[ { "title": "Nucleocytoplasmic shuttling of the human parainfluenza virus type 2 phosphoprotein.", "journal": "Virology", "date": "2019", "authors": "Ohtsuka Junpei, Matsumoto Yusuke, Ohta Keisuke, Fukumura Masayuki, Tsurudome Masato, Nosaka Tetsuya, Nishio Machiko", "reference": { "type": "PubMed", "id": "30576860", "url": "https://pubmed.ncbi.nlm.nih.gov/30576860" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P52294-1", "protein_name": "Importin subunit alpha-5", "gene_name": "KPNA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60684-1", "protein_name": "Importin subunit alpha-7", "gene_name": "KPNA6", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P52294", "url": "https://www.uniprot.org/uniprotkb/P52294" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.30576860", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Baricitinib as potential treatment for 2019-nCoV acute respiratory disease.", "journal": "Lancet (London, England)", "date": "2020", "authors": "Richardson P, Griffin I, Tucker C, Smith D, Oechsle O, Phelan A, Rawling M, Savory E, Stebbing J", "reference": { "type": "PubMed", "id": "32032529", "url": "https://pubmed.ncbi.nlm.nih.gov/32032529" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P52294-1", "protein_name": "Importin subunit alpha-5", "gene_name": "KPNA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P18146-1", "protein_name": "Early growth response protein 1", "gene_name": "EGR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15646-1", "protein_name": "2'-5'-oligoadenylate synthase-like protein", "gene_name": "OASL", "tax_name": "Human" }, { "uniprot_canonical_ac": "P29728-1", "protein_name": "2'-5'-oligoadenylate synthase 2", "gene_name": "OAS2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15524-1", "protein_name": "Suppressor of cytokine signaling 1", "gene_name": "SOCS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y6K5-1", "protein_name": "2'-5'-oligoadenylate synthase 3", "gene_name": "OAS3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q02556-1", "protein_name": "Interferon regulatory factor 8", "gene_name": "IRF8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96AZ6-1", "protein_name": "Interferon-stimulated gene 20 kDa protein", "gene_name": "ISG20", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14896-1", "protein_name": "Interferon regulatory factor 6", "gene_name": "IRF6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P30511-1", "protein_name": "HLA class I histocompatibility antigen, alpha chain F", "gene_name": "HLA-F", "tax_name": "Human" }, { "uniprot_canonical_ac": "P13747-1", "protein_name": "HLA class I histocompatibility antigen, alpha chain E", "gene_name": "HLA-E", "tax_name": "Human" }, { "uniprot_canonical_ac": "P17693-1", "protein_name": "HLA class I histocompatibility antigen, alpha chain G", "gene_name": "HLA-G", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01563-1", "protein_name": "Interferon alpha-2", "gene_name": "IFNA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01567-1", "protein_name": "Interferon alpha-7", "gene_name": "IFNA7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01568-1", "protein_name": "Interferon alpha-21", "gene_name": "IFNA21", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01569-1", "protein_name": "Interferon alpha-5", "gene_name": "IFNA5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01570-1", "protein_name": "Interferon alpha-14", "gene_name": "IFNA14", "tax_name": "Human" }, { "uniprot_canonical_ac": "P09914-1", "protein_name": "Antiviral innate immune response effector IFIT1", "gene_name": "IFIT1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P32881-1", "protein_name": "Interferon alpha-8", "gene_name": "IFNA8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UHH9-1", "protein_name": "Inositol hexakisphosphate kinase 2", "gene_name": "IP6K2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05013-1", "protein_name": "Interferon alpha-6", "gene_name": "IFNA6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P09913-1", "protein_name": "Interferon-induced protein with tetratricopeptide repeats 2", "gene_name": "IFIT2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8WXG1-1", "protein_name": "S-adenosylmethionine-dependent nucleotide dehydratase RSAD2", "gene_name": "RSAD2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P20592-1", "protein_name": "Interferon-induced GTP-binding protein Mx2", "gene_name": "MX2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P14316-1", "protein_name": "Interferon regulatory factor 2", "gene_name": "IRF2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P29350-1", "protein_name": "Tyrosine-protein phosphatase non-receptor type 6", "gene_name": "PTPN6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14653-1", "protein_name": "Interferon regulatory factor 3", "gene_name": "IRF3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P20591-1", "protein_name": "Interferon-induced GTP-binding protein Mx1", "gene_name": "MX1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13568-1", "protein_name": "Interferon regulatory factor 5", "gene_name": "IRF5", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14879-1", "protein_name": "Interferon-induced protein with tetratricopeptide repeats 3", "gene_name": "IFIT3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q05823-1", "protein_name": "2-5A-dependent ribonuclease", "gene_name": "RNASEL", "tax_name": "Human" }, { "uniprot_canonical_ac": "P10914-1", "protein_name": "Interferon regulatory factor 1", "gene_name": "IRF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6GPH4-1", "protein_name": "XIAP-associated factor 1", "gene_name": "XAF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P52630-3", "protein_name": "Signal transducer and activator of transcription 2", "gene_name": "STAT2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P09912-1", "protein_name": "Interferon alpha-inducible protein 6", "gene_name": "IFI6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P10321-1", "protein_name": "HLA class I histocompatibility antigen, C alpha chain", "gene_name": "HLA-C", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04439-1", "protein_name": "HLA class I histocompatibility antigen, A alpha chain", "gene_name": "HLA-A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92985-1", "protein_name": "Interferon regulatory factor 7", "gene_name": "IRF7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61221-1", "protein_name": "ATP-binding cassette sub-family E member 1", "gene_name": "ABCE1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P00973-1", "protein_name": "2'-5'-oligoadenylate synthase 1", "gene_name": "OAS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05014-1", "protein_name": "Interferon alpha-4", "gene_name": "IFNA4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q06124-2", "protein_name": "Tyrosine-protein phosphatase non-receptor type 11", "gene_name": "PTPN11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P29597-1", "protein_name": "Non-receptor tyrosine-protein kinase TYK2", "gene_name": "TYK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14543-1", "protein_name": "Suppressor of cytokine signaling 3", "gene_name": "SOCS3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DY56-1", "protein_name": "Interferon alpha-1", "gene_name": "IFNA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62979-1", "protein_name": "Ubiquitin-ribosomal protein eS31 fusion protein", "gene_name": "RPS27A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q10589-1", "protein_name": "Bone marrow stromal antigen 2", "gene_name": "BST2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15306-1", "protein_name": "Interferon regulatory factor 4", "gene_name": "IRF4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P55265-1", "protein_name": "Double-stranded RNA-specific adenosine deaminase", "gene_name": "ADAR", "tax_name": "Human" }, { "uniprot_canonical_ac": "P13164-1", "protein_name": "Interferon-induced transmembrane protein 1", "gene_name": "IFITM1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P40305-2", "protein_name": "Interferon alpha-inducible protein 27, mitochondrial", "gene_name": "IFI27", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01629-1", "protein_name": "Interferon-induced transmembrane protein 2", "gene_name": "IFITM2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01566-1", "protein_name": "Interferon alpha-10", "gene_name": "IFNA10", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01571-1", "protein_name": "Interferon alpha-17", "gene_name": "IFNA17", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01574-1", "protein_name": "Interferon beta", "gene_name": "IFNB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05015-1", "protein_name": "Interferon alpha-16", "gene_name": "IFNA16", "tax_name": "Human" }, { "uniprot_canonical_ac": "P28062-1", "protein_name": "Proteasome subunit beta type-8", "gene_name": "PSMB8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13325-1", "protein_name": "Interferon-induced protein with tetratricopeptide repeats 5", "gene_name": "IFIT5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P19525-1", "protein_name": "Interferon-induced, double-stranded RNA-activated protein kinase", "gene_name": "EIF2AK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG47-1", "protein_name": "Polyubiquitin-B", "gene_name": "UBB", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42224-1", "protein_name": "Signal transducer and activator of transcription 1-alpha/beta", "gene_name": "STAT1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P80217-1", "protein_name": "Interferon-induced 35 kDa protein", "gene_name": "IFI35", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62987-1", "protein_name": "Ubiquitin-ribosomal protein eL40 fusion protein", "gene_name": "UBA52", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01628-1", "protein_name": "Interferon-induced transmembrane protein 3", "gene_name": "IFITM3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y3Z3-1", "protein_name": "Deoxynucleoside triphosphate triphosphohydrolase SAMHD1", "gene_name": "SAMHD1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P32456-1", "protein_name": "Guanylate-binding protein 2", "gene_name": "GBP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q00978-1", "protein_name": "Interferon regulatory factor 9", "gene_name": "IRF9", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01893-1", "protein_name": "Putative HLA class I histocompatibility antigen, alpha chain H", "gene_name": "HLA-H", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05161-1", "protein_name": "Ubiquitin-like protein ISG15", "gene_name": "ISG15", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14974-1", "protein_name": "Importin subunit beta-1", "gene_name": "KPNB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P23458-1", "protein_name": "Tyrosine-protein kinase JAK1", "gene_name": "JAK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P17181-1", "protein_name": "Interferon alpha/beta receptor 1", "gene_name": "IFNAR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG48-1", "protein_name": "Polyubiquitin-C", "gene_name": "UBC", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01889-1", "protein_name": "HLA class I histocompatibility antigen, B alpha chain", "gene_name": "HLA-B", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P52294", "url": "https://www.uniprot.org/uniprotkb/P52294" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.32032529", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 74 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "COVID-19: combining antiviral and anti-inflammatory treatments.", "journal": "The Lancet. Infectious diseases", "date": "2020", "authors": "Stebbing J, Phelan A, Griffin I, Tucker C, Oechsle O, Smith D, Richardson P", "reference": { "type": "PubMed", "id": "32113509", "url": "https://pubmed.ncbi.nlm.nih.gov/32113509" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P52294-1", "protein_name": "Importin subunit alpha-5", "gene_name": "KPNA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P18146-1", "protein_name": "Early growth response protein 1", "gene_name": "EGR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15646-1", "protein_name": "2'-5'-oligoadenylate synthase-like protein", "gene_name": "OASL", "tax_name": "Human" }, { "uniprot_canonical_ac": "P29728-1", "protein_name": "2'-5'-oligoadenylate synthase 2", "gene_name": "OAS2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15524-1", "protein_name": "Suppressor of cytokine signaling 1", "gene_name": "SOCS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y6K5-1", "protein_name": "2'-5'-oligoadenylate synthase 3", "gene_name": "OAS3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q02556-1", "protein_name": "Interferon regulatory factor 8", "gene_name": "IRF8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96AZ6-1", "protein_name": "Interferon-stimulated gene 20 kDa protein", "gene_name": "ISG20", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14896-1", "protein_name": "Interferon regulatory factor 6", "gene_name": "IRF6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P30511-1", "protein_name": "HLA class I histocompatibility antigen, alpha chain F", "gene_name": "HLA-F", "tax_name": "Human" }, { "uniprot_canonical_ac": "P13747-1", "protein_name": "HLA class I histocompatibility antigen, alpha chain E", "gene_name": "HLA-E", "tax_name": "Human" }, { "uniprot_canonical_ac": "P17693-1", "protein_name": "HLA class I histocompatibility antigen, alpha chain G", "gene_name": "HLA-G", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01563-1", "protein_name": "Interferon alpha-2", "gene_name": "IFNA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01567-1", "protein_name": "Interferon alpha-7", "gene_name": "IFNA7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01568-1", "protein_name": "Interferon alpha-21", "gene_name": "IFNA21", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01569-1", "protein_name": "Interferon alpha-5", "gene_name": "IFNA5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01570-1", "protein_name": "Interferon alpha-14", "gene_name": "IFNA14", "tax_name": "Human" }, { "uniprot_canonical_ac": "P09914-1", "protein_name": "Antiviral innate immune response effector IFIT1", "gene_name": "IFIT1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P32881-1", "protein_name": "Interferon alpha-8", "gene_name": "IFNA8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UHH9-1", "protein_name": "Inositol hexakisphosphate kinase 2", "gene_name": "IP6K2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05013-1", "protein_name": "Interferon alpha-6", "gene_name": "IFNA6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P09913-1", "protein_name": "Interferon-induced protein with tetratricopeptide repeats 2", "gene_name": "IFIT2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8WXG1-1", "protein_name": "S-adenosylmethionine-dependent nucleotide dehydratase RSAD2", "gene_name": "RSAD2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P20592-1", "protein_name": "Interferon-induced GTP-binding protein