E2 D1", "gene_name": "UBE2D1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95393-1", "protein_name": "Bone morphogenetic protein 10", "gene_name": "BMP10", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95813-1", "protein_name": "Cerberus", "gene_name": "CER1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BU40-6", "protein_name": "Chordin-like protein 1", "gene_name": "CHRDL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05111-1", "protein_name": "Inhibin alpha chain", "gene_name": "INHA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q7Z3T8-1", "protein_name": "Zinc finger FYVE domain-containing protein 16", "gene_name": "ZFYVE16", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15105-1", "protein_name": "SMAD family member 7", "gene_name": "SMAD7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P37023-1", "protein_name": "Activin receptor type-1-like", "gene_name": "ACVRL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16671-1", "protein_name": "Anti-Muellerian hormone type-2 receptor", "gene_name": "AMHR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15797-1", "protein_name": "SMAD family member 1", "gene_name": "SMAD1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HCE7-1", "protein_name": "E3 ubiquitin-protein ligase SMURF1", "gene_name": "SMURF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HAU4-1", "protein_name": "E3 ubiquitin-protein ligase SMURF2", "gene_name": "SMURF2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UK05-1", "protein_name": "Growth/differentiation factor 2", "gene_name": "GDF2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13705-1", "protein_name": "Activin receptor type-2B", "gene_name": "ACVR2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00238-1", "protein_name": "Bone morphogenetic protein receptor type-1B", "gene_name": "BMPR1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P12643-1", "protein_name": "Bone morphogenetic protein 2", "gene_name": "BMP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P36894-1", "protein_name": "Bone morphogenetic protein receptor type-1A", "gene_name": "BMPR1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13253-1", "protein_name": "Noggin", "gene_name": "NOG", "tax_name": "Human" }, { "uniprot_canonical_ac": "P12755-1", "protein_name": "Ski oncogene", "gene_name": "SKI", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27037-1", "protein_name": "Activin receptor type-2A", "gene_name": "ACVR2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13873-1", "protein_name": "Bone morphogenetic protein receptor type-2", "gene_name": "BMPR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q03167-1", "protein_name": "Transforming growth factor beta receptor type 3", "gene_name": "TGFBR3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H772-1", "protein_name": "Gremlin-2", "gene_name": "GREM2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P08476-1", "protein_name": "Inhibin beta A chain", "gene_name": "INHBA", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q12841", "url": "https://www.uniprot.org/uniprotkb/Q12841" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.7791754", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 31 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Characterization of a rat C6 glioma-secreted follistatin-related protein (FRP). Cloning and sequence of the human homologue.", "journal": "Eur. J. Biochem.", "date": "1994", "authors": "Zwijsen A, Blockx H, Van Arnhem W, Willems J, Fransen L, Devos K, Raymackers J, Van de Voorde A, Slegers H", "reference": { "type": "PubMed", "id": "7957230", "url": "https://pubmed.ncbi.nlm.nih.gov/7957230" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q12841-1", "protein_name": "Follistatin-related protein 1", "gene_name": "FSTL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q62632-1", "protein_name": "Follistatin-related protein 1", "gene_name": "Fstl1", "tax_name": "Rat" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q12841", "url": "https://www.uniprot.org/uniprotkb/Q12841" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.7957230", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "A novel member of the transmembrane serine/threonine kinase receptor family is specifically expressed in the gonads and in mesenchymal cells adjacent to the mullerian duct.", "journal": "Development (Cambridge, England)", "date": "1994", "authors": "Baarends WM, van Helmond MJ, Post M, van der Schoot PJ, Hoogerbrugge JW, de Winter JP, Uilenbroek JT, Karels B, Wilming LG, Meijers JH, et al.", "reference": { "type": "PubMed", "id": "8119126", "url": "https://pubmed.ncbi.nlm.nih.gov/8119126" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q12841-1", "protein_name": "Follistatin-related protein 1", "gene_name": "FSTL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15198-1", "protein_name": "SMAD family member 9", "gene_name": "SMAD9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13485-1", "protein_name": "SMAD family member 4", "gene_name": "SMAD4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P03971-1", "protein_name": "Anti-Muellerian hormone", "gene_name": "AMH", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43541-1", "protein_name": "SMAD family member 6", "gene_name": "SMAD6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q62893-1", "protein_name": "Anti-Muellerian hormone type-2 receptor", "gene_name": "Amhr2", "tax_name": "Rat" }, { "uniprot_canonical_ac": "Q99717-1", "protein_name": "SMAD family member 5", "gene_name": "SMAD5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61077-1", "protein_name": "Ubiquitin-conjugating enzyme E2 D3", "gene_name": "UBE2D3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51668-1", "protein_name": "Ubiquitin-conjugating enzyme E2 D1", "gene_name": "UBE2D1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95393-1", "protein_name": "Bone morphogenetic protein 10", "gene_name": "BMP10", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95813-1", "protein_name": "Cerberus", "gene_name": "CER1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BU40-6", "protein_name": "Chordin-like protein 1", "gene_name": "CHRDL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05111-1", "protein_name": "Inhibin alpha chain", "gene_name": "INHA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q7Z3T8-1", "protein_name": "Zinc finger FYVE domain-containing protein 16", "gene_name": "ZFYVE16", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15105-1", "protein_name": "SMAD family member 7", "gene_name": "SMAD7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P37023-1", "protein_name": "Activin receptor type-1-like", "gene_name": "ACVRL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16671-1", "protein_name": "Anti-Muellerian hormone type-2 receptor", "gene_name": "AMHR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15797-1", "protein_name": "SMAD family member 1", "gene_name": "SMAD1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HCE7-1", "protein_name": "E3 ubiquitin-protein ligase SMURF1", "gene_name": "SMURF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HAU4-1", "protein_name": "E3 ubiquitin-protein ligase SMURF2", "gene_name": "SMURF2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UK05-1", "protein_name": "Growth/differentiation factor 2", "gene_name": "GDF2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13705-1", "protein_name": "Activin receptor type-2B", "gene_name": "ACVR2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00238-1", "protein_name": "Bone morphogenetic protein receptor type-1B", "gene_name": "BMPR1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P12643-1", "protein_name": "Bone morphogenetic protein 2", "gene_name": "BMP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P36894-1", "protein_name": "Bone morphogenetic protein receptor type-1A", "gene_name": "BMPR1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13253-1", "protein_name": "Noggin", "gene_name": "NOG", "tax_name": "Human" }, { "uniprot_canonical_ac": "P12755-1", "protein_name": "Ski oncogene", "gene_name": "SKI", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27037-1", "protein_name": "Activin receptor type-2A", "gene_name": "ACVR2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13873-1", "protein_name": "Bone morphogenetic protein receptor type-2", "gene_name": "BMPR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q03167-1", "protein_name": "Transforming growth factor beta receptor type 3", "gene_name": "TGFBR3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H772-1", "protein_name": "Gremlin-2", "gene_name": "GREM2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P08476-1", "protein_name": "Inhibin beta A chain", "gene_name": "INHBA", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q12841", "url": "https://www.uniprot.org/uniprotkb/Q12841" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.8119126", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 32 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "MADR1, a MAD-related protein that functions in BMP2 signaling pathways.", "journal": "Cell", "date": "1996", "authors": "Hoodless PA, Haerry T, Abdollah S, Stapleton M, O'Connor MB, Attisano L, Wrana JL", "reference": { "type": "PubMed", "id": "8653785", "url": "https://pubmed.ncbi.nlm.nih.gov/8653785" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q12841-1", "protein_name": "Follistatin-related protein 1", "gene_name": "FSTL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15198-1", "protein_name": "SMAD family member 9", "gene_name": "SMAD9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13485-1", "protein_name": "SMAD family member 4", "gene_name": "SMAD4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P03971-1", "protein_name": "Anti-Muellerian hormone", "gene_name": "AMH", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43541-1", "protein_name": "SMAD family member 6", "gene_name": "SMAD6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99717-1", "protein_name": "SMAD family member 5", "gene_name": "SMAD5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61077-1", "protein_name": "Ubiquitin-conjugating enzyme E2 D3", "gene_name": "UBE2D3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51668-1", "protein_name": "Ubiquitin-conjugating enzyme E2 D1", "gene_name": "UBE2D1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95393-1", "protein_name": "Bone morphogenetic protein 10", "gene_name": "BMP10", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95813-1", "protein_name": "Cerberus", "gene_name": "CER1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BU40-6", "protein_name": "Chordin-like