Mx2", "gene_name": "MX2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P14316-1", "protein_name": "Interferon regulatory factor 2", "gene_name": "IRF2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P29350-1", "protein_name": "Tyrosine-protein phosphatase non-receptor type 6", "gene_name": "PTPN6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14653-1", "protein_name": "Interferon regulatory factor 3", "gene_name": "IRF3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P20591-1", "protein_name": "Interferon-induced GTP-binding protein Mx1", "gene_name": "MX1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13568-1", "protein_name": "Interferon regulatory factor 5", "gene_name": "IRF5", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14879-1", "protein_name": "Interferon-induced protein with tetratricopeptide repeats 3", "gene_name": "IFIT3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q05823-1", "protein_name": "2-5A-dependent ribonuclease", "gene_name": "RNASEL", "tax_name": "Human" }, { "uniprot_canonical_ac": "P10914-1", "protein_name": "Interferon regulatory factor 1", "gene_name": "IRF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6GPH4-1", "protein_name": "XIAP-associated factor 1", "gene_name": "XAF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P52630-3", "protein_name": "Signal transducer and activator of transcription 2", "gene_name": "STAT2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P09912-1", "protein_name": "Interferon alpha-inducible protein 6", "gene_name": "IFI6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P10321-1", "protein_name": "HLA class I histocompatibility antigen, C alpha chain", "gene_name": "HLA-C", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04439-1", "protein_name": "HLA class I histocompatibility antigen, A alpha chain", "gene_name": "HLA-A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92985-1", "protein_name": "Interferon regulatory factor 7", "gene_name": "IRF7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61221-1", "protein_name": "ATP-binding cassette sub-family E member 1", "gene_name": "ABCE1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P00973-1", "protein_name": "2'-5'-oligoadenylate synthase 1", "gene_name": "OAS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05014-1", "protein_name": "Interferon alpha-4", "gene_name": "IFNA4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q06124-2", "protein_name": "Tyrosine-protein phosphatase non-receptor type 11", "gene_name": "PTPN11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P29597-1", "protein_name": "Non-receptor tyrosine-protein kinase TYK2", "gene_name": "TYK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14543-1", "protein_name": "Suppressor of cytokine signaling 3", "gene_name": "SOCS3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DY56-1", "protein_name": "Interferon alpha-1", "gene_name": "IFNA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62979-1", "protein_name": "Ubiquitin-ribosomal protein eS31 fusion protein", "gene_name": "RPS27A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q10589-1", "protein_name": "Bone marrow stromal antigen 2", "gene_name": "BST2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15306-1", "protein_name": "Interferon regulatory factor 4", "gene_name": "IRF4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P55265-1", "protein_name": "Double-stranded RNA-specific adenosine deaminase", "gene_name": "ADAR", "tax_name": "Human" }, { "uniprot_canonical_ac": "P13164-1", "protein_name": "Interferon-induced transmembrane protein 1", "gene_name": "IFITM1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P40305-2", "protein_name": "Interferon alpha-inducible protein 27, mitochondrial", "gene_name": "IFI27", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01629-1", "protein_name": "Interferon-induced transmembrane protein 2", "gene_name": "IFITM2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01566-1", "protein_name": "Interferon alpha-10", "gene_name": "IFNA10", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01571-1", "protein_name": "Interferon alpha-17", "gene_name": "IFNA17", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01574-1", "protein_name": "Interferon beta", "gene_name": "IFNB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05015-1", "protein_name": "Interferon alpha-16", "gene_name": "IFNA16", "tax_name": "Human" }, { "uniprot_canonical_ac": "P28062-1", "protein_name": "Proteasome subunit beta type-8", "gene_name": "PSMB8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13325-1", "protein_name": "Interferon-induced protein with tetratricopeptide repeats 5", "gene_name": "IFIT5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P19525-1", "protein_name": "Interferon-induced, double-stranded RNA-activated protein kinase", "gene_name": "EIF2AK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG47-1", "protein_name": "Polyubiquitin-B", "gene_name": "UBB", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42224-1", "protein_name": "Signal transducer and activator of transcription 1-alpha/beta", "gene_name": "STAT1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P80217-1", "protein_name": "Interferon-induced 35 kDa protein", "gene_name": "IFI35", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62987-1", "protein_name": "Ubiquitin-ribosomal protein eL40 fusion protein", "gene_name": "UBA52", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01628-1", "protein_name": "Interferon-induced transmembrane protein 3", "gene_name": "IFITM3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y3Z3-1", "protein_name": "Deoxynucleoside triphosphate triphosphohydrolase SAMHD1", "gene_name": "SAMHD1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P32456-1", "protein_name": "Guanylate-binding protein 2", "gene_name": "GBP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q00978-1", "protein_name": "Interferon regulatory factor 9", "gene_name": "IRF9", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01893-1", "protein_name": "Putative HLA class I histocompatibility antigen, alpha chain H", "gene_name": "HLA-H", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05161-1", "protein_name": "Ubiquitin-like protein ISG15", "gene_name": "ISG15", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14974-1", "protein_name": "Importin subunit beta-1", "gene_name": "KPNB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P23458-1", "protein_name": "Tyrosine-protein kinase JAK1", "gene_name": "JAK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P17181-1", "protein_name": "Interferon alpha/beta receptor 1", "gene_name": "IFNAR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG48-1", "protein_name": "Polyubiquitin-C", "gene_name": "UBC", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01889-1", "protein_name": "HLA class I histocompatibility antigen, B alpha chain", "gene_name": "HLA-B", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P52294", "url": "https://www.uniprot.org/uniprotkb/P52294" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.32113509", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 74 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Discovery of a Janus Kinase Inhibitor Bearing a Highly Three-Dimensional Spiro Scaffold: JTE-052 (Delgocitinib) as a New Dermatological Agent to Treat Inflammatory Skin Disorders.", "journal": "Journal of medicinal chemistry", "date": "2020", "authors": "Noji S, Hara Y, Miura T, Yamanaka H, Maeda K, Hori A, Yamamoto H, Obika S, Inoue M, Hase Y, Orita T, Doi S, Adachi T, Tanimoto A, Oki C, Kimoto Y, Ogawa Y, Negoro T, Hashimoto H, Shiozaki M", "reference": { "type": "PubMed", "id": "32511913", "url": "https://pubmed.ncbi.nlm.nih.gov/32511913" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P52294-1", "protein_name": "Importin subunit alpha-5", "gene_name": "KPNA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P18146-1", "protein_name": "Early growth response protein 1", "gene_name": "EGR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15646-1", "protein_name": "2'-5'-oligoadenylate synthase-like protein", "gene_name": "OASL", "tax_name": "Human" }, { "uniprot_canonical_ac": "P29728-1", "protein_name": "2'-5'-oligoadenylate synthase 2", "gene_name": "OAS2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15524-1", "protein_name": "Suppressor of cytokine signaling 1", "gene_name": "SOCS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y6K5-1", "protein_name": "2'-5'-oligoadenylate synthase 3", "gene_name": "OAS3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q02556-1", "protein_name": "Interferon regulatory factor 8", "gene_name": "IRF8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96AZ6-1", "protein_name": "Interferon-stimulated gene 20 kDa protein", "gene_name": "ISG20", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14896-1", "protein_name": "Interferon regulatory factor 6", "gene_name": "IRF6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P30511-1", "protein_name": "HLA class I histocompatibility antigen, alpha chain F", "gene_name": "HLA-F", "tax_name": "Human" }, { "uniprot_canonical_ac": "P13747-1", "protein_name": "HLA class I histocompatibility antigen, alpha chain E", "gene_name": "HLA-E", "tax_name": "Human" }, { "uniprot_canonical_ac": "P17693-1", "protein_name": "HLA class I histocompatibility antigen, alpha chain G", "gene_name": "HLA-G", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01563-1", "protein_name": "Interferon alpha-2", "gene_name": "IFNA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01567-1", "protein_name": "Interferon alpha-7", "gene_name": "IFNA7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01568-1", "protein_name": "Interferon alpha-21", "gene_name": "IFNA21", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01569-1", "protein_name": "Interferon alpha-5", "gene_name": "IFNA5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01570-1", "protein_name": "Interferon alpha-14", "gene_name": "IFNA14", "tax_name": "Human" }, { "uniprot_canonical_ac": "P09914-1", "protein_name": "Antiviral innate immune response effector IFIT1", "gene_name": "IFIT1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P32881-1", "protein_name": "Interferon alpha-8", "gene_name": "IFNA8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UHH9-1", "protein_name": "Inositol hexakisphosphate kinase 2", "gene_name": "IP6K2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05013-1", "protein_name": "Interferon alpha-6", "gene_name": "IFNA6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P09913-1", "protein_name": "Interferon-induced protein with tetratricopeptide repeats 2", "gene_name": "IFIT2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8WXG1-1", "protein_name": "S-adenosylmethionine-dependent nucleotide dehydratase RSAD2", "gene_name": "RSAD2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P20592-1", "protein_name": "Interferon-induced GTP-binding protein Mx2", "gene_name": "MX2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P14316-1", "protein_name": "Interferon regulatory factor 2", "gene_name": "IRF2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P29350-1", "protein_name": "Tyrosine-protein phosphatase non-receptor type 6", "gene_name": "PTPN6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14653-1", "protein_name": "Interferon regulatory factor 3", "gene_name": "IRF3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P20591-1", "protein_name": "Interferon-induced GTP-binding protein Mx1", "gene_name": "MX1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13568-1", "protein_name": "Interferon regulatory factor 5", "gene_name": "IRF5", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14879-1", "protein_name": "Interferon-induced protein with tetratricopeptide repeats 3", "gene_name": "IFIT3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q05823-1", "protein_name": "2-5A-dependent ribonuclease", "gene_name": "RNASEL", "tax_name": "Human" }, { "uniprot_canonical_ac": "P10914-1", "protein_name": "Interferon regulatory factor 1", "gene_name": "IRF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6GPH4-1", "protein_name": "XIAP-associated factor 1", "gene_name": "XAF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P52630-3", "protein_name": "Signal transducer and activator of transcription 2", "gene_name": "STAT2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P09912-1", "protein_name": "Interferon alpha-inducible protein 6", "gene_name": "IFI6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P10321-1", "protein_name": "HLA class I histocompatibility antigen, C alpha chain", "gene_name": "HLA-C", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04439-1", "protein_name": "HLA class I histocompatibility antigen, A alpha chain", "gene_name": "HLA-A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92985-1", "protein_name": "Interferon regulatory factor 7", "gene_name": "IRF7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61221-1", "protein_name": "ATP-binding cassette sub-family E member 1", "gene_name": "ABCE1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P00973-1", "protein_name": "2'-5'-oligoadenylate synthase 1", "gene_name": "OAS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05014-1", "protein_name": "Interferon alpha-4", "gene_name": "IFNA4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q06124-2", "protein_name": "Tyrosine-protein phosphatase non-receptor type 11", "gene_name": "PTPN11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P29597-1", "protein_name": "Non-receptor tyrosine-protein kinase TYK2", "gene_name": "TYK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14543-1", "protein_name": "Suppressor of cytokine signaling 3", "gene_name": "SOCS3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DY56-1", "protein_name": "Interferon alpha-1", "gene_name": "IFNA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62979-1", "protein_name": "Ubiquitin-ribosomal protein eS31 fusion protein", "gene_name": "RPS27A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q10589-1", "protein_name": "Bone marrow stromal antigen 2", "gene_name": "BST2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15306-1", "protein_name": "Interferon regulatory factor 4", "gene_name": "IRF4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P55265-1", "protein_name": "Double-stranded RNA-specific adenosine deaminase", "gene_name": "ADAR", "tax_name": "Human" }, { "uniprot_canonical_ac": "P13164-1", "protein_name": "Interferon-induced transmembrane protein 1", "gene_name": "IFITM1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P40305-2", "protein_name": "Interferon alpha-inducible protein 27, mitochondrial", "gene_name": "IFI27", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01629-1", "protein_name": "Interferon-induced transmembrane protein 2", "gene_name": "IFITM2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01566-1", "protein_name": "Interferon alpha-10", "gene_name": "IFNA10", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01571-1", "protein_name": "Interferon alpha-17", "gene_name": "IFNA17", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01574-1", "protein_name": "Interferon beta", "gene_name": "IFNB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05015-1", "protein_name": "Interferon alpha-16", "gene_name": "IFNA16", "tax_name": "Human" }, { "uniprot_canonical_ac": "P28062-1", "protein_name": "Proteasome subunit beta type-8", "gene_name": "PSMB8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13325-1", "protein_name": "Interferon-induced protein with tetratricopeptide repeats 5", "gene_name": "IFIT5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P19525-1", "protein_name": "Interferon-induced, double-stranded RNA-activated protein kinase", "gene_name": "EIF2AK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG47-1", "protein_name": "Polyubiquitin-B", "gene_name": "UBB", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42224-1", "protein_name": "Signal transducer and activator of transcription 1-alpha/beta", "gene_name": "STAT1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P80217-1", "protein_name": "Interferon-induced 35 kDa protein", "gene_name": "IFI35", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62987-1", "protein_name": "Ubiquitin-ribosomal protein eL40 fusion protein", "gene_name": "UBA52", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01628-1", "protein_name": "Interferon-induced transmembrane protein 3", "gene_name": "IFITM3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y3Z3-1", "protein_name": "Deoxynucleoside triphosphate triphosphohydrolase SAMHD1", "gene_name": "SAMHD1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P32456-1", "protein_name": "Guanylate-binding protein 2", "gene_name": "GBP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q00978-1", "protein_name": "Interferon regulatory factor 9", "gene_name": "IRF9", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01893-1", "protein_name": "Putative HLA class I histocompatibility antigen, alpha chain H", "gene_name": "HLA-H", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05161-1", "protein_name": "Ubiquitin-like protein ISG15", "gene_name": "ISG15", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14974-1", "protein_name": "Importin subunit beta-1", "gene_name": "KPNB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P23458-1", "protein_name": "Tyrosine-protein kinase JAK1", "gene_name": "JAK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P17181-1", "protein_name": "Interferon alpha/beta receptor 1", "gene_name": "IFNAR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG48-1", "protein_name": "Polyubiquitin-C", "gene_name": "UBC", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01889-1", "protein_name": "HLA class I histocompatibility antigen, B alpha chain", "gene_name": "HLA-B", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P52294", "url": "https://www.uniprot.org/uniprotkb/P52294" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.32511913", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 74 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Interferon-alpha2b Treatment for COVID-19.", "journal": "Frontiers in immunology", "date": "2020", "authors": "Zhou Q, Chen V, Shannon CP, Wei XS, Xiang X, Wang X, Wang ZH, Tebbutt SJ, Kollmann TR, Fish EN", "reference": { "type": "PubMed", "id": "32574262", "url": "https://pubmed.ncbi.nlm.nih.gov/32574262" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P52294-1", "protein_name": "Importin subunit alpha-5", "gene_name": "KPNA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P18146-1", "protein_name": "Early growth response protein 1", "gene_name": "EGR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15646-1", "protein_name": "2'-5'-oligoadenylate synthase-like protein", "gene_name": "OASL", "tax_name": "Human" }, { "uniprot_canonical_ac": "P29728-1", "protein_name": "2'-5'-oligoadenylate synthase 2", "gene_name": "OAS2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15524-1", "protein_name": "Suppressor of cytokine signaling 1", "gene_name": "SOCS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y6K5-1", "protein_name": "2'-5'-oligoadenylate synthase 3", "gene_name": "OAS3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q02556-1", "protein_name": "Interferon regulatory factor 8", "gene_name": "IRF8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96AZ6-1", "protein_name": "Interferon-stimulated gene 20 kDa protein", "gene_name": "ISG20", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14896-1", "protein_name": "Interferon regulatory factor 6", "gene_name": "IRF6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P30511-1", "protein_name": "HLA class I histocompatibility antigen, alpha chain F", "gene_name": "HLA-F", "tax_name": "Human" }, { "uniprot_canonical_ac": "P13747-1", "protein_name": "HLA class I histocompatibility antigen, alpha chain E", "gene_name": "HLA-E", "tax_name": "Human" }, { "uniprot_canonical_ac": "P17693-1", "protein_name": "HLA class I histocompatibility antigen, alpha chain G", "gene_name": "HLA-G", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01563-1", "protein_name": "Interferon alpha-2", "gene_name": "IFNA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01567-1", "protein_name": "Interferon alpha-7", "gene_name": "IFNA7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01568-1", "protein_name": "Interferon alpha-21", "gene_name": "IFNA21", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01569-1", "protein_name": "Interferon alpha-5", "gene_name": "IFNA5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01570-1", "protein_name": "Interferon alpha-14", "gene_name": "IFNA14", "tax_name": "Human" }, { "uniprot_canonical_ac": "P09914-1", "protein_name": "Antiviral innate immune response effector IFIT1", "gene_name": "IFIT1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P32881-1", "protein_name": "Interferon alpha-8", "gene_name": "IFNA8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UHH9-1", "protein_name": "Inositol hexakisphosphate kinase 2", "gene_name": "IP6K2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05013-1", "protein_name": "Interferon alpha-6", "gene_name": "IFNA6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P09913-1", "protein_name": "Interferon-induced protein with tetratricopeptide repeats 2", "gene_name": "IFIT2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8WXG1-1", "protein_name": "S-adenosylmethionine-dependent nucleotide dehydratase RSAD2", "gene_name": "RSAD2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P20592-1", "protein_name": "Interferon-induced GTP-binding protein Mx2", "gene_name": "MX2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P14316-1", "protein_name": "Interferon regulatory factor 2", "gene_name": "IRF2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P29350-1", "protein_name": "Tyrosine-protein phosphatase non-receptor type 6", "gene_name": "PTPN6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14653-1", "protein_name": "Interferon regulatory factor 3", "gene_name": "IRF3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P20591-1", "protein_name": "Interferon-induced GTP-binding protein Mx1", "gene_name": "MX1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13568-1", "protein_name": "Interferon regulatory factor 5", "gene_name": "IRF5", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14879-1", "protein_name": "Interferon-induced protein with tetratricopeptide repeats 3", "gene_name": "IFIT3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q05823-1", "protein_name": "2-5A-dependent ribonuclease", "gene_name": "RNASEL", "tax_name": "Human" }, { "uniprot_canonical_ac": "P10914-1", "protein_name": "Interferon regulatory factor 1", "gene_name": "IRF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6GPH4-1", "protein_name": "XIAP-associated factor 1", "gene_name": "XAF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P52630-3", "protein_name": "Signal transducer and activator of transcription 2", "gene_name": "STAT2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P09912-1", "protein_name": "Interferon alpha-inducible protein 6", "gene_name": "IFI6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P10321-1", "protein_name": "HLA class I histocompatibility antigen, C alpha chain", "gene_name": "HLA-C", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04439-1", "protein_name": "HLA class I histocompatibility antigen, A alpha chain", "gene_name": "HLA-A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92985-1", "protein_name": "Interferon regulatory factor 7", "gene_name": "IRF7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61221-1", "protein_name": "ATP-binding cassette sub-family E member 1", "gene_name": "ABCE1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P00973-1", "protein_name": "2'-5'-oligoadenylate synthase 1", "gene_name": "OAS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05014-1", "protein_name": "Interferon alpha-4", "gene_name": "IFNA4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q06124-2", "protein_name": "Tyrosine-protein phosphatase non-receptor type 11", "gene_name": "PTPN11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P29597-1", "protein_name": "Non-receptor tyrosine-protein kinase TYK2", "gene_name": "TYK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14543-1", "protein_name": "Suppressor of cytokine signaling 3", "gene_name": "SOCS3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DY56-1", "protein_name": "Interferon alpha-1", "gene_name": "IFNA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62979-1", "protein_name": "Ubiquitin-ribosomal protein eS31 fusion protein", "gene_name": "RPS27A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q10589-1", "protein_name": "Bone marrow stromal antigen 2", "gene_name": "BST2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15306-1", "protein_name": "Interferon regulatory factor 4", "gene_name": "IRF4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P55265-1", "protein_name": "Double-stranded RNA-specific adenosine deaminase", "gene_name": "ADAR", "tax_name": "Human" }, { "uniprot_canonical_ac": "P13164-1", "protein_name": "Interferon-induced transmembrane protein 1", "gene_name": "IFITM1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P40305-2", "protein_name": "Interferon alpha-inducible protein 27, mitochondrial", "gene_name": "IFI27", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01629-1", "protein_name": "Interferon-induced transmembrane protein 2", "gene_name": "IFITM2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01566-1", "protein_name": "Interferon alpha-10", "gene_name": "IFNA10", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01571-1", "protein_name": "Interferon alpha-17", "gene_name": "IFNA17", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01574-1", "protein_name": "Interferon beta", "gene_name": "IFNB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05015-1", "protein_name": "Interferon alpha-16", "gene_name": "IFNA16", "tax_name": "Human" }, { "uniprot_canonical_ac": "P28062-1", "protein_name": "Proteasome subunit beta type-8", "gene_name": "PSMB8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13325-1", "protein_name": "Interferon-induced protein with tetratricopeptide repeats 5", "gene_name": "IFIT5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P19525-1", "protein_name": "Interferon-induced, double-stranded RNA-activated protein kinase", "gene_name": "EIF2AK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG47-1", "protein_name": "Polyubiquitin-B", "gene_name": "UBB", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42224-1", "protein_name": "Signal transducer and activator of transcription 1-alpha/beta", "gene_name": "STAT1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P80217-1", "protein_name": "Interferon-induced 35 kDa protein", "gene_name": "IFI35", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62987-1", "protein_name": "Ubiquitin-ribosomal protein eL40 fusion protein", "gene_name": "UBA52", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01628-1", "protein_name": "Interferon-induced transmembrane protein 3", "gene_name": "IFITM3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y3Z3-1", "protein_name": "Deoxynucleoside triphosphate triphosphohydrolase SAMHD1", "gene_name": "SAMHD1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P32456-1", "protein_name": "Guanylate-binding protein 2", "gene_name": "GBP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q00978-1", "protein_name": "Interferon regulatory factor 9", "gene_name": "IRF9", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01893-1", "protein_name": "Putative HLA class I histocompatibility antigen, alpha chain H", "gene_name": "HLA-H", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05161-1", "protein_name": "Ubiquitin-like protein ISG15", "gene_name": "ISG15", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14974-1", "protein_name": "Importin subunit beta-1", "gene_name": "KPNB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P23458-1", "protein_name": "Tyrosine-protein kinase JAK1", "gene_name": "JAK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P17181-1", "protein_name": "Interferon alpha/beta receptor 1", "gene_name": "IFNAR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG48-1", "protein_name": "Polyubiquitin-C", "gene_name": "UBC", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01889-1", "protein_name": "HLA class I histocompatibility antigen, B alpha chain", "gene_name": "HLA-B", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P52294", "url": "https://www.uniprot.org/uniprotkb/P52294" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.32574262", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 74 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "A Randomized Clinical Trial of the Efficacy and Safety of Interferon beta-1a in Treatment of Severe COVID-19.", "journal": "Antimicrobial agents and chemotherapy", "date": "2020", "authors": "Davoudi-Monfared E, Rahmani H, Khalili H, Hajiabdolbaghi M, Salehi M, Abbasian L, Kazemzadeh H, Yekaninejad MS", "reference": { "type": "PubMed", "id": "32661006", "url": "https://pubmed.ncbi.nlm.nih.gov/32661006" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P52294-1", "protein_name": "Importin subunit alpha-5", "gene_name": "KPNA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P18146-1", "protein_name": "Early growth response protein 1", "gene_name": "EGR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15646-1", "protein_name": "2'-5'-oligoadenylate synthase-like protein", "gene_name": "OASL", "tax_name": "Human" }, { "uniprot_canonical_ac": "P29728-1", "protein_name": "2'-5'-oligoadenylate synthase 2", "gene_name": "OAS2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15524-1", "protein_name": "Suppressor of cytokine signaling 1", "gene_name": "SOCS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y6K5-1", "protein_name": "2'-5'-oligoadenylate synthase 3", "gene_name": "OAS3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q02556-1", "protein_name": "Interferon regulatory factor 8", "gene_name": "IRF8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96AZ6-1", "protein_name": "Interferon-stimulated gene 20 kDa protein", "gene_name": "ISG20", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14896-1", "protein_name": "Interferon