protein 1", "gene_name": "CHRDL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05111-1", "protein_name": "Inhibin alpha chain", "gene_name": "INHA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q7Z3T8-1", "protein_name": "Zinc finger FYVE domain-containing protein 16", "gene_name": "ZFYVE16", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15105-1", "protein_name": "SMAD family member 7", "gene_name": "SMAD7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P37023-1", "protein_name": "Activin receptor type-1-like", "gene_name": "ACVRL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16671-1", "protein_name": "Anti-Muellerian hormone type-2 receptor", "gene_name": "AMHR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15797-1", "protein_name": "SMAD family member 1", "gene_name": "SMAD1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HCE7-1", "protein_name": "E3 ubiquitin-protein ligase SMURF1", "gene_name": "SMURF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HAU4-1", "protein_name": "E3 ubiquitin-protein ligase SMURF2", "gene_name": "SMURF2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UK05-1", "protein_name": "Growth/differentiation factor 2", "gene_name": "GDF2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13705-1", "protein_name": "Activin receptor type-2B", "gene_name": "ACVR2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00238-1", "protein_name": "Bone morphogenetic protein receptor type-1B", "gene_name": "BMPR1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P12643-1", "protein_name": "Bone morphogenetic protein 2", "gene_name": "BMP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P36894-1", "protein_name": "Bone morphogenetic protein receptor type-1A", "gene_name": "BMPR1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13253-1", "protein_name": "Noggin", "gene_name": "NOG", "tax_name": "Human" }, { "uniprot_canonical_ac": "P12755-1", "protein_name": "Ski oncogene", "gene_name": "SKI", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27037-1", "protein_name": "Activin receptor type-2A", "gene_name": "ACVR2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13873-1", "protein_name": "Bone morphogenetic protein receptor type-2", "gene_name": "BMPR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q03167-1", "protein_name": "Transforming growth factor beta receptor type 3", "gene_name": "TGFBR3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H772-1", "protein_name": "Gremlin-2", "gene_name": "GREM2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P08476-1", "protein_name": "Inhibin beta A chain", "gene_name": "INHBA", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q12841", "url": "https://www.uniprot.org/uniprotkb/Q12841" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 419, "end_pos": 419, "sequence_org": "G", "sequence_mut": "S", "comment": "Loss of phosphorylation.", "evidence": [ { "database": "UniProtKB", "id": "Q15797", "url": "https://www.uniprot.org/uniprotkb/Q15797" }, { "database": "PubMed", "id": "8653785", "url": "https://pubmed.ncbi.nlm.nih.gov/8653785" } ], "uniprot_canonical_ac": "Q15797-1" } ], "record_id": "pubmed.8653785", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 31 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Partnership between DPC4 and SMAD proteins in TGF-beta signalling pathways.", "journal": "Nature", "date": "1996", "authors": "Lagna G, Hata A, Hemmati-Brivanlou A, Massague J", "reference": { "type": "PubMed", "id": "8893010", "url": "https://pubmed.ncbi.nlm.nih.gov/8893010" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q12841-1", "protein_name": "Follistatin-related protein 1", "gene_name": "FSTL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15198-1", "protein_name": "SMAD family member 9", "gene_name": "SMAD9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13485-1", "protein_name": "SMAD family member 4", "gene_name": "SMAD4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P03971-1", "protein_name": "Anti-Muellerian hormone", "gene_name": "AMH", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43541-1", "protein_name": "SMAD family member 6", "gene_name": "SMAD6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99717-1", "protein_name": "SMAD family member 5", "gene_name": "SMAD5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61077-1", "protein_name": "Ubiquitin-conjugating enzyme E2 D3", "gene_name": "UBE2D3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51668-1", "protein_name": "Ubiquitin-conjugating enzyme E2 D1", "gene_name": "UBE2D1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95393-1", "protein_name": "Bone morphogenetic protein 10", "gene_name": "BMP10", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95813-1", "protein_name": "Cerberus", "gene_name": "CER1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BU40-6", "protein_name": "Chordin-like protein 1", "gene_name": "CHRDL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05111-1", "protein_name": "Inhibin alpha chain", "gene_name": "INHA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q7Z3T8-1", "protein_name": "Zinc finger FYVE domain-containing protein 16", "gene_name": "ZFYVE16", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15105-1", "protein_name": "SMAD family member 7", "gene_name": "SMAD7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P37023-1", "protein_name": "Activin receptor type-1-like", "gene_name": "ACVRL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16671-1", "protein_name": "Anti-Muellerian hormone type-2 receptor", "gene_name": "AMHR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15797-1", "protein_name": "SMAD family member 1", "gene_name": "SMAD1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HCE7-1", "protein_name": "E3 ubiquitin-protein ligase SMURF1", "gene_name": "SMURF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HAU4-1", "protein_name": "E3 ubiquitin-protein ligase SMURF2", "gene_name": "SMURF2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UK05-1", "protein_name": "Growth/differentiation factor 2", "gene_name": "GDF2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13705-1", "protein_name": "Activin receptor type-2B", "gene_name": "ACVR2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00238-1", "protein_name": "Bone morphogenetic protein receptor type-1B", "gene_name": "BMPR1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P12643-1", "protein_name": "Bone morphogenetic protein 2", "gene_name": "BMP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P36894-1", "protein_name": "Bone morphogenetic protein receptor type-1A", "gene_name": "BMPR1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13253-1", "protein_name": "Noggin", "gene_name": "NOG", "tax_name": "Human" }, { "uniprot_canonical_ac": "P12755-1", "protein_name": "Ski oncogene", "gene_name": "SKI", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27037-1", "protein_name": "Activin receptor type-2A", "gene_name": "ACVR2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13873-1", "protein_name": "Bone morphogenetic protein receptor type-2", "gene_name": "BMPR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q03167-1", "protein_name": "Transforming growth factor beta receptor type 3", "gene_name": "TGFBR3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H772-1", "protein_name": "Gremlin-2", "gene_name": "GREM2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P08476-1", "protein_name": "Inhibin beta A chain", "gene_name": "INHBA", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q12841", "url": "https://www.uniprot.org/uniprotkb/Q12841" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.8893010", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 31 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The TGF-beta family mediator Smad1 is phosphorylated directly and activated functionally by the BMP receptor kinase.", "journal": "Genes & development", "date": "1997", "authors": "Kretzschmar M, Liu F, Hata A, Doody J, Massague J", "reference": { "type": "PubMed", "id": "9136927", "url": "https://pubmed.ncbi.nlm.nih.gov/9136927" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q12841-1", "protein_name": "Follistatin-related protein 1", "gene_name": "FSTL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15198-1", "protein_name": "SMAD family member 9", "gene_name": "SMAD9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13485-1", "protein_name": "SMAD family member 4", "gene_name": "SMAD4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15796-1", "protein_name": "SMAD family member 2", "gene_name": "SMAD2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P03971-1", "protein_name": "Anti-Muellerian hormone", "gene_name": "AMH", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43541-1", "protein_name": "SMAD family member 6", "gene_name": "SMAD6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99717-1", "protein_name": "SMAD family member 5", "gene_name": "SMAD5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61077-1", "protein_name": "Ubiquitin-conjugating enzyme E2 D3", "gene_name": "UBE2D3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51668-1", "protein_name": "Ubiquitin-conjugating enzyme E2 D1", "gene_name": "UBE2D1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95393-1", "protein_name": "Bone morphogenetic protein 10", "gene_name": "BMP10", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95813-1", "protein_name": "Cerberus", "gene_name": "CER1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BU40-6", "protein_name": "Chordin-like protein 1", "gene_name": "CHRDL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05111-1", "protein_name": "Inhibin alpha chain", "gene_name": "INHA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q7Z3T8-1", "protein_name": "Zinc finger FYVE domain-containing protein 16", "gene_name": "ZFYVE16", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15105-1", "protein_name": "SMAD family member 7", "gene_name": "SMAD7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P37023-1", "protein_name": "Activin receptor type-1-like", "gene_name": "ACVRL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16671-1", "protein_name": "Anti-Muellerian hormone type-2 receptor", "gene_name": "AMHR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15797-1", "protein_name": "SMAD family member 1", "gene_name": "SMAD1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HCE7-1", "protein_name": "E3 ubiquitin-protein ligase