regulatory factor 6", "gene_name": "IRF6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P30511-1", "protein_name": "HLA class I histocompatibility antigen, alpha chain F", "gene_name": "HLA-F", "tax_name": "Human" }, { "uniprot_canonical_ac": "P13747-1", "protein_name": "HLA class I histocompatibility antigen, alpha chain E", "gene_name": "HLA-E", "tax_name": "Human" }, { "uniprot_canonical_ac": "P17693-1", "protein_name": "HLA class I histocompatibility antigen, alpha chain G", "gene_name": "HLA-G", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01563-1", "protein_name": "Interferon alpha-2", "gene_name": "IFNA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01567-1", "protein_name": "Interferon alpha-7", "gene_name": "IFNA7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01568-1", "protein_name": "Interferon alpha-21", "gene_name": "IFNA21", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01569-1", "protein_name": "Interferon alpha-5", "gene_name": "IFNA5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01570-1", "protein_name": "Interferon alpha-14", "gene_name": "IFNA14", "tax_name": "Human" }, { "uniprot_canonical_ac": "P09914-1", "protein_name": "Antiviral innate immune response effector IFIT1", "gene_name": "IFIT1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P32881-1", "protein_name": "Interferon alpha-8", "gene_name": "IFNA8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UHH9-1", "protein_name": "Inositol hexakisphosphate kinase 2", "gene_name": "IP6K2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05013-1", "protein_name": "Interferon alpha-6", "gene_name": "IFNA6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P09913-1", "protein_name": "Interferon-induced protein with tetratricopeptide repeats 2", "gene_name": "IFIT2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8WXG1-1", "protein_name": "S-adenosylmethionine-dependent nucleotide dehydratase RSAD2", "gene_name": "RSAD2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P20592-1", "protein_name": "Interferon-induced GTP-binding protein Mx2", "gene_name": "MX2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P14316-1", "protein_name": "Interferon regulatory factor 2", "gene_name": "IRF2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P29350-1", "protein_name": "Tyrosine-protein phosphatase non-receptor type 6", "gene_name": "PTPN6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14653-1", "protein_name": "Interferon regulatory factor 3", "gene_name": "IRF3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P20591-1", "protein_name": "Interferon-induced GTP-binding protein Mx1", "gene_name": "MX1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13568-1", "protein_name": "Interferon regulatory factor 5", "gene_name": "IRF5", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14879-1", "protein_name": "Interferon-induced protein with tetratricopeptide repeats 3", "gene_name": "IFIT3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q05823-1", "protein_name": "2-5A-dependent ribonuclease", "gene_name": "RNASEL", "tax_name": "Human" }, { "uniprot_canonical_ac": "P10914-1", "protein_name": "Interferon regulatory factor 1", "gene_name": "IRF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6GPH4-1", "protein_name": "XIAP-associated factor 1", "gene_name": "XAF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P52630-3", "protein_name": "Signal transducer and activator of transcription 2", "gene_name": "STAT2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P09912-1", "protein_name": "Interferon alpha-inducible protein 6", "gene_name": "IFI6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P10321-1", "protein_name": "HLA class I histocompatibility antigen, C alpha chain", "gene_name": "HLA-C", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04439-1", "protein_name": "HLA class I histocompatibility antigen, A alpha chain", "gene_name": "HLA-A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92985-1", "protein_name": "Interferon regulatory factor 7", "gene_name": "IRF7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61221-1", "protein_name": "ATP-binding cassette sub-family E member 1", "gene_name": "ABCE1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P00973-1", "protein_name": "2'-5'-oligoadenylate synthase 1", "gene_name": "OAS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05014-1", "protein_name": "Interferon alpha-4", "gene_name": "IFNA4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q06124-2", "protein_name": "Tyrosine-protein phosphatase non-receptor type 11", "gene_name": "PTPN11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P29597-1", "protein_name": "Non-receptor tyrosine-protein kinase TYK2", "gene_name": "TYK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14543-1", "protein_name": "Suppressor of cytokine signaling 3", "gene_name": "SOCS3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DY56-1", "protein_name": "Interferon alpha-1", "gene_name": "IFNA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62979-1", "protein_name": "Ubiquitin-ribosomal protein eS31 fusion protein", "gene_name": "RPS27A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q10589-1", "protein_name": "Bone marrow stromal antigen 2", "gene_name": "BST2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15306-1", "protein_name": "Interferon regulatory factor 4", "gene_name": "IRF4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P55265-1", "protein_name": "Double-stranded RNA-specific adenosine deaminase", "gene_name": "ADAR", "tax_name": "Human" }, { "uniprot_canonical_ac": "P13164-1", "protein_name": "Interferon-induced transmembrane protein 1", "gene_name": "IFITM1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P40305-2", "protein_name": "Interferon alpha-inducible protein 27, mitochondrial", "gene_name": "IFI27", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01629-1", "protein_name": "Interferon-induced transmembrane protein 2", "gene_name": "IFITM2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01566-1", "protein_name": "Interferon alpha-10", "gene_name": "IFNA10", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01571-1", "protein_name": "Interferon alpha-17", "gene_name": "IFNA17", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01574-1", "protein_name": "Interferon beta", "gene_name": "IFNB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05015-1", "protein_name": "Interferon alpha-16", "gene_name": "IFNA16", "tax_name": "Human" }, { "uniprot_canonical_ac": "P28062-1", "protein_name": "Proteasome subunit beta type-8", "gene_name": "PSMB8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13325-1", "protein_name": "Interferon-induced protein with tetratricopeptide repeats 5", "gene_name": "IFIT5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P19525-1", "protein_name": "Interferon-induced, double-stranded RNA-activated protein kinase", "gene_name": "EIF2AK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG47-1", "protein_name": "Polyubiquitin-B", "gene_name": "UBB", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42224-1", "protein_name": "Signal transducer and activator of transcription 1-alpha/beta", "gene_name": "STAT1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P80217-1", "protein_name": "Interferon-induced 35 kDa protein", "gene_name": "IFI35", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62987-1", "protein_name": "Ubiquitin-ribosomal protein eL40 fusion protein", "gene_name": "UBA52", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01628-1", "protein_name": "Interferon-induced transmembrane protein 3", "gene_name": "IFITM3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y3Z3-1", "protein_name": "Deoxynucleoside triphosphate triphosphohydrolase SAMHD1", "gene_name": "SAMHD1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P32456-1", "protein_name": "Guanylate-binding protein 2", "gene_name": "GBP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q00978-1", "protein_name": "Interferon regulatory factor 9", "gene_name": "IRF9", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01893-1", "protein_name": "Putative HLA class I histocompatibility antigen, alpha chain H", "gene_name": "HLA-H", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05161-1", "protein_name": "Ubiquitin-like protein ISG15", "gene_name": "ISG15", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14974-1", "protein_name": "Importin subunit beta-1", "gene_name": "KPNB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P23458-1", "protein_name": "Tyrosine-protein kinase JAK1", "gene_name": "JAK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P17181-1", "protein_name": "Interferon alpha/beta receptor 1", "gene_name": "IFNAR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG48-1", "protein_name": "Polyubiquitin-C", "gene_name": "UBC", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01889-1", "protein_name": "HLA class I histocompatibility antigen, B alpha chain", "gene_name": "HLA-B", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P52294", "url": "https://www.uniprot.org/uniprotkb/P52294" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.32661006", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 74 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "SARS-CoV-2 clearance in COVID-19 patients with Novaferon treatment: A randomized, open-label, parallel-group trial.", "journal": "International journal of infectious diseases : IJID : official publication of the International Society for Infectious Diseases", "date": "2020", "authors": "Zheng F, Zhou Y, Zhou Z, Ye F, Huang B, Huang Y, Ma J, Zuo Q, Tan X, Xie J, Niu P, Wang W, Xu Y, Peng F, Zhou N, Cai C, Tang W, Xiao X, Li Y, Zhou Z, Jiang Y, Xie Y, Tan W, Gong G", "reference": { "type": "PubMed", "id": "32758689", "url": "https://pubmed.ncbi.nlm.nih.gov/32758689" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P52294-1", "protein_name": "Importin subunit alpha-5", "gene_name": "KPNA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P18146-1", "protein_name": "Early growth response protein 1", "gene_name": "EGR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15646-1", "protein_name": "2'-5'-oligoadenylate synthase-like protein", "gene_name": "OASL", "tax_name": "Human" }, { "uniprot_canonical_ac": "P29728-1", "protein_name": "2'-5'-oligoadenylate synthase 2", "gene_name": "OAS2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15524-1", "protein_name": "Suppressor of cytokine signaling 1", "gene_name": "SOCS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y6K5-1", "protein_name": "2'-5'-oligoadenylate synthase 3", "gene_name": "OAS3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q02556-1", "protein_name": "Interferon regulatory factor 8", "gene_name": "IRF8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96AZ6-1", "protein_name": "Interferon-stimulated gene 20 kDa protein", "gene_name": "ISG20", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14896-1", "protein_name": "Interferon regulatory factor 6", "gene_name": "IRF6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P30511-1", "protein_name": "HLA class I histocompatibility antigen, alpha chain F", "gene_name": "HLA-F", "tax_name": "Human" }, { "uniprot_canonical_ac": "P13747-1", "protein_name": "HLA class I histocompatibility antigen, alpha chain E", "gene_name": "HLA-E", "tax_name": "Human" }, { "uniprot_canonical_ac": "P17693-1", "protein_name": "HLA class I histocompatibility antigen, alpha chain G", "gene_name": "HLA-G", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01563-1", "protein_name": "Interferon alpha-2", "gene_name": "IFNA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01567-1", "protein_name": "Interferon alpha-7", "gene_name": "IFNA7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01568-1", "protein_name": "Interferon alpha-21", "gene_name": "IFNA21", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01569-1", "protein_name": "Interferon alpha-5", "gene_name": "IFNA5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01570-1", "protein_name": "Interferon alpha-14", "gene_name": "IFNA14", "tax_name": "Human" }, { "uniprot_canonical_ac": "P09914-1", "protein_name": "Antiviral innate immune response effector IFIT1", "gene_name": "IFIT1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P32881-1", "protein_name": "Interferon alpha-8", "gene_name": "IFNA8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UHH9-1", "protein_name": "Inositol hexakisphosphate kinase 2", "gene_name": "IP6K2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05013-1", "protein_name": "Interferon alpha-6", "gene_name": "IFNA6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P09913-1", "protein_name": "Interferon-induced protein with tetratricopeptide repeats 2", "gene_name": "IFIT2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8WXG1-1", "protein_name": "S-adenosylmethionine-dependent nucleotide dehydratase RSAD2", "gene_name": "RSAD2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P20592-1", "protein_name": "Interferon-induced GTP-binding protein Mx2", "gene_name": "MX2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P14316-1", "protein_name": "Interferon regulatory factor 2", "gene_name": "IRF2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P29350-1", "protein_name": "Tyrosine-protein phosphatase non-receptor type 6", "gene_name": "PTPN6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14653-1", "protein_name": "Interferon regulatory factor 3", "gene_name": "IRF3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P20591-1", "protein_name": "Interferon-induced GTP-binding protein Mx1", "gene_name": "MX1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13568-1", "protein_name": "Interferon regulatory factor 5", "gene_name": "IRF5", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14879-1", "protein_name": "Interferon-induced protein with tetratricopeptide repeats 3", "gene_name": "IFIT3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q05823-1", "protein_name": "2-5A-dependent ribonuclease", "gene_name": "RNASEL", "tax_name": "Human" }, { "uniprot_canonical_ac": "P10914-1", "protein_name": "Interferon regulatory factor 1", "gene_name": "IRF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6GPH4-1", "protein_name": "XIAP-associated factor 1", "gene_name": "XAF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P52630-3", "protein_name": "Signal transducer and activator of transcription 2", "gene_name": "STAT2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P09912-1", "protein_name": "Interferon alpha-inducible protein 6", "gene_name": "IFI6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P10321-1", "protein_name": "HLA class I histocompatibility antigen, C alpha chain", "gene_name": "HLA-C", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04439-1", "protein_name": "HLA class I histocompatibility antigen, A alpha chain", "gene_name": "HLA-A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92985-1", "protein_name": "Interferon regulatory factor 7", "gene_name": "IRF7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61221-1", "protein_name": "ATP-binding cassette sub-family E member 1", "gene_name": "ABCE1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P00973-1", "protein_name": "2'-5'-oligoadenylate synthase 1", "gene_name": "OAS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05014-1", "protein_name": "Interferon alpha-4", "gene_name": "IFNA4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q06124-2", "protein_name": "Tyrosine-protein phosphatase non-receptor type 11", "gene_name": "PTPN11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P29597-1", "protein_name": "Non-receptor tyrosine-protein kinase TYK2", "gene_name": "TYK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14543-1", "protein_name": "Suppressor of cytokine signaling 3", "gene_name": "SOCS3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DY56-1", "protein_name": "Interferon alpha-1", "gene_name": "IFNA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62979-1", "protein_name": "Ubiquitin-ribosomal protein eS31 fusion protein", "gene_name": "RPS27A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q10589-1", "protein_name": "Bone marrow stromal antigen 2", "gene_name": "BST2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15306-1", "protein_name": "Interferon regulatory factor 4", "gene_name": "IRF4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P55265-1", "protein_name": "Double-stranded RNA-specific adenosine deaminase", "gene_name": "ADAR", "tax_name": "Human" }, { "uniprot_canonical_ac": "P13164-1", "protein_name": "Interferon-induced transmembrane protein 1", "gene_name": "IFITM1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P40305-2", "protein_name": "Interferon alpha-inducible protein 27, mitochondrial", "gene_name": "IFI27", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01629-1", "protein_name": "Interferon-induced transmembrane protein 2", "gene_name": "IFITM2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01566-1", "protein_name": "Interferon alpha-10", "gene_name": "IFNA10", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01571-1", "protein_name": "Interferon alpha-17", "gene_name": "IFNA17", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01574-1", "protein_name": "Interferon beta", "gene_name": "IFNB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05015-1", "protein_name": "Interferon alpha-16", "gene_name": "IFNA16", "tax_name": "Human" }, { "uniprot_canonical_ac": "P28062-1", "protein_name": "Proteasome subunit beta type-8", "gene_name": "PSMB8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13325-1", "protein_name": "Interferon-induced protein with tetratricopeptide repeats 5", "gene_name": "IFIT5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P19525-1", "protein_name": "Interferon-induced, double-stranded RNA-activated protein kinase", "gene_name": "EIF2AK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG47-1", "protein_name": "Polyubiquitin-B", "gene_name": "UBB", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42224-1", "protein_name": "Signal transducer and activator of transcription 1-alpha/beta", "gene_name": "STAT1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P80217-1", "protein_name": "Interferon-induced 35 kDa protein", "gene_name": "IFI35", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62987-1", "protein_name": "Ubiquitin-ribosomal protein eL40 fusion protein", "gene_name": "UBA52", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01628-1", "protein_name": "Interferon-induced transmembrane protein 3", "gene_name": "IFITM3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y3Z3-1", "protein_name": "Deoxynucleoside triphosphate triphosphohydrolase SAMHD1", "gene_name": "SAMHD1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P32456-1", "protein_name": "Guanylate-binding protein 2", "gene_name": "GBP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q00978-1", "protein_name": "Interferon regulatory factor 9", "gene_name": "IRF9", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01893-1", "protein_name": "Putative HLA class I histocompatibility antigen, alpha chain H", "gene_name": "HLA-H", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05161-1", "protein_name": "Ubiquitin-like protein ISG15", "gene_name": "ISG15", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14974-1", "protein_name": "Importin subunit beta-1", "gene_name": "KPNB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P23458-1", "protein_name": "Tyrosine-protein kinase JAK1", "gene_name": "JAK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P17181-1", "protein_name": "Interferon alpha/beta receptor 1", "gene_name": "IFNAR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG48-1", "protein_name": "Polyubiquitin-C", "gene_name": "UBC", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01889-1", "protein_name": "HLA class I histocompatibility antigen, B alpha chain", "gene_name": "HLA-B", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P52294", "url": "https://www.uniprot.org/uniprotkb/P52294" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.32758689", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 74 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The dynamic nature of the human origin recognition complex revealed through five cryoEM structures.", "journal": "eLife", "date": "2020", "authors": "Jaremko MJ, On KF, Thomas DR, Stillman B, Joshua-Tor L", "reference": { "type": "PubMed", "id": "32808929", "url": "https://pubmed.ncbi.nlm.nih.gov/32808929" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P52294-1", "protein_name": "Importin subunit alpha-5", "gene_name": "KPNA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UBD5-1", "protein_name": "Origin recognition complex subunit 3", "gene_name": "ORC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13415-1", "protein_name": "Origin recognition complex subunit 1", "gene_name": "ORC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13416-1", "protein_name": "Origin recognition complex subunit 2", "gene_name": "ORC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60684-1", "protein_name": "Importin subunit alpha-7", "gene_name": "KPNA6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P84243-1", "protein_name": "Histone H3.3", "gene_name": "H3-3A; H3-3B", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43913-1", "protein_name": "Origin recognition complex subunit 5", "gene_name": "ORC5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62805-1", "protein_name": "Histone H4", "gene_name": "H4C11; H4C12; H4C13; H4C14; H4C15; H4C16; H4C1; H4C2; H4C3; H4C4; H4C5; H4C6; H4C8; H4C9", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68431-1", "protein_name": "Histone H3.1", "gene_name": "H3C10; H3C11; H3C12; H3C1; H3C2; H3C3; H3C4; H3C6; H3C7; H3C8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16778-1", "protein_name": "Histone H2B type 2-E", "gene_name": "H2BC21", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62807-1", "protein_name": "Histone H2B type 1-C/E/F/G/I", "gene_name": "H2BC10; H2BC4; H2BC6; H2BC7; H2BC8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q71DI3-1", "protein_name": "Histone H3.2", "gene_name": "H3C13; H3C14; H3C15", "tax_name": "Human" }, { "uniprot_canonical_ac": "P16104-1", "protein_name": "Histone H2AX", "gene_name": "H2AX", "tax_name": "Human" }, { "uniprot_canonical_ac": "P33778-1", "protein_name": "Histone H2B type 1-B", "gene_name": "H2BC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P58876-1", "protein_name": "Histone H2B type 1-D", "gene_name": "H2BC5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96A08-1", "protein_name": "Histone H2B type 1-A", "gene_name": "H2BC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P23527-1", "protein_name": "Histone H2B type 1-O", "gene_name": "H2BC17", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0C5Y9-1", "protein_name": "Histone H2A-Bbd type 1", "gene_name": "H2AB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BTM1-1", "protein_name": "Histone H2A.J", "gene_name": "H2AJ", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60814-1", "protein_name": "Histone H2B type 1-K", "gene_name": "H2BC12", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q93077-1", "protein_name": "Histone H2A type 1-C", "gene_name": "H2AC6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q93079-1", "protein_name": "Histone H2B type 1-H", "gene_name": "H2BC9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99879-1", "protein_name": "Histone H2B type 1-M", "gene_name": "H2BC14", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43929-1", "protein_name": "Origin recognition complex subunit 4", "gene_name": "ORC4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q71UI9-1", "protein_name": "Histone H2A.V", "gene_name": "H2AZ2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y5N6-1", "protein_name": "Origin recognition complex subunit 6", "gene_name": "ORC6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04908-1", "protein_name": "Histone H2A type 1-B/E", "gene_name": "H2AC4; H2AC8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06899-1", "protein_name": "Histone H2B type 1-J", "gene_name": "H2BC11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P20671-1", "protein_name": "Histone H2A type 1-D", "gene_name": "H2AC7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P57053-1", "protein_name": "Histone H2B type F-S", "gene_name": "H2BC12L", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16777-1", "protein_name": "Histone H2A type 2-C", "gene_name": "H2AC20", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6FI13-1", "protein_name": "Histone H2A type 2-A", "gene_name": "H2AC18; H2AC19", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N257-1", "protein_name": "Histone H2B type 3-B", "gene_name": "H2BC26", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99877-1", "protein_name": "Histone H2B type 1-N", "gene_name": "H2BC15", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99878-1", "protein_name": "Histone H2A type 1-J", "gene_name": "H2AC14", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99880-1", "protein_name": "Histone H2B type 1-L", "gene_name": "H2BC13", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14974-1", "protein_name": "Importin subunit beta-1", "gene_name": "KPNB1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P52294", "url": "https://www.uniprot.org/uniprotkb/P52294" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.32808929", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 37 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Interferon beta-1b in treatment of severe COVID-19: A randomized clinical trial.", "journal": "International immunopharmacology", "date": "2020", "authors": "Rahmani H, Davoudi-Monfared E, Nourian A, Khalili H, Hajizadeh N, Jalalabadi NZ, Fazeli MR, Ghazaeian M, Yekaninejad MS", "reference": { "type": "PubMed", "id": "32862111", "url": "https://pubmed.ncbi.nlm.nih.gov/32862111" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P52294-1", "protein_name": "Importin subunit alpha-5", "gene_name": "KPNA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P18146-1", "protein_name": "Early growth response protein 1", "gene_name": "EGR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15646-1", "protein_name": "2'-5'-oligoadenylate synthase-like protein", "gene_name": "OASL", "tax_name": "Human" }, { "uniprot_canonical_ac": "P29728-1", "protein_name": "2'-5'-oligoadenylate synthase 2", "gene_name": "OAS2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15524-1", "protein_name": "Suppressor of cytokine signaling 1", "gene_name": "SOCS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y6K5-1", "protein_name": "2'-5'-oligoadenylate synthase 3", "gene_name": "OAS3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q02556-1", "protein_name": "Interferon regulatory factor 8", "gene_name": "IRF8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96AZ6-1", "protein_name": "Interferon-stimulated gene 20 kDa protein", "gene_name": "ISG20", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14896-1", "protein_name": "Interferon regulatory factor 6", "gene_name": "IRF6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P30511-1", "protein_name": "HLA class I histocompatibility antigen, alpha chain F", "gene_name": "HLA-F", "tax_name": "Human" }, { "uniprot_canonical_ac": "P13747-1", "protein_name": "HLA class I histocompatibility antigen, alpha chain E", "gene_name": "HLA-E", "tax_name": "Human" }, { "uniprot_canonical_ac": "P17693-1", "protein_name": "HLA class I histocompatibility antigen, alpha chain G", "gene_name": "HLA-G", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01563-1", "protein_name": "Interferon alpha-2", "gene_name": "IFNA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01567-1", "protein_name": "Interferon alpha-7", "gene_name": "IFNA7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01568-1", "protein_name": "Interferon alpha-21", "gene_name": "IFNA21", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01569-1", "protein_name": "Interferon alpha-5", "gene_name": "IFNA5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01570-1", "protein_name": "Interferon alpha-14", "gene_name": "IFNA14", "tax_name": "Human" }, { "uniprot_canonical_ac": "P09914-1", "protein_name": "Antiviral innate immune response effector IFIT1", "gene_name": "IFIT1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P32881-1", "protein_name": "Interferon alpha-8", "gene_name": "IFNA8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UHH9-1", "protein_name": "Inositol hexakisphosphate kinase 2", "gene_name": "IP6K2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05013-1", "protein_name": "Interferon alpha-6", "gene_name": "IFNA6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P09913-1", "protein_name": "Interferon-induced protein with tetratricopeptide repeats 2", "gene_name": "IFIT2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8WXG1-1", "protein_name": "S-adenosylmethionine-dependent nucleotide dehydratase RSAD2", "gene_name": "RSAD2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P20592-1", "protein_name": "Interferon-induced GTP-binding protein Mx2", "gene_name": "MX2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P14316-1", "protein_name": "Interferon regulatory factor 2", "gene_name": "IRF2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P29350-1", "protein_name": "Tyrosine-protein phosphatase non-receptor type 6", "gene_name": "PTPN6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14653-1", "protein_name": "Interferon regulatory factor 3", "gene_name": "IRF3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P20591-1", "protein_name": "Interferon-induced GTP-binding protein Mx1", "gene_name": "MX1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13568-1", "protein_name": "Interferon regulatory factor 5", "gene_name": "IRF5", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14879-1", "protein_name": "Interferon-induced protein with tetratricopeptide repeats 3", "gene_name": "IFIT3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q05823-1", "protein_name": "2-5A-dependent ribonuclease", "gene_name": "RNASEL", "tax_name": "Human" }, { "uniprot_canonical_ac": "P10914-1", "protein_name": "Interferon regulatory factor 