SMURF1", "gene_name": "SMURF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HAU4-1", "protein_name": "E3 ubiquitin-protein ligase SMURF2", "gene_name": "SMURF2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UK05-1", "protein_name": "Growth/differentiation factor 2", "gene_name": "GDF2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13705-1", "protein_name": "Activin receptor type-2B", "gene_name": "ACVR2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00238-1", "protein_name": "Bone morphogenetic protein receptor type-1B", "gene_name": "BMPR1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P12643-1", "protein_name": "Bone morphogenetic protein 2", "gene_name": "BMP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P36894-1", "protein_name": "Bone morphogenetic protein receptor type-1A", "gene_name": "BMPR1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13253-1", "protein_name": "Noggin", "gene_name": "NOG", "tax_name": "Human" }, { "uniprot_canonical_ac": "P12755-1", "protein_name": "Ski oncogene", "gene_name": "SKI", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27037-1", "protein_name": "Activin receptor type-2A", "gene_name": "ACVR2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13873-1", "protein_name": "Bone morphogenetic protein receptor type-2", "gene_name": "BMPR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q03167-1", "protein_name": "Transforming growth factor beta receptor type 3", "gene_name": "TGFBR3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H772-1", "protein_name": "Gremlin-2", "gene_name": "GREM2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P08476-1", "protein_name": "Inhibin beta A chain", "gene_name": "INHBA", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q12841", "url": "https://www.uniprot.org/uniprotkb/Q12841" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 465, "end_pos": 465, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by TGFBR1", "evidence": [ { "database": "UniProtKB", "id": "Q15796", "url": "https://www.uniprot.org/uniprotkb/Q15796" }, { "database": "PRO", "id": "Q15796", "url": "https://proconsortium.org/cgi-bin/entry_pro?id=Q15796" }, { "database": "iPTMnet", "id": "Q15796", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q15796" }, { "database": "PubMed", "id": "17074756", "url": "https://pubmed.ncbi.nlm.nih.gov/17074756" }, { "database": "PubMed", "id": "11027280", "url": "https://pubmed.ncbi.nlm.nih.gov/11027280" }, { "database": "PubMed", "id": "12193595", "url": "https://pubmed.ncbi.nlm.nih.gov/12193595" }, { "database": "PubMed", "id": "8980228", "url": "https://pubmed.ncbi.nlm.nih.gov/8980228" }, { "database": "PubMed", "id": "9346966", "url": "https://pubmed.ncbi.nlm.nih.gov/9346966" }, { "database": "PubMed", "id": "12660320", "url": "https://pubmed.ncbi.nlm.nih.gov/12660320" }, { "database": "PubMed", "id": "15134444", "url": "https://pubmed.ncbi.nlm.nih.gov/15134444" }, { "database": "PubMed", "id": "17099224", "url": "https://pubmed.ncbi.nlm.nih.gov/17099224" }, { "database": "PubMed", "id": "18032924", "url": "https://pubmed.ncbi.nlm.nih.gov/18032924" }, { "database": "PubMed", "id": "20717921", "url": "https://pubmed.ncbi.nlm.nih.gov/20717921" }, { "database": "PubMed", "id": "22880011", "url": "https://pubmed.ncbi.nlm.nih.gov/22880011" }, { "database": "PubMed", "id": "23937725", "url": "https://pubmed.ncbi.nlm.nih.gov/23937725" }, { "database": "PubMed", "id": "24759784", "url": "https://pubmed.ncbi.nlm.nih.gov/24759784" }, { "database": "PubMed", "id": "26057631", "url": "https://pubmed.ncbi.nlm.nih.gov/26057631" }, { "database": "PubMed", "id": "30072727", "url": "https://pubmed.ncbi.nlm.nih.gov/30072727" }, { "database": "PubMed", "id": "30135653", "url": "https://pubmed.ncbi.nlm.nih.gov/30135653" }, { "database": "PubMed", "id": "30805303", "url": "https://pubmed.ncbi.nlm.nih.gov/30805303" }, { "database": "PubMed", "id": "31817988", "url": "https://pubmed.ncbi.nlm.nih.gov/31817988" }, { "database": "PubMed", "id": "33406242", "url": "https://pubmed.ncbi.nlm.nih.gov/33406242" }, { "database": "PubMed", "id": "9346908", "url": "https://pubmed.ncbi.nlm.nih.gov/9346908" }, { "database": "PubMed", "id": "9136927", "url": "https://pubmed.ncbi.nlm.nih.gov/9136927" }, { "database": "PubMed", "id": "23478445", "url": "https://pubmed.ncbi.nlm.nih.gov/23478445" } ], "site_lbl": "Ser465", "uniprot_canonical_ac": "Q15796-1" }, { "start_pos": 467, "end_pos": 467, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by TGFBR1", "evidence": [ { "database": "UniProtKB", "id": "Q15796", "url": "https://www.uniprot.org/uniprotkb/Q15796" }, { "database": "PRO", "id": "Q15796", "url": "https://proconsortium.org/cgi-bin/entry_pro?id=Q15796" }, { "database": "iPTMnet", "id": "Q15796", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q15796" }, { "database": "PubMed", "id": "17074756", "url": "https://pubmed.ncbi.nlm.nih.gov/17074756" }, { "database": "PubMed", "id": "11027280", "url": "https://pubmed.ncbi.nlm.nih.gov/11027280" }, { "database": "PubMed", "id": "12193595", "url": "https://pubmed.ncbi.nlm.nih.gov/12193595" }, { "database": "PubMed", "id": "8980228", "url": "https://pubmed.ncbi.nlm.nih.gov/8980228" }, { "database": "PubMed", "id": "9346966", "url": "https://pubmed.ncbi.nlm.nih.gov/9346966" }, { "database": "PubMed", "id": "12660320", "url": "https://pubmed.ncbi.nlm.nih.gov/12660320" }, { "database": "PubMed", "id": "15134444", "url": "https://pubmed.ncbi.nlm.nih.gov/15134444" }, { "database": "PubMed", "id": "17099224", "url": "https://pubmed.ncbi.nlm.nih.gov/17099224" }, { "database": "PubMed", "id": "18032924", "url": "https://pubmed.ncbi.nlm.nih.gov/18032924" }, { "database": "PubMed", "id": "20717921", "url": "https://pubmed.ncbi.nlm.nih.gov/20717921" }, { "database": "PubMed", "id": "22880011", "url": "https://pubmed.ncbi.nlm.nih.gov/22880011" }, { "database": "PubMed", "id": "23934187", "url": "https://pubmed.ncbi.nlm.nih.gov/23934187" }, { "database": "PubMed", "id": "23937725", "url": "https://pubmed.ncbi.nlm.nih.gov/23937725" }, { "database": "PubMed", "id": "24759784", "url": "https://pubmed.ncbi.nlm.nih.gov/24759784" }, { "database": "PubMed", "id": "26057631", "url": "https://pubmed.ncbi.nlm.nih.gov/26057631" }, { "database": "PubMed", "id": "30072727", "url": "https://pubmed.ncbi.nlm.nih.gov/30072727" }, { "database": "PubMed", "id": "30135653", "url": "https://pubmed.ncbi.nlm.nih.gov/30135653" }, { "database": "PubMed", "id": "30805303", "url": "https://pubmed.ncbi.nlm.nih.gov/30805303" }, { "database": "PubMed", "id": "31817988", "url": "https://pubmed.ncbi.nlm.nih.gov/31817988" }, { "database": "PubMed", "id": "33406242", "url": "https://pubmed.ncbi.nlm.nih.gov/33406242" }, { "database": "PubMed", "id": "9346908", "url": "https://pubmed.ncbi.nlm.nih.gov/9346908" }, { "database": "PubMed", "id": "9136927", "url": "https://pubmed.ncbi.nlm.nih.gov/9136927" }, { "database": "PubMed", "id": "23478445", "url": "https://pubmed.ncbi.nlm.nih.gov/23478445" } ], "site_lbl": "Ser467", "uniprot_canonical_ac": "Q15796-1" }, { "start_pos": 462, "end_pos": 462, "kinase_uniprot_canonical_ac": "P36897-1", "kinase_gene_name": "TGFBR1", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q15797", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q15797" }, { "database": "PubMed", "id": "10085121", "url": "https://pubmed.ncbi.nlm.nih.gov/10085121" }, { "database": "PubMed", "id": "9136927", "url": "https://pubmed.ncbi.nlm.nih.gov/9136927" }, { "database": "PubMed", "id": "9748228", "url": "https://pubmed.ncbi.nlm.nih.gov/9748228" } ], "site_lbl": "Ser462", "uniprot_canonical_ac": "Q15797-1" }, { "start_pos": 462, "end_pos": 462, "kinase_uniprot_canonical_ac": "Q04771-1", "kinase_gene_name": "ACVR1", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q15797", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q15797" }, { "database": "PubMed", "id": "10085121", "url": "https://pubmed.ncbi.nlm.nih.gov/10085121" }, { "database": "PubMed", "id": "9136927", "url": "https://pubmed.ncbi.nlm.nih.gov/9136927" }, { "database": "PubMed", "id": "9748228", "url": "https://pubmed.ncbi.nlm.nih.gov/9748228" } ], "site_lbl": "Ser462", "uniprot_canonical_ac": "Q15797-1" }, { "start_pos": 463, "end_pos": 463, "kinase_uniprot_canonical_ac": "P36894-1", "kinase_gene_name": "BMPR1A", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q15797", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q15797" }, { "database": "PubMed", "id": "9136927", "url": "https://pubmed.ncbi.nlm.nih.gov/9136927" } ], "site_lbl": "Ser463", "uniprot_canonical_ac": "Q15797-1" }, { "start_pos": 463, "end_pos": 463, "kinase_uniprot_canonical_ac": "P36897-1", "kinase_gene_name": "TGFBR1", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q15797", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q15797" }, { "database": "PubMed", "id": "10085121", "url": "https://pubmed.ncbi.nlm.nih.gov/10085121" }, { "database": "PubMed", "id": "19651622", "url": "https://pubmed.ncbi.nlm.nih.gov/19651622" }, { "database": "PubMed", "id": "9136927", "url": "https://pubmed.ncbi.nlm.nih.gov/9136927" }, { "database": "PubMed", "id": "9748228", "url": "https://pubmed.ncbi.nlm.nih.gov/9748228" } ], "site_lbl": "Ser463", "uniprot_canonical_ac": "Q15797-1" }, { "start_pos": 463, "end_pos": 463, "kinase_uniprot_canonical_ac": "Q04771-1", "kinase_gene_name": "ACVR1", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q15797", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q15797" }, { "database": "PubMed", "id": "10085121", "url": "https://pubmed.ncbi.nlm.nih.gov/10085121" }, { "database": "PubMed", "id": "19651622", "url": "https://pubmed.ncbi.nlm.nih.gov/19651622" }, { "database": "PubMed", "id": "9136927", "url": "https://pubmed.ncbi.nlm.nih.gov/9136927" }, { "database": "PubMed", "id": "9748228", "url": "https://pubmed.ncbi.nlm.nih.gov/9748228" } ], "site_lbl": "Ser463", "uniprot_canonical_ac": "Q15797-1" }, { "start_pos": 463, "end_pos": 463, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "Q15797", "url": "https://www.uniprot.org/uniprotkb/Q15797" }, { "database": "PubMed", "id": "11779505", "url": "https://pubmed.ncbi.nlm.nih.gov/11779505" }, { "database": "PubMed", "id": "9136927", "url": "https://pubmed.ncbi.nlm.nih.gov/9136927" }, { "database": "iPTMnet", "id": "Q15797", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q15797" }, { "database": "PubMed", "id": "19651622", "url": "https://pubmed.ncbi.nlm.nih.gov/19651622" }, { "database": "PRO", "id": "Q15797", "url": "https://proconsortium.org/cgi-bin/entry_pro?id=Q15797" }, { "database": "PubMed", "id": "12857866", "url": "https://pubmed.ncbi.nlm.nih.gov/12857866" }, { "database": "PubMed", "id": "28542453", "url": "https://pubmed.ncbi.nlm.nih.gov/28542453" }, { "database": "PubMed", "id": "30674353", "url": "https://pubmed.ncbi.nlm.nih.gov/30674353" }, { "database": "PubMed", "id": "30854241", "url": "https://pubmed.ncbi.nlm.nih.gov/30854241" } ], "site_lbl": "Ser463", "uniprot_canonical_ac": "Q15797-1" }, { "start_pos": 