1", "gene_name": "IRF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6GPH4-1", "protein_name": "XIAP-associated factor 1", "gene_name": "XAF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P52630-3", "protein_name": "Signal transducer and activator of transcription 2", "gene_name": "STAT2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P09912-1", "protein_name": "Interferon alpha-inducible protein 6", "gene_name": "IFI6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P10321-1", "protein_name": "HLA class I histocompatibility antigen, C alpha chain", "gene_name": "HLA-C", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04439-1", "protein_name": "HLA class I histocompatibility antigen, A alpha chain", "gene_name": "HLA-A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92985-1", "protein_name": "Interferon regulatory factor 7", "gene_name": "IRF7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61221-1", "protein_name": "ATP-binding cassette sub-family E member 1", "gene_name": "ABCE1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P00973-1", "protein_name": "2'-5'-oligoadenylate synthase 1", "gene_name": "OAS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05014-1", "protein_name": "Interferon alpha-4", "gene_name": "IFNA4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q06124-2", "protein_name": "Tyrosine-protein phosphatase non-receptor type 11", "gene_name": "PTPN11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P29597-1", "protein_name": "Non-receptor tyrosine-protein kinase TYK2", "gene_name": "TYK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14543-1", "protein_name": "Suppressor of cytokine signaling 3", "gene_name": "SOCS3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DY56-1", "protein_name": "Interferon alpha-1", "gene_name": "IFNA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62979-1", "protein_name": "Ubiquitin-ribosomal protein eS31 fusion protein", "gene_name": "RPS27A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q10589-1", "protein_name": "Bone marrow stromal antigen 2", "gene_name": "BST2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15306-1", "protein_name": "Interferon regulatory factor 4", "gene_name": "IRF4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P55265-1", "protein_name": "Double-stranded RNA-specific adenosine deaminase", "gene_name": "ADAR", "tax_name": "Human" }, { "uniprot_canonical_ac": "P13164-1", "protein_name": "Interferon-induced transmembrane protein 1", "gene_name": "IFITM1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P40305-2", "protein_name": "Interferon alpha-inducible protein 27, mitochondrial", "gene_name": "IFI27", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01629-1", "protein_name": "Interferon-induced transmembrane protein 2", "gene_name": "IFITM2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01566-1", "protein_name": "Interferon alpha-10", "gene_name": "IFNA10", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01571-1", "protein_name": "Interferon alpha-17", "gene_name": "IFNA17", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01574-1", "protein_name": "Interferon beta", "gene_name": "IFNB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05015-1", "protein_name": "Interferon alpha-16", "gene_name": "IFNA16", "tax_name": "Human" }, { "uniprot_canonical_ac": "P28062-1", "protein_name": "Proteasome subunit beta type-8", "gene_name": "PSMB8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13325-1", "protein_name": "Interferon-induced protein with tetratricopeptide repeats 5", "gene_name": "IFIT5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P19525-1", "protein_name": "Interferon-induced, double-stranded RNA-activated protein kinase", "gene_name": "EIF2AK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG47-1", "protein_name": "Polyubiquitin-B", "gene_name": "UBB", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42224-1", "protein_name": "Signal transducer and activator of transcription 1-alpha/beta", "gene_name": "STAT1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P80217-1", "protein_name": "Interferon-induced 35 kDa protein", "gene_name": "IFI35", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62987-1", "protein_name": "Ubiquitin-ribosomal protein eL40 fusion protein", "gene_name": "UBA52", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01628-1", "protein_name": "Interferon-induced transmembrane protein 3", "gene_name": "IFITM3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y3Z3-1", "protein_name": "Deoxynucleoside triphosphate triphosphohydrolase SAMHD1", "gene_name": "SAMHD1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P32456-1", "protein_name": "Guanylate-binding protein 2", "gene_name": "GBP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q00978-1", "protein_name": "Interferon regulatory factor 9", "gene_name": "IRF9", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01893-1", "protein_name": "Putative HLA class I histocompatibility antigen, alpha chain H", "gene_name": "HLA-H", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05161-1", "protein_name": "Ubiquitin-like protein ISG15", "gene_name": "ISG15", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14974-1", "protein_name": "Importin subunit beta-1", "gene_name": "KPNB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P23458-1", "protein_name": "Tyrosine-protein kinase JAK1", "gene_name": "JAK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P17181-1", "protein_name": "Interferon alpha/beta receptor 1", "gene_name": "IFNAR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG48-1", "protein_name": "Polyubiquitin-C", "gene_name": "UBC", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01889-1", "protein_name": "HLA class I histocompatibility antigen, B alpha chain", "gene_name": "HLA-B", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P52294", "url": "https://www.uniprot.org/uniprotkb/P52294" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.32862111", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 74 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The Role of Type I Interferons in the Pathogenesis and Treatment of COVID-19.", "journal": "Frontiers in immunology", "date": "2020", "authors": "Schreiber G", "reference": { "type": "PubMed", "id": "33117408", "url": "https://pubmed.ncbi.nlm.nih.gov/33117408" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P52294-1", "protein_name": "Importin subunit alpha-5", "gene_name": "KPNA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P18146-1", "protein_name": "Early growth response protein 1", "gene_name": "EGR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15646-1", "protein_name": "2'-5'-oligoadenylate synthase-like protein", "gene_name": "OASL", "tax_name": "Human" }, { "uniprot_canonical_ac": "P29728-1", "protein_name": "2'-5'-oligoadenylate synthase 2", "gene_name": "OAS2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15524-1", "protein_name": "Suppressor of cytokine signaling 1", "gene_name": "SOCS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y6K5-1", "protein_name": "2'-5'-oligoadenylate synthase 3", "gene_name": "OAS3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q02556-1", "protein_name": "Interferon regulatory factor 8", "gene_name": "IRF8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96AZ6-1", "protein_name": "Interferon-stimulated gene 20 kDa protein", "gene_name": "ISG20", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14896-1", "protein_name": "Interferon regulatory factor 6", "gene_name": "IRF6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P30511-1", "protein_name": "HLA class I histocompatibility antigen, alpha chain F", "gene_name": "HLA-F", "tax_name": "Human" }, { "uniprot_canonical_ac": "P13747-1", "protein_name": "HLA class I histocompatibility antigen, alpha chain E", "gene_name": "HLA-E", "tax_name": "Human" }, { "uniprot_canonical_ac": "P17693-1", "protein_name": "HLA class I histocompatibility antigen, alpha chain G", "gene_name": "HLA-G", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01563-1", "protein_name": "Interferon alpha-2", "gene_name": "IFNA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01567-1", "protein_name": "Interferon alpha-7", "gene_name": "IFNA7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01568-1", "protein_name": "Interferon alpha-21", "gene_name": "IFNA21", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01569-1", "protein_name": "Interferon alpha-5", "gene_name": "IFNA5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01570-1", "protein_name": "Interferon alpha-14", "gene_name": "IFNA14", "tax_name": "Human" }, { "uniprot_canonical_ac": "P09914-1", "protein_name": "Antiviral innate immune response effector IFIT1", "gene_name": "IFIT1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P32881-1", "protein_name": "Interferon alpha-8", "gene_name": "IFNA8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UHH9-1", "protein_name": "Inositol hexakisphosphate kinase 2", "gene_name": "IP6K2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05013-1", "protein_name": "Interferon alpha-6", "gene_name": "IFNA6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P09913-1", "protein_name": "Interferon-induced protein with tetratricopeptide repeats 2", "gene_name": "IFIT2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8WXG1-1", "protein_name": "S-adenosylmethionine-dependent nucleotide dehydratase RSAD2", "gene_name": "RSAD2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P20592-1", "protein_name": "Interferon-induced GTP-binding protein Mx2", "gene_name": "MX2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P14316-1", "protein_name": "Interferon regulatory factor 2", "gene_name": "IRF2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P29350-1", "protein_name": "Tyrosine-protein phosphatase non-receptor type 6", "gene_name": "PTPN6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14653-1", "protein_name": "Interferon regulatory factor 3", "gene_name": "IRF3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P20591-1", "protein_name": "Interferon-induced GTP-binding protein Mx1", "gene_name": "MX1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13568-1", "protein_name": "Interferon regulatory factor 5", "gene_name": "IRF5", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14879-1", "protein_name": "Interferon-induced protein with tetratricopeptide repeats 3", "gene_name": "IFIT3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q05823-1", "protein_name": "2-5A-dependent ribonuclease", "gene_name": "RNASEL", "tax_name": "Human" }, { "uniprot_canonical_ac": "P10914-1", "protein_name": "Interferon regulatory factor 1", "gene_name": "IRF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6GPH4-1", "protein_name": "XIAP-associated factor 1", "gene_name": "XAF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P52630-3", "protein_name": "Signal transducer and activator of transcription 2", "gene_name": "STAT2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P09912-1", "protein_name": "Interferon alpha-inducible protein 6", "gene_name": "IFI6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P10321-1", "protein_name": "HLA class I histocompatibility antigen, C alpha chain", "gene_name": "HLA-C", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04439-1", "protein_name": "HLA class I histocompatibility antigen, A alpha chain", "gene_name": "HLA-A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92985-1", "protein_name": "Interferon regulatory factor 7", "gene_name": "IRF7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61221-1", "protein_name": "ATP-binding cassette sub-family E member 1", "gene_name": "ABCE1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P00973-1", "protein_name": "2'-5'-oligoadenylate synthase 1", "gene_name": "OAS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05014-1", "protein_name": "Interferon alpha-4", "gene_name": "IFNA4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q06124-2", "protein_name": "Tyrosine-protein phosphatase non-receptor type 11", "gene_name": "PTPN11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P29597-1", "protein_name": "Non-receptor tyrosine-protein kinase TYK2", "gene_name": "TYK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14543-1", "protein_name": "Suppressor of cytokine signaling 3", "gene_name": "SOCS3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DY56-1", "protein_name": "Interferon alpha-1", "gene_name": "IFNA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62979-1", "protein_name": "Ubiquitin-ribosomal protein eS31 fusion protein", "gene_name": "RPS27A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q10589-1", "protein_name": "Bone marrow stromal antigen 2", "gene_name": "BST2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15306-1", "protein_name": "Interferon regulatory factor 4", "gene_name": "IRF4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P55265-1", "protein_name": "Double-stranded RNA-specific adenosine deaminase", "gene_name": "ADAR", "tax_name": "Human" }, { "uniprot_canonical_ac": "P13164-1", "protein_name": "Interferon-induced transmembrane protein 1", "gene_name": "IFITM1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P40305-2", "protein_name": "Interferon alpha-inducible protein 27, mitochondrial", "gene_name": "IFI27", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01629-1", "protein_name": "Interferon-induced transmembrane protein 2", "gene_name": "IFITM2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01566-1", "protein_name": "Interferon alpha-10", "gene_name": "IFNA10", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01571-1", "protein_name": "Interferon alpha-17", "gene_name": "IFNA17", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01574-1", "protein_name": "Interferon beta", "gene_name": "IFNB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05015-1", "protein_name": "Interferon alpha-16", "gene_name": "IFNA16", "tax_name": "Human" }, { "uniprot_canonical_ac": "P28062-1", "protein_name": "Proteasome subunit beta type-8", "gene_name": "PSMB8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13325-1", "protein_name": "Interferon-induced protein with tetratricopeptide repeats 5", "gene_name": "IFIT5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P19525-1", "protein_name": "Interferon-induced, double-stranded RNA-activated protein kinase", "gene_name": "EIF2AK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG47-1", "protein_name": "Polyubiquitin-B", "gene_name": "UBB", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42224-1", "protein_name": "Signal transducer and activator of transcription 1-alpha/beta", "gene_name": "STAT1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P80217-1", "protein_name": "Interferon-induced 35 kDa protein", "gene_name": "IFI35", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62987-1", "protein_name": "Ubiquitin-ribosomal protein eL40 fusion protein", "gene_name": "UBA52", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01628-1", "protein_name": "Interferon-induced transmembrane protein 3", "gene_name": "IFITM3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y3Z3-1", "protein_name": "Deoxynucleoside triphosphate triphosphohydrolase SAMHD1", "gene_name": "SAMHD1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P32456-1", "protein_name": "Guanylate-binding protein 2", "gene_name": "GBP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q00978-1", "protein_name": "Interferon regulatory factor 9", "gene_name": "IRF9", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01893-1", "protein_name": "Putative HLA class I histocompatibility antigen, alpha chain H", "gene_name": "HLA-H", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05161-1", "protein_name": "Ubiquitin-like protein ISG15", "gene_name": "ISG15", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14974-1", "protein_name": "Importin subunit beta-1", "gene_name": "KPNB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P23458-1", "protein_name": "Tyrosine-protein kinase JAK1", "gene_name": "JAK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P17181-1", "protein_name": "Interferon alpha/beta receptor 1", "gene_name": "IFNAR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG48-1", "protein_name": "Polyubiquitin-C", "gene_name": "UBC", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01889-1", "protein_name": "HLA class I histocompatibility antigen, B alpha chain", "gene_name": "HLA-B", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P52294", "url": "https://www.uniprot.org/uniprotkb/P52294" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.33117408", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 74 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Safety and efficacy of inhaled nebulised interferon beta-1a (SNG001) for treatment of SARS-CoV-2 infection: a randomised, double-blind, placebo-controlled, phase 2 trial.", "journal": "The Lancet. Respiratory medicine", "date": "2021", "authors": "Monk PD, Marsden RJ, Tear VJ, Brookes J, Batten TN, Mankowski M, Gabbay FJ, Davies DE, Holgate ST, Ho LP, Clark T, Djukanovic R, Wilkinson TMA", "reference": { "type": "PubMed", "id": "33189161", "url": "https://pubmed.ncbi.nlm.nih.gov/33189161" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P52294-1", "protein_name": "Importin subunit alpha-5", "gene_name": "KPNA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P18146-1", "protein_name": "Early growth response protein 1", "gene_name": "EGR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15646-1", "protein_name": "2'-5'-oligoadenylate synthase-like protein", "gene_name": "OASL", "tax_name": "Human" }, { "uniprot_canonical_ac": "P29728-1", "protein_name": "2'-5'-oligoadenylate synthase 2", "gene_name": "OAS2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15524-1", "protein_name": "Suppressor of cytokine signaling 1", "gene_name": "SOCS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y6K5-1", "protein_name": "2'-5'-oligoadenylate synthase 3", "gene_name": "OAS3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q02556-1", "protein_name": "Interferon regulatory factor 8", "gene_name": "IRF8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96AZ6-1", "protein_name": "Interferon-stimulated gene 20 kDa protein", "gene_name": "ISG20", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14896-1", "protein_name": "Interferon regulatory factor 6", "gene_name": "IRF6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P30511-1", "protein_name": "HLA class I histocompatibility antigen, alpha chain F", "gene_name": "HLA-F", "tax_name": "Human" }, { "uniprot_canonical_ac": "P13747-1", "protein_name": "HLA class I histocompatibility antigen, alpha chain E", "gene_name": "HLA-E", "tax_name": "Human" }, { "uniprot_canonical_ac": "P17693-1", "protein_name": "HLA class I histocompatibility antigen, alpha chain G", "gene_name": "HLA-G", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01563-1", "protein_name": "Interferon alpha-2", "gene_name": "IFNA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01567-1", "protein_name": "Interferon alpha-7", "gene_name": "IFNA7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01568-1", "protein_name": "Interferon alpha-21", "gene_name": "IFNA21", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01569-1", "protein_name": "Interferon alpha-5", "gene_name": "IFNA5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01570-1", "protein_name": "Interferon alpha-14", "gene_name": "IFNA14", "tax_name": "Human" }, { "uniprot_canonical_ac": "P09914-1", "protein_name": "Antiviral innate immune response effector IFIT1", "gene_name": "IFIT1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P32881-1", "protein_name": "Interferon alpha-8", "gene_name": "IFNA8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UHH9-1", "protein_name": "Inositol hexakisphosphate kinase 2", "gene_name": "IP6K2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05013-1", "protein_name": "Interferon alpha-6", "gene_name": "IFNA6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P09913-1", "protein_name": "Interferon-induced protein with tetratricopeptide repeats 2", "gene_name": "IFIT2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8WXG1-1", "protein_name": "S-adenosylmethionine-dependent nucleotide dehydratase RSAD2", "gene_name": "RSAD2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P20592-1", "protein_name": "Interferon-induced GTP-binding protein Mx2", "gene_name": "MX2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P14316-1", "protein_name": "Interferon regulatory factor 2", "gene_name": "IRF2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P29350-1", "protein_name": "Tyrosine-protein phosphatase non-receptor type 6", "gene_name": "PTPN6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14653-1", "protein_name": "Interferon regulatory factor 3", "gene_name": "IRF3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P20591-1", "protein_name": "Interferon-induced GTP-binding protein Mx1", "gene_name": "MX1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13568-1", "protein_name": "Interferon regulatory factor 5", "gene_name": "IRF5", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14879-1", "protein_name": "Interferon-induced protein with tetratricopeptide repeats 3", "gene_name": "IFIT3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q05823-1", "protein_name": "2-5A-dependent ribonuclease", "gene_name": "RNASEL", "tax_name": "Human" }, { "uniprot_canonical_ac": "P10914-1", "protein_name": "Interferon regulatory factor 1", "gene_name": "IRF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6GPH4-1", "protein_name": "XIAP-associated factor 1", "gene_name": "XAF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P52630-3", "protein_name": "Signal transducer and activator of transcription 2", "gene_name": "STAT2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P09912-1", "protein_name": "Interferon alpha-inducible protein 6", "gene_name": "IFI6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P10321-1", "protein_name": "HLA class I histocompatibility antigen, C alpha chain", "gene_name": "HLA-C", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04439-1", "protein_name": "HLA class I histocompatibility antigen, A alpha chain", "gene_name": "HLA-A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92985-1", "protein_name": "Interferon regulatory factor 7", "gene_name": "IRF7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61221-1", "protein_name": "ATP-binding cassette sub-family E member 1", "gene_name": "ABCE1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P00973-1", "protein_name": "2'-5'-oligoadenylate synthase 1", "gene_name": "OAS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05014-1", "protein_name": "Interferon alpha-4", "gene_name": "IFNA4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q06124-2", "protein_name": "Tyrosine-protein phosphatase non-receptor type 11", "gene_name": "PTPN11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P29597-1", "protein_name": "Non-receptor tyrosine-protein kinase TYK2", "gene_name": "TYK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14543-1", "protein_name": "Suppressor of cytokine signaling 3", "gene_name": "SOCS3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DY56-1", "protein_name": "Interferon alpha-1", "gene_name": "IFNA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62979-1", "protein_name": "Ubiquitin-ribosomal protein eS31 fusion protein", "gene_name": "RPS27A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q10589-1", "protein_name": "Bone marrow stromal antigen 2", "gene_name": "BST2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15306-1", "protein_name": "Interferon regulatory factor 4", "gene_name": "IRF4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P55265-1", "protein_name": "Double-stranded RNA-specific adenosine deaminase", "gene_name": "ADAR", "tax_name": "Human" }, { "uniprot_canonical_ac": "P13164-1", "protein_name": "Interferon-induced transmembrane protein 1", "gene_name": "IFITM1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P40305-2", "protein_name": "Interferon alpha-inducible protein 27, mitochondrial", "gene_name": "IFI27", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01629-1", "protein_name": "Interferon-induced transmembrane protein 2", "gene_name": "IFITM2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01566-1", "protein_name": "Interferon alpha-10", "gene_name": "IFNA10", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01571-1", "protein_name": "Interferon alpha-17", "gene_name": "IFNA17", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01574-1", "protein_name": "Interferon beta", "gene_name": "IFNB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05015-1", "protein_name": "Interferon alpha-16", "gene_name": "IFNA16", "tax_name": "Human" }, { "uniprot_canonical_ac": "P28062-1", "protein_name": "Proteasome subunit beta type-8", "gene_name": "PSMB8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13325-1", "protein_name": "Interferon-induced protein with tetratricopeptide repeats 5", "gene_name": "IFIT5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P19525-1", "protein_name": "Interferon-induced, double-stranded RNA-activated protein kinase", "gene_name": "EIF2AK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG47-1", "protein_name": "Polyubiquitin-B", "gene_name": "UBB", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42224-1", "protein_name": "Signal transducer and activator of transcription 1-alpha/beta", "gene_name": "STAT1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P80217-1", "protein_name": "Interferon-induced 35 kDa protein", "gene_name": "IFI35", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62987-1", "protein_name": "Ubiquitin-ribosomal protein eL40 fusion protein", "gene_name": "UBA52", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01628-1", "protein_name": "Interferon-induced transmembrane protein 3", "gene_name": "IFITM3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y3Z3-1", "protein_name": "Deoxynucleoside triphosphate triphosphohydrolase SAMHD1", "gene_name": "SAMHD1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P32456-1", "protein_name": "Guanylate-binding protein 2", "gene_name": "GBP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q00978-1", "protein_name": "Interferon regulatory factor 9", "gene_name": "IRF9", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01893-1", "protein_name": "Putative HLA class I histocompatibility antigen, alpha chain H", "gene_name": "HLA-H", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05161-1", "protein_name": "Ubiquitin-like protein ISG15", "gene_name": "ISG15", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14974-1", "protein_name": "Importin subunit beta-1", "gene_name": "KPNB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P23458-1", "protein_name": "Tyrosine-protein kinase JAK1", "gene_name": "JAK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P17181-1", "protein_name": "Interferon alpha/beta receptor 1", "gene_name": "IFNAR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG48-1", "protein_name": "Polyubiquitin-C", "gene_name": "UBC", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01889-1", "protein_name": "HLA class I histocompatibility antigen, B alpha chain", "gene_name": "HLA-B", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P52294", "url": "https://www.uniprot.org/uniprotkb/P52294" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.33189161", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 74 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Corrigendum: Interferon-alpha2b Treatment for COVID-19.", "journal": "Frontiers in immunology", "date": "2020", "authors": "Zhou Q, Chen V, Shannon CP, Wei XS, Xiang X, Wang X, Wang ZH, Tebbutt SJ, Kollmann TR, Fish EN", "reference": { "type": "PubMed", "id": "33193462", "url": "https://pubmed.ncbi.nlm.nih.gov/33193462" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P52294-1", "protein_name": "Importin subunit alpha-5", "gene_name": "KPNA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P18146-1", "protein_name": "Early growth response protein 1", "gene_name": "EGR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15646-1", "protein_name": "2'-5'-oligoadenylate synthase-like protein", "gene_name": "OASL", "tax_name": "Human" }, { "uniprot_canonical_ac": "P29728-1", "protein_name": "2'-5'-oligoadenylate synthase 2", "gene_name": "OAS2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15524-1", "protein_name": "Suppressor of cytokine signaling 1", "gene_name": "SOCS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y6K5-1", "protein_name": "2'-5'-oligoadenylate synthase 3", "gene_name": "OAS3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q02556-1", "protein_name": "Interferon regulatory factor 8", "gene_name": "IRF8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96AZ6-1", "protein_name": "Interferon-stimulated gene 20 kDa protein", "gene_name": "ISG20", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14896-1", "protein_name": "Interferon regulatory factor 6", "gene_name": "IRF6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P30511-1", "protein_name": "HLA class I histocompatibility antigen, alpha chain F", "gene_name": "HLA-F", "tax_name": "Human" }, { "uniprot_canonical_ac": "P13747-1", "protein_name": "HLA class I histocompatibility antigen, alpha chain E", "gene_name": "HLA-E", "tax_name": "Human" }, { "uniprot_canonical_ac": "P17693-1", "protein_name": "HLA class I histocompatibility antigen, alpha chain G", "gene_name": "HLA-G", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01563-1", "protein_name": "Interferon alpha-2", "gene_name": "IFNA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01567-1", "protein_name": "Interferon alpha-7", "gene_name": "IFNA7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01568-1", "protein_name": "Interferon alpha-21", "gene_name": "IFNA21", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01569-1", "protein_name": "Interferon alpha-5", "gene_name": "IFNA5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01570-1", "protein_name": "Interferon alpha-14", "gene_name": "IFNA14", "tax_name": "Human" }, { "uniprot_canonical_ac": "P09914-1", "protein_name": "Antiviral innate immune response effector