465, "end_pos": 465, "kinase_uniprot_canonical_ac": "P36894-1", "kinase_gene_name": "BMPR1A", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q15797", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q15797" }, { "database": "PubMed", "id": "9136927", "url": "https://pubmed.ncbi.nlm.nih.gov/9136927" } ], "site_lbl": "Ser465", "uniprot_canonical_ac": "Q15797-1" }, { "start_pos": 465, "end_pos": 465, "kinase_uniprot_canonical_ac": "P36897-1", "kinase_gene_name": "TGFBR1", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q15797", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q15797" }, { "database": "PubMed", "id": "10085121", "url": "https://pubmed.ncbi.nlm.nih.gov/10085121" }, { "database": "PubMed", "id": "19651622", "url": "https://pubmed.ncbi.nlm.nih.gov/19651622" }, { "database": "PubMed", "id": "9136927", "url": "https://pubmed.ncbi.nlm.nih.gov/9136927" }, { "database": "PubMed", "id": "9748228", "url": "https://pubmed.ncbi.nlm.nih.gov/9748228" } ], "site_lbl": "Ser465", "uniprot_canonical_ac": "Q15797-1" }, { "start_pos": 465, "end_pos": 465, "kinase_uniprot_canonical_ac": "Q04771-1", "kinase_gene_name": "ACVR1", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q15797", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q15797" }, { "database": "PubMed", "id": "10085121", "url": "https://pubmed.ncbi.nlm.nih.gov/10085121" }, { "database": "PubMed", "id": "19651622", "url": "https://pubmed.ncbi.nlm.nih.gov/19651622" }, { "database": "PubMed", "id": "9136927", "url": "https://pubmed.ncbi.nlm.nih.gov/9136927" }, { "database": "PubMed", "id": "9748228", "url": "https://pubmed.ncbi.nlm.nih.gov/9748228" } ], "site_lbl": "Ser465", "uniprot_canonical_ac": "Q15797-1" }, { "start_pos": 465, "end_pos": 465, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "Q15797", "url": "https://www.uniprot.org/uniprotkb/Q15797" }, { "database": "PubMed", "id": "9136927", "url": "https://pubmed.ncbi.nlm.nih.gov/9136927" }, { "database": "PubMed", "id": "11779505", "url": "https://pubmed.ncbi.nlm.nih.gov/11779505" }, { "database": "iPTMnet", "id": "Q15797", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q15797" }, { "database": "PubMed", "id": "19651622", "url": "https://pubmed.ncbi.nlm.nih.gov/19651622" }, { "database": "PRO", "id": "Q15797", "url": "https://proconsortium.org/cgi-bin/entry_pro?id=Q15797" }, { "database": "PubMed", "id": "12857866", "url": "https://pubmed.ncbi.nlm.nih.gov/12857866" }, { "database": "PubMed", "id": "28542453", "url": "https://pubmed.ncbi.nlm.nih.gov/28542453" }, { "database": "PubMed", "id": "30674353", "url": "https://pubmed.ncbi.nlm.nih.gov/30674353" }, { "database": "PubMed", "id": "30854241", "url": "https://pubmed.ncbi.nlm.nih.gov/30854241" } ], "site_lbl": "Ser465", "uniprot_canonical_ac": "Q15797-1" } ], "record_id": "pubmed.9136927", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 32 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 12 }, { "field": "total_sites", "count": 4 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Smad6 inhibits BMP/Smad1 signaling by specifically competing with the Smad4 tumor suppressor.", "journal": "Genes & development", "date": "1998", "authors": "Hata A, Lagna G, Massague J, Hemmati-Brivanlou A", "reference": { "type": "PubMed", "id": "9436979", "url": "https://pubmed.ncbi.nlm.nih.gov/9436979" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q12841-1", "protein_name": "Follistatin-related protein 1", "gene_name": "FSTL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15198-1", "protein_name": "SMAD family member 9", "gene_name": "SMAD9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13485-1", "protein_name": "SMAD family member 4", "gene_name": "SMAD4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P03971-1", "protein_name": "Anti-Muellerian hormone", "gene_name": "AMH", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43541-1", "protein_name": "SMAD family member 6", "gene_name": "SMAD6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99717-1", "protein_name": "SMAD family member 5", "gene_name": "SMAD5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61077-1", "protein_name": "Ubiquitin-conjugating enzyme E2 D3", "gene_name": "UBE2D3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51668-1", "protein_name": "Ubiquitin-conjugating enzyme E2 D1", "gene_name": "UBE2D1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95393-1", "protein_name": "Bone morphogenetic protein 10", "gene_name": "BMP10", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95813-1", "protein_name": "Cerberus", "gene_name": "CER1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BU40-6", "protein_name": "Chordin-like protein 1", "gene_name": "CHRDL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05111-1", "protein_name": "Inhibin alpha chain", "gene_name": "INHA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q7Z3T8-1", "protein_name": "Zinc finger FYVE domain-containing protein 16", "gene_name": "ZFYVE16", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15105-1", "protein_name": "SMAD family member 7", "gene_name": "SMAD7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P37023-1", "protein_name": "Activin receptor type-1-like", "gene_name": "ACVRL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16671-1", "protein_name": "Anti-Muellerian hormone type-2 receptor", "gene_name": "AMHR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15797-1", "protein_name": "SMAD family member 1", "gene_name": "SMAD1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HCE7-1", "protein_name": "E3 ubiquitin-protein ligase SMURF1", "gene_name": "SMURF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HAU4-1", "protein_name": "E3 ubiquitin-protein ligase SMURF2", "gene_name": "SMURF2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UK05-1", "protein_name": "Growth/differentiation factor 2", "gene_name": "GDF2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13705-1", "protein_name": "Activin receptor type-2B", "gene_name": "ACVR2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00238-1", "protein_name": "Bone morphogenetic protein receptor type-1B", "gene_name": "BMPR1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P12643-1", "protein_name": "Bone morphogenetic protein 2", "gene_name": "BMP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P36894-1", "protein_name": "Bone morphogenetic protein receptor type-1A", "gene_name": "BMPR1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13253-1", "protein_name": "Noggin", "gene_name": "NOG", "tax_name": "Human" }, { "uniprot_canonical_ac": "P12755-1", "protein_name": "Ski oncogene", "gene_name": "SKI", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27037-1", "protein_name": "Activin receptor type-2A", "gene_name": "ACVR2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13873-1", "protein_name": "Bone morphogenetic protein receptor type-2", "gene_name": "BMPR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q03167-1", "protein_name": "Transforming growth factor beta receptor type 3", "gene_name": "TGFBR3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H772-1", "protein_name": "Gremlin-2", "gene_name": "GREM2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P08476-1", "protein_name": "Inhibin beta A chain", "gene_name": "INHBA", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q12841", "url": "https://www.uniprot.org/uniprotkb/Q12841" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 471, "end_pos": 471, "sequence_org": "G", "sequence_mut": "S", "comment": "Loss of SMAD1-binding and of inhibition of BMP-SMAD1 signaling. No effect on interaction with BMPR1B and TGFBR1.", "evidence": [ { "database": "UniProtKB", "id": "O43541", "url": "https://www.uniprot.org/uniprotkb/O43541" }, { "database": "PubMed", "id": "9436979", "url": "https://pubmed.ncbi.nlm.nih.gov/9436979" } ], "uniprot_canonical_ac": "O43541-1" }, { "start_pos": 478, "end_pos": 496, "sequence_org": "RQFITSCPCWLEILLNNPR", "sequence_mut": "", "comment": "Loss of interaction with BMPR1B, TGFBR1 and SMAD1.", "evidence": [ { "database": "UniProtKB", "id": "O43541", "url": "https://www.uniprot.org/uniprotkb/O43541" }, { "database": "PubMed", "id": "9436979", "url": "https://pubmed.ncbi.nlm.nih.gov/9436979" } ], "uniprot_canonical_ac": "O43541-1" } ], "record_id": "pubmed.9436979", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 31 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Cloning of follistatin-related protein as a novel autoantigen in systemic rheumatic diseases.", "journal": "Int. Immunol.", "date": "1998", "authors": "Tanaka M, Ozaki S, Osakada F, Mori K, Okubo M, Nakao K", "reference": { "type": "PubMed", "id": "9786430", "url": "https://pubmed.ncbi.nlm.nih.gov/9786430" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q12841-1", "protein_name": "Follistatin-related protein 1", "gene_name": "FSTL1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q12841", "url": "https://www.uniprot.org/uniprotkb/Q12841" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.9786430", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Infantile encephalopathy and defective mitochondrial DNA translation in patients with mutations of mitochondrial elongation factors EFG1 and EFTu.", "journal": "American journal of human genetics", "date": "2007", "authors": "Valente L, Tiranti V, Marsano RM, Malfatti E, Fernandez-Vizarra E, Donnini C, Mereghetti P, De Gioia L, Burlina A, Castellan C, Comi GP, Savasta S, Ferrero I, Zeviani M", "reference": { "type": "PubMed", "id": "17160893", "url": "https://pubmed.ncbi.nlm.nih.gov/17160893" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P49411-1", "protein_name": "Elongation factor Tu, mitochondrial", "gene_name": "TUFM", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96RP9-1", "protein_name": "Elongation factor G, mitochondrial", "gene_name": "GFM1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P49411", "url": "https://www.uniprot.org/uniprotkb/P49411" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.17160893", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The mitochondrial proteins NLRX1 and TUFM form a complex that regulates type I interferon and autophagy.", "journal": "Immunity", "date": "2012", "authors": "Lei Y, Wen H, Yu Y, Taxman DJ, Zhang L, Widman DG, Swanson KV, Wen KW, Damania B, Moore CB, Giguere PM, Siderovski DP, Hiscott J, Razani B, Semenkovich CF, Chen X, Ting JP", "reference": { "type": "PubMed", "id": "22749352", "url": "https://pubmed.ncbi.nlm.nih.gov/22749352" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P49411-1", "protein_name": "Elongation factor Tu, mitochondrial", "gene_name": "TUFM", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q676U5-1", "protein_name": "Autophagy-related protein 16-1", "gene_name": "ATG16L1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86UT6-1", "protein_name": "NLR family member X1", "gene_name": "NLRX1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8BFR5-1", "protein_name": "Elongation factor Tu, mitochondrial", "gene_name": "Tufm", "tax_name": "Mouse" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P49411", "url": "https://www.uniprot.org/uniprotkb/P49411" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.22749352", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 4 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The Matrix Protein of Human Parainfluenza Virus Type 3 Induces Mitophagy that Suppresses Interferon Responses.", "journal": "Cell host & microbe", "date": "2017-04-12", "authors": "Ding Binbin, Zhang Linliang, Li Zhifei, Zhong Yi, Tang Qiaopeng, Qin Yali, Chen Mingzhou", "reference": { "type": "PubMed", "id": "28407488", "url": "https://pubmed.ncbi.nlm.nih.gov/28407488" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P49411-1", "protein_name": "Elongation factor Tu, mitochondrial", "gene_name": "TUFM", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P49411", "url": "https://www.uniprot.org/uniprotkb/P49411" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.28407488", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The Glycoprotein and Nucleocapsid Protein of Hantaviruses Manipulate Autophagy Flux to Restrain Host Innate Immune Responses.", "journal": "Cell Rep.", "date": "2019", "authors": "Wang Kerong, Ma Hongwei, Liu He, Ye Wei, Li Zhuo, Cheng Linfeng, Zhang Liang, Lei Yingfeng, Shen Lixin, Zhang Fanglin", "reference": { "type": "PubMed", "id": "31091447", "url": "https://pubmed.ncbi.nlm.nih.gov/31091447" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P49411-1", "protein_name": "Elongation factor Tu, mitochondrial", "gene_name": "TUFM", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95721-1", "protein_name": "Synaptosomal-associated protein 29", "gene_name": "SNAP29", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9GZQ8-1", "protein_name": "Microtubule-associated protein 1 light chain 3 beta", "gene_name": "MAP1LC3B", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P49411", "url": "https://www.uniprot.org/uniprotkb/P49411" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.31091447", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Elongation Factor Tu Switch I Element is a Gate for Aminoacyl-tRNA Selection.", "journal": "Journal of molecular biology", "date": "2020", "authors": "Girodat D, Blanchard SC, Wieden HJ, Sanbonmatsu KY", "reference": { "type": "PubMed", "id": "32061931", "url": "https://pubmed.ncbi.nlm.nih.gov/32061931" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P49411-1", "protein_name": "Elongation factor Tu, mitochondrial", "gene_name": "TUFM", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P49411", "url": "https://www.uniprot.org/uniprotkb/P49411" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.32061931", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "TUFM is involved in Alzheimer's disease-like pathologies that are associated with ROS.", "journal": "FASEB journal : official publication of the Federation of American Societies for Experimental Biology", "date": "2021", "authors": "Zhong BR, Zhou GF, Song L, Wen QX, Deng XJ, Ma YL, Hu LT, Chen GJ", "reference": { "type": "PubMed", "id": "33774866", "url": "https://pubmed.ncbi.nlm.nih.gov/33774866" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P49411-1", "protein_name": "Elongation factor Tu, mitochondrial", "gene_name": "TUFM", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8BFR5-1", "protein_name": "Elongation factor Tu, mitochondrial", "gene_name": "Tufm", "tax_name": "Mouse" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P49411", "url": "https://www.uniprot.org/uniprotkb/P49411" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.33774866", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Novel Tu translation elongation factor, mitochondrial (TUFM) homozygous variant in a consanguineous family with premature ovarian insufficiency.", "journal": "Clinical genetics", "date": "2023-07-17", "authors": "Zhang Jun, Zhou Xing-Yu, Wang Ao, Lai Yun-Hui, Zhang Xiao-Fei, Liu Xiao-Tong, Wang Zhe, Liu Yu-Dong, Tang Shu-Yan, Chen Shi-Ling", "reference": { "type": "PubMed", "id": "37461298", "url": "https://pubmed.ncbi.nlm.nih.gov/37461298" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P49411-1", "protein_name": "Elongation factor Tu, mitochondrial", "gene_name": "TUFM", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P49411", "url": "https://www.uniprot.org/uniprotkb/P49411" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.37461298", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "A mitochondrial elongation factor-like protein is over-expressed in tumours and differentially expressed in normal tissues.", "journal": "FEBS Lett.", "date": "1995", "authors": "Wells J, Henkler F, Leversha M, Koshy R", "reference": { "type": "PubMed", "id": "7828719", "url": "https://pubmed.ncbi.nlm.nih.gov/7828719" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P49411-1", "protein_name": "Elongation factor Tu, mitochondrial", "gene_name": "TUFM", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P49411", "url": "https://www.uniprot.org/uniprotkb/P49411" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.7828719", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Cloning, sequence analysis and expression of mammalian mitochondrial protein synthesis elongation factor Tu.", "journal": "Biochim. Biophys. Acta", "date": "1995", "authors": "Woriax V L, Burkhart W, Spremulli L L", "reference": { "type": "PubMed", "id": "8547323", "url": "https://pubmed.ncbi.nlm.nih.gov/8547323" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P49411-1", "protein_name": "Elongation factor Tu, mitochondrial", "gene_name": "TUFM", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49410-1", "protein_name": "Elongation factor Tu, mitochondrial", "gene_name": "TUFM", "tax_name": "Bovine" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P49411", "url": "https://www.uniprot.org/uniprotkb/P49411" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.8547323", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The human mitochondrial elongation factor Tu (EF-Tu) gene: cDNA sequence, genomic localization, genomic structure, and identification of a pseudogene.", "journal": "Gene", "date": "1997", "authors": "Ling M, Merante F, Chen H S, Duff C, Duncan A M, Robinson B H", "reference": { "type": "PubMed", "id": "9332382", "url": "https://pubmed.ncbi.nlm.nih.gov/9332382" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P49411-1", "protein_name": "Elongation factor Tu, mitochondrial", "gene_name": "TUFM", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P49411", "url": "https://www.uniprot.org/uniprotkb/P49411" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.9332382", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Regulation of APC activity by phosphorylation and regulatory factors.", "journal": "J. Cell Biol.", "date": "1999", "authors": "Kotani S, Tanaka H, Yasuda H, Todokoro K", "reference": { "type": "PubMed", "id": "10459014", "url": "https://pubmed.ncbi.nlm.nih.gov/10459014" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q12834-1", "protein_name": "Cell division cycle protein 20 homolog", "gene_name": "CDC20", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UM11-1", "protein_name": "Fizzy-related protein homolog", "gene_name": "FZR1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q12834", "url": "https://www.uniprot.org/uniprotkb/Q12834" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.10459014", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "MAD2B is an inhibitor of the anaphase-promoting complex.", "journal": "Genes Dev.", "date": "2001", "authors": "Chen J, Fang G", "reference": { "type": "PubMed", "id": "11459826", "url": "https://pubmed.ncbi.nlm.nih.gov/11459826" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q12834-1", "protein_name": "Cell division cycle protein 20 homolog", "gene_name": "CDC20", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UM11-1", "protein_name": "Fizzy-related protein homolog", "gene_name": "FZR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UI95-1", "protein_name": "Mitotic spindle assembly checkpoint protein MAD2B", "gene_name": "MAD2L2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q12834", "url": "https://www.uniprot.org/uniprotkb/Q12834" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.11459826", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Phosphorylation of Cdc20 by Bub1 provides a catalytic mechanism for APC/C inhibition by the spindle checkpoint.", "journal": "Molecular cell", "date": "2004", "authors": "Tang Z, Shu H, Oncel D, Chen S, Yu H", "reference": { "type": "PubMed", "id": "15525512", "url": "https://pubmed.ncbi.nlm.nih.gov/15525512" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q12834-1", "protein_name": "Cell division cycle protein 20 homolog", "gene_name": "CDC20", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43683-1", "protein_name": "Mitotic checkpoint serine/threonine-protein kinase BUB1", "gene_name": "BUB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43684-1", "protein_name": "Mitotic checkpoint protein BUB3", "gene_name": "BUB3", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q12834", "url": "https://www.uniprot.org/uniprotkb/Q12834" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 153, "end_pos": 153, "sequence_org": "S", "sequence_mut": "A", "comment": "Loss of BUB1-mediated phosphorylation and inhibition and partially defective spindle-assembly checkpoint; when associated with A-42; A-72; A-92; A-157 and A-161.", "evidence": [ { "database": "UniProtKB", "id": "Q12834", "url": "https://www.uniprot.org/uniprotkb/Q12834" }, { "database": "PubMed", "id": "15525512", "url": "https://pubmed.ncbi.nlm.nih.gov/15525512" } ], "uniprot_canonical_ac": "Q12834-1" }, { "start_pos": 157, "end_pos": 157, "sequence_org": "T", "sequence_mut": "A", "comment": "Loss of BUB1-mediated phosphorylation and inhibition and partially defective spindle-assembly checkpoint; when associated with A-42; A-72; A-92; A-153 and A-161.", "evidence": [ { "database": "UniProtKB", "id": "Q12834", "url": "https://www.uniprot.org/uniprotkb/Q12834" }, { "database": "PubMed", "id": "15525512", "url": "https://pubmed.ncbi.nlm.nih.gov/15525512" } ], "uniprot_canonical_ac": "Q12834-1" }, { "start_pos": 161, "end_pos": 161, "sequence_org": "S", "sequence_mut": "A", "comment": "Loss of BUB1-mediated phosphorylation and inhibition and partially defective spindle-assembly checkpoint; when associated with A-72; A-92; A-153; A-157 and A-161.", "evidence": [ { "database": "UniProtKB", "id": "Q12834", "url": "https://www.uniprot.org/uniprotkb/Q12834" }, { "database": "PubMed", "id": "15525512", "url": "https://pubmed.ncbi.nlm.nih.gov/15525512" } ], "uniprot_canonical_ac": "Q12834-1" }, { "start_pos": 41, "end_pos": 41, "sequence_org": "S", "sequence_mut": "A", "comment": "Loss of BUB1-mediated phosphorylation and inhibition and partially defective spindle-assembly checkpoint; when associated with A-72; A-92; A-153; A-157 and A-161.", "evidence": [ { "database": "UniProtKB", "id": "Q12834", "url": "https://www.uniprot.org/uniprotkb/Q12834" }, { "database": "PubMed", "id": "15525512", "url": "https://pubmed.ncbi.nlm.nih.gov/15525512" } ], "uniprot_canonical_ac": "Q12834-1" }, { "start_pos": 72, "end_pos": 72, "sequence_org": "S", "sequence_mut": "A", "comment": "Loss of BUB1-mediated phosphorylation and inhibition and partially defective spindle-assembly checkpoint; when associated with A-41; A-92; A-153; A-157 and A-161.", "evidence": [ { "database": "UniProtKB", "id": "Q12834", "url": "https://www.uniprot.org/uniprotkb/Q12834" }, { "database": "PubMed", "id": "15525512", "url": "https://pubmed.ncbi.nlm.nih.gov/15525512" } ], "uniprot_canonical_ac": "Q12834-1" }, { "start_pos": 92, "end_pos": 92, "sequence_org": "S", "sequence_mut": "A", "comment": "Loss of BUB1-mediated phosphorylation and inhibition and partially defective spindle-assembly checkpoint; when associated with A-41; A-72; A-153; A-157 and A-161.", "evidence": [ { "database": "UniProtKB", "id": "Q12834", "url": "https://www.uniprot.org/uniprotkb/Q12834" }, { "database": "PubMed", "id": "15525512", "url": "https://pubmed.ncbi.nlm.nih.gov/15525512" } ], "uniprot_canonical_ac": "Q12834-1" } ], "phosphorylation": [ { "start_pos": 153, "end_pos": 153, "kinase_uniprot_canonical_ac": "O43683-1", "kinase_gene_name": "BUB1", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q12834", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q12834" }, { "database": "PubMed", "id": "15525512", "url": "https://pubmed.ncbi.nlm.nih.gov/15525512" } ], "site_lbl": "Ser153", "uniprot_canonical_ac": "Q12834-1" }, { "start_pos": 153, "end_pos": 153, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "Q12834", "url": "https://www.uniprot.org/uniprotkb/Q12834" }, { "database": "PubMed", "id": "15525512", "url": "https://pubmed.ncbi.nlm.nih.gov/15525512" }, { "database": "PRO", "id": "Q12834", "url": "https://proconsortium.org/cgi-bin/entry_pro?id=Q12834" }, { "database": "iPTMnet", "id": "Q12834", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q12834" }, { "database": "PubMed", "id": "26912231", "url": "https://pubmed.ncbi.nlm.nih.gov/26912231" } ], "site_lbl": "Ser153", "uniprot_canonical_ac": "Q12834-1" }, { "start_pos": 157, "end_pos": 157, "kinase_uniprot_canonical_ac": "O43683-1", "kinase_gene_name": "BUB1", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q12834", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q12834" }, { "database": "PubMed", "id": "15525512", "url": "https://pubmed.ncbi.nlm.nih.gov/15525512" } ], "site_lbl": "Thr157", "uniprot_canonical_ac": "Q12834-1" }, { "start_pos": 157, "end_pos": 157, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine", "evidence": [ { "database": "UniProtKB", "id": "Q12834", "url": "https://www.uniprot.org/uniprotkb/Q12834" }, { "database": "PubMed", "id": "15525512", "url": "https://pubmed.ncbi.nlm.nih.gov/15525512" }, { "database": "PRO", "id": "Q12834", "url": "https://proconsortium.org/cgi-bin/entry_pro?id=Q12834" }, { "database": "iPTMnet", "id": "Q12834", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q12834" }, { "database": "PubMed", "id": "26912231", "url": "https://pubmed.ncbi.nlm.nih.gov/26912231" }, { "database": "PubMed", "id": "26960431", "url": "https://pubmed.ncbi.nlm.nih.gov/26960431" } ], "site_lbl": "Thr157", "uniprot_canonical_ac": "Q12834-1" }, { "start_pos": 161, "end_pos": 161, "kinase_uniprot_canonical_ac": "O43683-1", "kinase_gene_name": "BUB1", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q12834", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q12834" }, { "database": "PubMed", "id": "15525512", "url": "https://pubmed.ncbi.nlm.nih.gov/15525512" } ], "site_lbl": "Ser161", "uniprot_canonical_ac": "Q12834-1" }, { "start_pos": 161, "end_pos": 161, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "Q12834", "url": "https://www.uniprot.org/uniprotkb/Q12834" }, { "database": "PubMed", "id": "15525512", "url": "https://pubmed.ncbi.nlm.nih.gov/15525512" }, { "database": "PRO", "id": "Q12834", "url": "https://proconsortium.org/cgi-bin/entry_pro?id=Q12834" }, { "database": "iPTMnet", "id": "Q12834", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q12834" }, { "database": "PubMed", "id": "26912231", "url": "https://pubmed.ncbi.nlm.nih.gov/26912231" } ], "site_lbl": "Ser161", "uniprot_canonical_ac": "Q12834-1" }, { "start_pos": 41, "end_pos": 41, "kinase_uniprot_canonical_ac": "O43683-1", "kinase_gene_name": "BUB1", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q12834", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q12834" }, { "database": "PubMed", "id": "15525512", "url": "https://pubmed.ncbi.nlm.nih.gov/15525512" }, { "database": "PubMed", "id": "18669648", "url": "https://pubmed.ncbi.nlm.nih.gov/18669648" }, { "database": "PubMed", "id": "19413330", "url": "https://pubmed.ncbi.nlm.nih.gov/19413330" } ], "site_lbl": "Ser41", "uniprot_canonical_ac": "Q12834-1" }, { "start_pos": 41, "end_pos": 41, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "Q12834", "url": "https://www.uniprot.org/uniprotkb/Q12834" }, { "database": "PubMed", "id": "15525512", "url": "https://pubmed.ncbi.nlm.nih.gov/15525512" }, { "database": "PubMed", "id": "23186163", "url": "https://pubmed.ncbi.nlm.nih.gov/23186163" }, { "database": "PRO", "id": "Q12834", "url": "https://proconsortium.org/cgi-bin/entry_pro?id=Q12834" }, { "database": "iPTMnet", "id": "Q12834", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q12834" }, { "database": "PubMed", "id": "26960431", "url": "https://pubmed.ncbi.nlm.nih.gov/26960431" } ], "site_lbl": "Ser41", "uniprot_canonical_ac": "Q12834-1" }, { "start_pos": 72, "end_pos": 72, "kinase_uniprot_canonical_ac": "O43683-1", "kinase_gene_name": "BUB1", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q12834", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q12834" }, { "database": "PubMed", "id": "15525512", "url": "https://pubmed.ncbi.nlm.nih.gov/15525512" }, { "database": "PubMed", "id": "18767875", "url": "https://pubmed.ncbi.nlm.nih.gov/18767875" } ], "site_lbl": "Ser72", "uniprot_canonical_ac": "Q12834-1" }, { "start_pos": 72, "end_pos": 72, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "Q12834", "url": "https://www.uniprot.org/uniprotkb/Q12834" }, { "database": "PubMed", "id": "15525512", "url": "https://pubmed.ncbi.nlm.nih.gov/15525512" }, { "database": "PRO", "id": "Q12834", "url": "https://proconsortium.org/cgi-bin/entry_pro?id=Q12834" }, { "database": "iPTMnet", "id": "Q12834", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q12834" }, { "database": "PubMed", "id": "26912231", "url": "https://pubmed.ncbi.nlm.nih.gov/26912231" } ], "site_lbl": "Ser72", "uniprot_canonical_ac": "Q12834-1" }, { "start_pos": 92, "end_pos": 92, "kinase_uniprot_canonical_ac": "O43683-1", "kinase_gene_name": "BUB1", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q12834", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q12834" }, { "database": "PubMed", "id": "15525512", "url": "https://pubmed.ncbi.nlm.nih.gov/15525512" } ], "site_lbl": "Ser92", "uniprot_canonical_ac": "Q12834-1" }, { "start_pos": 92, "end_pos": 92, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "Q12834", "url": "https://www.uniprot.org/uniprotkb/Q12834" }, { "database": "PubMed", "id": "15525512", "url": "https://pubmed.ncbi.nlm.nih.gov/15525512" }, { "database": "PRO", "id": "Q12834", "url": "https://proconsortium.org/cgi-bin/entry_pro?id=Q12834" }, { "database": "iPTMnet", "id": "Q12834", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q12834" }, { "database": "PubMed", "id": "26912231", "url": "https://pubmed.ncbi.nlm.nih.gov/26912231" } ], "site_lbl": "Ser92", "uniprot_canonical_ac": "Q12834-1" } ], "record_id": "pubmed.15525512", "abstract": "", "glycosylation": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 12 }, { "field": "total_sites", "count": 6 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Cell cycle-dependent expression of centrosomal ninein-like protein in human cells is regulated by the anaphase-promoting complex.", "journal": "J. Biol. Chem.", "date": "2007", "authors": "Wang Y, Zhan Q", "reference": { "type": "PubMed", "id": "17403670", "url": "https://pubmed.ncbi.nlm.nih.gov/17403670" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q12834-1", "protein_name": "Cell division cycle protein 20 homolog", "gene_name": "CDC20", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y2I6-1", "protein_name": "Ninein-like protein", "gene_name": "NINL", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UM11-1", "protein_name": "Fizzy-related protein homolog", "gene_name": "FZR1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q12834", "url": "https://www.uniprot.org/uniprotkb/Q12834" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 495, "end_pos": 497, "sequence_org": "KEN", "sequence_mut": "AAA", "comment": "Disrupts binding to CDC20 and FZR1 and prevents ubiquitination and subsequent degradation of NINL; when associated with 633-A--A-636.", "evidence": [ { "database": "UniProtKB", "id": "Q9Y2I6", "url": "https://www.uniprot.org/uniprotkb/Q9Y2I6" }, { "database": "PubMed", "id": "17403670", "url": "https://pubmed.ncbi.nlm.nih.gov/17403670" } ], "uniprot_canonical_ac": "Q9Y2I6-1" }, { "start_pos": 633, "end_pos": 636, "sequence_org": "RTQL", "sequence_mut": "AAAA", "comment": "Disrupts binding to CDC20 and FZR1 and prevents ubiquitination and subsequent degradation of NINL; when associated with 495-A--A-497.", "evidence": [ { "database": "UniProtKB", "id": "Q9Y2I6", "url": "https://www.uniprot.org/uniprotkb/Q9Y2I6" }, { "database": "PubMed", "id": "17403670", "url": "https://pubmed.ncbi.nlm.nih.gov/17403670" } ], "uniprot_canonical_ac": "Q9Y2I6-1" } ], "record_id": "pubmed.17403670", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "HSF1 as a mitotic regulator: phosphorylation of HSF1 by Plk1 is essential for mitotic progression.", "journal": "Cancer Res.", "date": "2008", "authors": "Lee YJ, Kim EH, Lee JS, Jeoung D, Bae S, Kwon SH, Lee YS", "reference": { "type": "PubMed", "id": "18794143", "url": "https://pubmed.ncbi.nlm.nih.gov/18794143" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q12834-1", "protein_name": "Cell division cycle protein 20 homolog", "gene_name": "CDC20", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13257-1", "protein_name": "Mitotic spindle assembly checkpoint protein MAD2A", "gene_name": "MAD2L1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P53350-1", "protein_name": "Serine/threonine-protein kinase PLK1", "gene_name": "PLK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y297-1", "protein_name": "F-box/WD repeat-containing protein 1A", "gene_name": "BTRC", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q00613-1", "protein_name": "Heat shock factor protein 1", "gene_name": "HSF1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q12834", "url": "https://www.uniprot.org/uniprotkb/Q12834" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 216, "end_pos": 216, "sequence_org": "S", "sequence_mut": "A", "comment": "Does not change interaction with XRCC5 and XRCC6. No PLK1-induced phosphorylation in mitosis. Inhibits PLK1-stimulated ubiquitinylation. Increased protein stability.", "evidence": [ { "database": "UniProtKB", "id": "Q00613", "url": "https://www.uniprot.org/uniprotkb/Q00613" }, { "database": "PubMed", "id": "26359349", "url": "https://pubmed.ncbi.nlm.nih.gov/26359349" }, { "database": "PubMed", "id": "18794143", "url": "https://pubmed.ncbi.nlm.nih.gov/18794143" } ], "uniprot_canonical_ac": "Q00613-1" }, { "start_pos": 216, "end_pos": 216, "sequence_org": "S", "sequence_mut": "E", "comment": "Does not change interaction with XRCC5 and XRCC6. No change in spindle pole localization. Increases weakly PLK1-stimulated ubiquitinylation. No change in protein stability. Increased interaction with BTRC.", "evidence": [ { "database": "UniProtKB", "id": "Q00613", "url": "https://www.uniprot.org/uniprotkb/Q00613" }, { "database": "PubMed", "id": "26359349", "url": "https://pubmed.ncbi.nlm.nih.gov/26359349" }, { "database": "PubMed", "id": "18794143", "url": "https://pubmed.ncbi.nlm.nih.gov/18794143" } ], "uniprot_canonical_ac": "Q00613-1" }, { "start_pos": 216, "end_pos": 216, "sequence_org": "S", "sequence_mut": "N", "comment": "Decreased spindle pole localization. Decreased interaction with BTRC. Increased protein stability.", "evidence": [ { "database": "UniProtKB", "id": "Q00613", "url": "https://www.uniprot.org/uniprotkb/Q00613" }, { "database": "PubMed", "id": "18794143", "url": "https://pubmed.ncbi.nlm.nih.gov/18794143" } ], "uniprot_canonical_ac": "Q00613-1" }, { "start_pos": 230, "end_pos": 230, "sequence_org": "S", "sequence_mut": "A", "comment": "No phosphorylation. No change in PLK1-induced phosphorylation in mitosis. No change in DNA-binding activity upon heat shock. Decreased transcriptional activity upon heat shock.", "evidence": [ { "database": "UniProtKB", "id": "Q00613", "url": "https://www.uniprot.org/uniprotkb/Q00613" }, { "database": "PubMed", "id": "11447121", "url": "https://pubmed.ncbi.nlm.nih.gov/11447121" }, { "database": "PubMed", "id": "12665592", "url": "https://pubmed.ncbi.nlm.nih.gov/12665592" }, { "database": "PubMed", "id": "18794143", "url": "https://pubmed.ncbi.nlm.nih.gov/18794143" } ], "uniprot_canonical_ac": "Q00613-1" }, { "start_pos": 303, "end_pos": 303, "sequence_org": "S", "sequence_mut": "A", "comment": "No phosphorylation nor sumoylation. No change in nuclear stress granules subcellular location upon heat shock. Loss of colocalization with SUMO1 to nuclear stress granules upon heat shock. Slight decrease in transcriptional activity on heat treatment. No change in PLK1-induced phosphorylation in mitosis, induces derepression of transcription activation at control temperature, abolishes sumoylation and induces 2.5-fold increase in transcriptional activity on heat treatment; when associated with A-307.", "evidence": [ { "database": "UniProtKB", "id": "Q00613", "url": "https://www.uniprot.org/uniprotkb/Q00613" }, { "database": "PubMed", "id": "8946918", "url": "https://pubmed.ncbi.nlm.nih.gov/8946918" }, { "database": "PubMed", "id": "9535852", "url": "https://pubmed.ncbi.nlm.nih.gov/9535852" }, { "database": "PubMed", "id": "12665592", "url": "https://pubmed.ncbi.nlm.nih.gov/12665592" }, { "database": "PubMed", "id": "9121459", "url": "https://pubmed.ncbi.nlm.nih.gov/9121459" }, { "database": "PubMed", "id": "12646186", "url": "https://pubmed.ncbi.nlm.nih.gov/12646186" }, { "database": "PubMed", "id": "18794143", "url": "https://pubmed.ncbi.nlm.nih.gov/18794143" } ], "uniprot_canonical_ac": "Q00613-1" }, { "start_pos": 307, "end_pos": 307, "sequence_org": "S", "sequence_mut": "A", "comment": "No phosphorylation. Does not reduce Ser-303 phosphorylation. 1.5% increase in transcriptional activity on heat-treatment. No change in PLK1-induced phosphorylation in mitosis, induces derepression of transcription activation at control temperature, abolishes sumoylation and induces 2.5-fold increase in transcriptional activity on heat treatment; when associated with A-303.", "evidence": [ { "database": "UniProtKB", "id": "Q00613", "url": "https://www.uniprot.org/uniprotkb/Q00613" }, { "database": "PubMed", "id": "8946918", "url": "https://pubmed.ncbi.nlm.nih.gov/8946918" }, { "database": "PubMed", "id": "9535852", "url": "https://pubmed.ncbi.nlm.nih.gov/9535852" }, { "database": "PubMed", "id": "12665592", "url": "https://pubmed.ncbi.nlm.nih.gov/12665592" }, { "database": "PubMed", "id": "9121459", "url": "https://pubmed.ncbi.nlm.nih.gov/9121459" }, { "database": "PubMed", "id": "12646186", "url": "https://pubmed.ncbi.nlm.nih.gov/12646186" }, { "database": "PubMed", "id": "18794143", "url": "https://pubmed.ncbi.nlm.nih.gov/18794143" } ], "uniprot_canonical_ac": "Q00613-1" }, { "start_pos": 419, "end_pos": 419, "sequence_org": "S", "sequence_mut": "A", "comment": "Does not change interaction with XRCC5 and XRCC6. Decreased nuclear localization upon heat shock. Strongly decreases PLK1-induced phosphorylation. No change in PLK1-induced phosphorylation in mitosis.", "evidence": [ { "database": "UniProtKB", "id": "Q00613", "url": "https://www.uniprot.org/uniprotkb/Q00613" }, { "database": "PubMed", "id": "26359349", "url": "https://pubmed.ncbi.nlm.nih.gov/26359349" }, { "database": "PubMed", "id": "15661742", "url": "https://pubmed.ncbi.nlm.nih.gov/15661742" }, { "database": "PubMed", "id": "18794143", "url": "https://pubmed.ncbi.nlm.nih.gov/18794143" } ], "uniprot_canonical_ac": "Q00613-1" } ], "phosphorylation": [ { "start_pos": 216, "end_pos": 216, "kinase_uniprot_canonical_ac": "P53350-1", "kinase_gene_name": "PLK1", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q00613", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q00613" }, { "database": "PubMed", "id": "18794143", "url": "https://pubmed.ncbi.nlm.nih.gov/18794143" } ], "site_lbl": "Ser216", "uniprot_canonical_ac": "Q00613-1" }, { "start_pos": 216, "end_pos": 216, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by PLK1", "evidence": [ { "database": "UniProtKB", "id": "Q00613", "url": "https://www.uniprot.org/uniprotkb/Q00613" }, { "database": "iPTMnet", "id": "Q00613", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q00613" }, { "database": "PubMed", "id": "18794143", "url": "https://pubmed.ncbi.nlm.nih.gov/18794143" }, { "database": "PubMed", "id": "19934326", "url": "https://pubmed.ncbi.nlm.nih.gov/19934326" }, { "database": "PubMed", "id": "32457290", "url": "https://pubmed.ncbi.nlm.nih.gov/32457290" } ], "site_lbl": "Ser216", "uniprot_canonical_ac": "Q00613-1" } ], "record_id": "pubmed.18794143", "abstract": "", "glycosylation": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 5 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The APC/C maintains the spindle assembly checkpoint by targeting Cdc20 for destruction.", "journal": "Nature cell biology", "date": "2008", "authors": "Nilsson J, Yekezare M, Minshull J, Pines J", "reference": { "type": "PubMed", "id": "18997788", "url": "https://pubmed.ncbi.nlm.nih.gov/18997788" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q12834-1", "protein_name": "Cell division cycle protein 20 homolog", "gene_name": "CDC20", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q12834", "url": "https://www.uniprot.org/uniprotkb/Q12834" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.18997788", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "APC/C- and Mad2-mediated degradation of Cdc20 during spindle checkpoint activation.", "journal": "Cell cycle (Georgetown, Tex.)", "date": "2009", "authors": "Ge S, Skaar JR, Pagano M", "reference": { "type": "PubMed", "id": "19098431", "url": "https://pubmed.ncbi.nlm.nih.gov/19098431" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q12834-1", "protein_name": "Cell division cycle protein 20 homolog", "gene_name": "CDC20", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q12834", "url": "https://www.uniprot.org/uniprotkb/Q12834" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 132, "end_pos": 132, "sequence_org": "R", "sequence_mut": "A", "comment": "Loss of interaction with MAD2L1.", "evidence": [ { "database": "UniProtKB", "id": "Q12834", "url": "https://www.uniprot.org/uniprotkb/Q12834" }, { "database": "PubMed", "id": "19098431", "url": "https://pubmed.ncbi.nlm.nih.gov/19098431" } ], "uniprot_canonical_ac": "Q12834-1" } ], "record_id": "pubmed.19098431", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "CDK5RAP2 is required for spindle checkpoint function.", "journal": "Cell Cycle", "date": "2009", "authors": "Zhang Xiaoying, Liu Dongyun, Lv Shuang, Wang Haibo, Zhong Xueyan, Liu Bo, Wang Bo, Liao Ji, Li Jing, Pfeifer Gerd P, Xu Xingzhi", "reference": { "type": "PubMed", "id": "19282672", "url": "https://pubmed.ncbi.nlm.nih.gov/19282672" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q12834-1", "protein_name": "Cell division cycle protein 20 homolog", "gene_name": "CDC20", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96SN8-1", "protein_name": "CDK5 regulatory subunit-associated protein 2", "gene_name": "CDK5RAP2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q12834", "url": "https://www.uniprot.org/uniprotkb/Q12834" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.19282672", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Nek2 targets the mitotic checkpoint proteins Mad2 and Cdc20: a mechanism for aneuploidy in cancer.", "journal": "Experimental and molecular pathology", "date": "2010", "authors": "Liu Q, Hirohashi Y, Du X, Greene MI, Wang Q", "reference": { "type": "PubMed", "id": "20034488", "url": "https://pubmed.ncbi.nlm.nih.gov/20034488" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q12834-1", "protein_name": "Cell division cycle protein 20 homolog", "gene_name": "CDC20", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51955-1", "protein_name": "Serine/threonine-protein kinase Nek2", "gene_name": "NEK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13257-1", "protein_name": "Mitotic spindle assembly checkpoint protein MAD2A", "gene_name": "MAD2L1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q12834", "url": "https://www.uniprot.org/uniprotkb/Q12834" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.20034488", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "SIRT2 maintains genome integrity and suppresses tumorigenesis through regulating APC/C activity.", "journal": "Cancer cell", "date": "2011", "authors": "Kim HS, Vassilopoulos A, Wang RH, Lahusen T, Xiao Z, Xu X, Li C, Veenstra TD, Li B, Yu H, Ji J, Wang XW, Park SH, Cha YI, Gius D, Deng CX", "reference": { "type": "PubMed", "id": "22014574", "url": "https://pubmed.ncbi.nlm.nih.gov/22014574" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q12834-1", "protein_name": "Cell division cycle protein 20 homolog", "gene_name": "CDC20", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14965-1", "protein_name": "Aurora kinase A", "gene_name": "AURKA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8VDQ8-1", "protein_name": "NAD-dependent protein deacetylase sirtuin-2", "gene_name": "Sirt2", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "Q9JJ66-1", "protein_name": "Cell division cycle protein 20 homolog", "gene_name": "Cdc20", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "Q9R1K5-1", "protein_name": "Fizzy-related protein homolog", "gene_name": "Fzr1", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "Q8IXJ6-1", "protein_name": "NAD-dependent protein deacetylase sirtuin-2", "gene_name": "SIRT2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UM11-1", "protein_name": "Fizzy-related protein homolog", "gene_name": "FZR1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q12834", "url": "https://www.uniprot.org/uniprotkb/Q12834" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 187, "end_pos": 187, "sequence_org": "H", "sequence_mut": "A", "comment": "Inhibits deacetylase activity toward histone, alpha-tubulin, FZR1 and CDC20. No effect on CDK2-dependent phosphorylation. Does not inhibit interaction with alpha-tubulin, HDAC6, HIF1A and the cyclin E-CDK2 complex. Inhibits interaction with BEX4 and KMT5A. Abolishes deacetylation, dimeric formation and enzymatic activity increase of G6PD. Prevents histone H4 methylation at 'Lys-20'(H4K20me1) in metaphase chromosomes. Inhibits the block of entry to chromosome condensation and subsequent hyperploidy cell formation in response to mitotic stress; when associated with A-167 and A-168. Strongly reduced activity toward long-chain fatty acyl groups.", "evidence": [ { "database": "UniProtKB", "id": "Q8IXJ6", "url": "https://www.uniprot.org/uniprotkb/Q8IXJ6" }, { "database": "PubMed", "id": "24681946", "url": "https://pubmed.ncbi.nlm.nih.gov/24681946" }, { "database": "PubMed", "id": "17516032", "url": "https://pubmed.ncbi.nlm.nih.gov/17516032" }, { "database": "PubMed", "id": "10381378", "url": "https://pubmed.ncbi.nlm.nih.gov/10381378" }, { "database": "PubMed", "id": "17726514", "url": "https://pubmed.ncbi.nlm.nih.gov/17726514" }, { "database": "PubMed", "id": "22014574", "url": "https://pubmed.ncbi.nlm.nih.gov/22014574" }, { "database": "PubMed", "id": "11427894", "url": "https://pubmed.ncbi.nlm.nih.gov/11427894" }, { "database": "PubMed", "id": "16909107", "url": "https://pubmed.ncbi.nlm.nih.gov/16909107" }, { "database": "PubMed", "id": "27512957", "url": "https://pubmed.ncbi.nlm.nih.gov/27512957" }, { "database": "PubMed", "id": "12620231", "url": "https://pubmed.ncbi.nlm.nih.gov/12620231" }, { "database": "PubMed", "id": "29239724", "url": "https://pubmed.ncbi.nlm.nih.gov/29239724" }, { "database": "PubMed", "id": "11812793", "url": "https://pubmed.ncbi.nlm.nih.gov/11812793" }, { "database": "PubMed", "id": "17488717", "url": "https://pubmed.ncbi.nlm.nih.gov/17488717" }, { "database": "PubMed", "id": "12697818", "url": "https://pubmed.ncbi.nlm.nih.gov/12697818" } ], "uniprot_canonical_ac": "Q8IXJ6-1" }, { "start_pos": 187, "end_pos": 187, "sequence_org": "H", "sequence_mut": "Y", "comment": "Inhibits deacetylase activity toward histone, alpha-tubulin, FZR1 and CDC20. No effect on CDK2-dependent phosphorylation. Does not inhibit interaction with alpha-tubulin, HDAC6, HIF1A and the cyclin E-CDK2 complex. Inhibits interaction with BEX4 and KMT5A. Abolishes deacetylation, dimeric formation and enzymatic activity increase of G6PD. Prevents histone H4 methylation at 'Lys-20'(H4K20me1) in metaphase chromosomes. Inhibits the block of entry to chromosome condensation and subsequent hyperploidy cell formation in response to mitotic stress; when associated with A-167 and A-168. Strongly reduced activity toward long-chain fatty acyl groups.", "evidence": [ { "database": "UniProtKB", "id": "Q8IXJ6", "url": "https://www.uniprot.org/uniprotkb/Q8IXJ6" }, { "database": "PubMed", "id": "24681946", "url": "https://pubmed.ncbi.nlm.nih.gov/24681946" }, { "database": "PubMed", "id": "17516032", "url": "https://pubmed.ncbi.nlm.nih.gov/17516032" }, { "database": "PubMed", "id": "10381378", "url": "https://pubmed.ncbi.nlm.nih.gov/10381378" }, { "database": "PubMed", "id": "17726514", "url": "https://pubmed.ncbi.nlm.nih.gov/17726514" }, { "database": "PubMed", "id": "22014574", "url": "https://pubmed.ncbi.nlm.nih.gov/22014574" }, { "database": "PubMed", "id": "11427894", "url": "https://pubmed.ncbi.nlm.nih.gov/11427894" }, { "database": "PubMed", "id": "16909107", "url": "https://pubmed.ncbi.nlm.nih.gov/16909107" }, { "database": "PubMed", "id": "27512957", "url": "https://pubmed.ncbi.nlm.nih.gov/27512957" }, { "database": "PubMed", "id": "12620231", "url": "https://pubmed.ncbi.nlm.nih.gov/12620231" }, { "database": "PubMed", "id": "29239724", "url": "https://pubmed.ncbi.nlm.nih.gov/29239724" }, { "database": "PubMed", "id": "11812793", "url": "https://pubmed.ncbi.nlm.nih.gov/11812793" }, { "database": "PubMed", "id": "17488717", "url": "https://pubmed.ncbi.nlm.nih.gov/17488717" }, { "database": "PubMed", "id": "12697818", "url": "https://pubmed.ncbi.nlm.nih.gov/12697818" } ], "uniprot_canonical_ac": "Q8IXJ6-1" } ], "record_id": "pubmed.22014574", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 7 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Fcp1-dependent dephosphorylation is required for M-phase-promoting factor inactivation at mitosis exit.", "journal": "Nature communications", "date": "2012", "authors": "Visconti R, Palazzo L, Della Monica R, Grieco D", "reference": { "type": "PubMed", "id": "22692537", "url": "https://pubmed.ncbi.nlm.nih.gov/22692537" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q12834-1", "protein_name": "Cell division cycle protein 20 homolog", "gene_name": "CDC20", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y5B0-1", "protein_name": "RNA polymerase II subunit A C-terminal domain phosphatase", "gene_name": "CTDP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P30291-1", "protein_name": "Wee1-like protein kinase", "gene_name": "WEE1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H0E7-1", "protein_name": "Ubiquitin carboxyl-terminal hydrolase 44", "gene_name": "USP44", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q12834", "url": "https://www.uniprot.org/uniprotkb/Q12834" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 239, "end_pos": 239, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine", "evidence": [ { "database": "UniProtKB", "id": "P30291", "url": "https://www.uniprot.org/uniprotkb/P30291" }, { "database": "PubMed", "id": "22692537", "url": "https://pubmed.ncbi.nlm.nih.gov/22692537" }, { "database": "iPTMnet", "id": "P30291", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P30291" }, { "database": "PubMed", "id": "25744022", "url": "https://pubmed.ncbi.nlm.nih.gov/25744022" } ], "site_lbl": "Thr239", "uniprot_canonical_ac": "P30291-1" }, { "start_pos": 169, "end_pos": 169, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "Q9H0E7", "url": "https://www.uniprot.org/uniprotkb/Q9H0E7" }, { "database": "PubMed", "id": "22692537", "url": "https://pubmed.ncbi.nlm.nih.gov/22692537" }, { "database": "iPTMnet", "id": "Q9H0E7", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9H0E7" } ], "site_lbl": "Ser169", "uniprot_canonical_ac": "Q9H0E7-1" }, { "start_pos": 239, "end_pos": 239, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "Q9H0E7", "url": "https://www.uniprot.org/uniprotkb/Q9H0E7" }, { "database": "PubMed", "id": "22692537", "url": "https://pubmed.ncbi.nlm.nih.gov/22692537" }, { "database": "iPTMnet", "id": "Q9H0E7", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9H0E7" } ], "site_lbl": "Ser239", "uniprot_canonical_ac": "Q9H0E7-1" }, { "start_pos": 269, "end_pos": 269, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine", "evidence": [ { "database": "UniProtKB", "id": "Q9H0E7", "url": "https://www.uniprot.org/uniprotkb/Q9H0E7" }, { "database": "PubMed", "id": "22692537", "url": "https://pubmed.ncbi.nlm.nih.gov/22692537" }, { "database": "iPTMnet", "id": "Q9H0E7", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9H0E7" } ], "site_lbl": "Thr269", "uniprot_canonical_ac": "Q9H0E7-1" }, { "start_pos": 401, "end_pos": 401, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "Q9H0E7", "url": "https://www.uniprot.org/uniprotkb/Q9H0E7" }, { "database": "PubMed", "id": "22692537", "url": "https://pubmed.ncbi.nlm.nih.gov/22692537" }, { "database": "iPTMnet", "id": "Q9H0E7", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9H0E7" } ], "site_lbl": "Ser401", "uniprot_canonical_ac": "Q9H0E7-1" } ], "record_id": "pubmed.22692537", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 4 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 5 }, { "field": "total_sites", "count": 5 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] } ]