IFIT1", "gene_name": "IFIT1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P32881-1", "protein_name": "Interferon alpha-8", "gene_name": "IFNA8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UHH9-1", "protein_name": "Inositol hexakisphosphate kinase 2", "gene_name": "IP6K2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05013-1", "protein_name": "Interferon alpha-6", "gene_name": "IFNA6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P09913-1", "protein_name": "Interferon-induced protein with tetratricopeptide repeats 2", "gene_name": "IFIT2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8WXG1-1", "protein_name": "S-adenosylmethionine-dependent nucleotide dehydratase RSAD2", "gene_name": "RSAD2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P20592-1", "protein_name": "Interferon-induced GTP-binding protein Mx2", "gene_name": "MX2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P14316-1", "protein_name": "Interferon regulatory factor 2", "gene_name": "IRF2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P29350-1", "protein_name": "Tyrosine-protein phosphatase non-receptor type 6", "gene_name": "PTPN6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14653-1", "protein_name": "Interferon regulatory factor 3", "gene_name": "IRF3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P20591-1", "protein_name": "Interferon-induced GTP-binding protein Mx1", "gene_name": "MX1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13568-1", "protein_name": "Interferon regulatory factor 5", "gene_name": "IRF5", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14879-1", "protein_name": "Interferon-induced protein with tetratricopeptide repeats 3", "gene_name": "IFIT3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q05823-1", "protein_name": "2-5A-dependent ribonuclease", "gene_name": "RNASEL", "tax_name": "Human" }, { "uniprot_canonical_ac": "P10914-1", "protein_name": "Interferon regulatory factor 1", "gene_name": "IRF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6GPH4-1", "protein_name": "XIAP-associated factor 1", "gene_name": "XAF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P52630-3", "protein_name": "Signal transducer and activator of transcription 2", "gene_name": "STAT2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P09912-1", "protein_name": "Interferon alpha-inducible protein 6", "gene_name": "IFI6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P10321-1", "protein_name": "HLA class I histocompatibility antigen, C alpha chain", "gene_name": "HLA-C", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04439-1", "protein_name": "HLA class I histocompatibility antigen, A alpha chain", "gene_name": "HLA-A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92985-1", "protein_name": "Interferon regulatory factor 7", "gene_name": "IRF7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61221-1", "protein_name": "ATP-binding cassette sub-family E member 1", "gene_name": "ABCE1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P00973-1", "protein_name": "2'-5'-oligoadenylate synthase 1", "gene_name": "OAS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05014-1", "protein_name": "Interferon alpha-4", "gene_name": "IFNA4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q06124-2", "protein_name": "Tyrosine-protein phosphatase non-receptor type 11", "gene_name": "PTPN11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P29597-1", "protein_name": "Non-receptor tyrosine-protein kinase TYK2", "gene_name": "TYK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14543-1", "protein_name": "Suppressor of cytokine signaling 3", "gene_name": "SOCS3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DY56-1", "protein_name": "Interferon alpha-1", "gene_name": "IFNA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62979-1", "protein_name": "Ubiquitin-ribosomal protein eS31 fusion protein", "gene_name": "RPS27A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q10589-1", "protein_name": "Bone marrow stromal antigen 2", "gene_name": "BST2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15306-1", "protein_name": "Interferon regulatory factor 4", "gene_name": "IRF4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P55265-1", "protein_name": "Double-stranded RNA-specific adenosine deaminase", "gene_name": "ADAR", "tax_name": "Human" }, { "uniprot_canonical_ac": "P13164-1", "protein_name": "Interferon-induced transmembrane protein 1", "gene_name": "IFITM1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P40305-2", "protein_name": "Interferon alpha-inducible protein 27, mitochondrial", "gene_name": "IFI27", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01629-1", "protein_name": "Interferon-induced transmembrane protein 2", "gene_name": "IFITM2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01566-1", "protein_name": "Interferon alpha-10", "gene_name": "IFNA10", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01571-1", "protein_name": "Interferon alpha-17", "gene_name": "IFNA17", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01574-1", "protein_name": "Interferon beta", "gene_name": "IFNB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05015-1", "protein_name": "Interferon alpha-16", "gene_name": "IFNA16", "tax_name": "Human" }, { "uniprot_canonical_ac": "P28062-1", "protein_name": "Proteasome subunit beta type-8", "gene_name": "PSMB8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13325-1", "protein_name": "Interferon-induced protein with tetratricopeptide repeats 5", "gene_name": "IFIT5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P19525-1", "protein_name": "Interferon-induced, double-stranded RNA-activated protein kinase", "gene_name": "EIF2AK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG47-1", "protein_name": "Polyubiquitin-B", "gene_name": "UBB", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42224-1", "protein_name": "Signal transducer and activator of transcription 1-alpha/beta", "gene_name": "STAT1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P80217-1", "protein_name": "Interferon-induced 35 kDa protein", "gene_name": "IFI35", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62987-1", "protein_name": "Ubiquitin-ribosomal protein eL40 fusion protein", "gene_name": "UBA52", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01628-1", "protein_name": "Interferon-induced transmembrane protein 3", "gene_name": "IFITM3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y3Z3-1", "protein_name": "Deoxynucleoside triphosphate triphosphohydrolase SAMHD1", "gene_name": "SAMHD1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P32456-1", "protein_name": "Guanylate-binding protein 2", "gene_name": "GBP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q00978-1", "protein_name": "Interferon regulatory factor 9", "gene_name": "IRF9", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01893-1", "protein_name": "Putative HLA class I histocompatibility antigen, alpha chain H", "gene_name": "HLA-H", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05161-1", "protein_name": "Ubiquitin-like protein ISG15", "gene_name": "ISG15", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14974-1", "protein_name": "Importin subunit beta-1", "gene_name": "KPNB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P23458-1", "protein_name": "Tyrosine-protein kinase JAK1", "gene_name": "JAK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P17181-1", "protein_name": "Interferon alpha/beta receptor 1", "gene_name": "IFNAR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG48-1", "protein_name": "Polyubiquitin-C", "gene_name": "UBC", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01889-1", "protein_name": "HLA class I histocompatibility antigen, B alpha chain", "gene_name": "HLA-B", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P52294", "url": "https://www.uniprot.org/uniprotkb/P52294" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.33193462", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 74 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Structural insight into the assembly and conformational activation of human origin recognition complex.", "journal": "Cell discovery", "date": "2020", "authors": "Cheng J, Li N, Wang X, Hu J, Zhai Y, Gao N", "reference": { "type": "PubMed", "id": "33298899", "url": "https://pubmed.ncbi.nlm.nih.gov/33298899" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P52294-1", "protein_name": "Importin subunit alpha-5", "gene_name": "KPNA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UBD5-1", "protein_name": "Origin recognition complex subunit 3", "gene_name": "ORC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13415-1", "protein_name": "Origin recognition complex subunit 1", "gene_name": "ORC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13416-1", "protein_name": "Origin recognition complex subunit 2", "gene_name": "ORC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60684-1", "protein_name": "Importin subunit alpha-7", "gene_name": "KPNA6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P84243-1", "protein_name": "Histone H3.3", "gene_name": "H3-3A; H3-3B", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43913-1", "protein_name": "Origin recognition complex subunit 5", "gene_name": "ORC5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62805-1", "protein_name": "Histone H4", "gene_name": "H4C11; H4C12; H4C13; H4C14; H4C15; H4C16; H4C1; H4C2; H4C3; H4C4; H4C5; H4C6; H4C8; H4C9", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68431-1", "protein_name": "Histone H3.1", "gene_name": "H3C10; H3C11; H3C12; H3C1; H3C2; H3C3; H3C4; H3C6; H3C7; H3C8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16778-1", "protein_name": "Histone H2B type 2-E", "gene_name": "H2BC21", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62807-1", "protein_name": "Histone H2B type 1-C/E/F/G/I", "gene_name": "H2BC10; H2BC4; H2BC6; H2BC7; H2BC8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q71DI3-1", "protein_name": "Histone H3.2", "gene_name": "H3C13; H3C14; H3C15", "tax_name": "Human" }, { "uniprot_canonical_ac": "P16104-1", "protein_name": "Histone H2AX", "gene_name": "H2AX", "tax_name": "Human" }, { "uniprot_canonical_ac": "P33778-1", "protein_name": "Histone H2B type 1-B", "gene_name": "H2BC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P58876-1", "protein_name": "Histone H2B type 1-D", "gene_name": "H2BC5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96A08-1", "protein_name": "Histone H2B type 1-A", "gene_name": "H2BC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P23527-1", "protein_name": "Histone H2B type 1-O", "gene_name": "H2BC17", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0C5Y9-1", "protein_name": "Histone H2A-Bbd type 1", "gene_name": "H2AB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BTM1-1", "protein_name": "Histone H2A.J", "gene_name": "H2AJ", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60814-1", "protein_name": "Histone H2B type 1-K", "gene_name": "H2BC12", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q93077-1", "protein_name": "Histone H2A type 1-C", "gene_name": "H2AC6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q93079-1", "protein_name": "Histone H2B type 1-H", "gene_name": "H2BC9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99879-1", "protein_name": "Histone H2B type 1-M", "gene_name": "H2BC14", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43929-1", "protein_name": "Origin recognition complex subunit 4", "gene_name": "ORC4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q71UI9-1", "protein_name": "Histone H2A.V", "gene_name": "H2AZ2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y5N6-1", "protein_name": "Origin recognition complex subunit 6", "gene_name": "ORC6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04908-1", "protein_name": "Histone H2A type 1-B/E", "gene_name": "H2AC4; H2AC8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06899-1", "protein_name": "Histone H2B type 1-J", "gene_name": "H2BC11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P20671-1", "protein_name": "Histone H2A type 1-D", "gene_name": "H2AC7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P57053-1", "protein_name": "Histone H2B type F-S", "gene_name": "H2BC12L", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16777-1", "protein_name": "Histone H2A type 2-C", "gene_name": "H2AC20", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6FI13-1", "protein_name": "Histone H2A type 2-A", "gene_name": "H2AC18; H2AC19", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N257-1", "protein_name": "Histone H2B type 3-B", "gene_name": "H2BC26", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99877-1", "protein_name": "Histone H2B type 1-N", "gene_name": "H2BC15", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99878-1", "protein_name": "Histone H2A type 1-J", "gene_name": "H2AC14", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99880-1", "protein_name": "Histone H2B type 1-L", "gene_name": "H2BC13", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14974-1", "protein_name": "Importin subunit beta-1", "gene_name": "KPNB1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P52294", "url": "https://www.uniprot.org/uniprotkb/P52294" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.33298899", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 37 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Interferon-alpha2b Treatment for COVID-19 Is Associated with Improvements in Lung Abnormalities.", "journal": "Viruses", "date": "2020", "authors": "Zhou Q, MacArthur MR, He X, Wei X, Zarin P, Hanna BS, Wang ZH, Xiang X, Fish EN", "reference": { "type": "PubMed", "id": "33396578", "url": "https://pubmed.ncbi.nlm.nih.gov/33396578" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P52294-1", "protein_name": "Importin subunit alpha-5", "gene_name": "KPNA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P18146-1", "protein_name": "Early growth response protein 1", "gene_name": "EGR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15646-1", "protein_name": "2'-5'-oligoadenylate synthase-like protein", "gene_name": "OASL", "tax_name": "Human" }, { "uniprot_canonical_ac": "P29728-1", "protein_name": "2'-5'-oligoadenylate synthase 2", "gene_name": "OAS2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15524-1", "protein_name": "Suppressor of cytokine signaling 1", "gene_name": "SOCS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y6K5-1", "protein_name": "2'-5'-oligoadenylate synthase 3", "gene_name": "OAS3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q02556-1", "protein_name": "Interferon regulatory factor 8", "gene_name": "IRF8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96AZ6-1", "protein_name": "Interferon-stimulated gene 20 kDa protein", "gene_name": "ISG20", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14896-1", "protein_name": "Interferon regulatory factor 6", "gene_name": "IRF6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P30511-1", "protein_name": "HLA class I histocompatibility antigen, alpha chain F", "gene_name": "HLA-F", "tax_name": "Human" }, { "uniprot_canonical_ac": "P13747-1", "protein_name": "HLA class I histocompatibility antigen, alpha chain E", "gene_name": "HLA-E", "tax_name": "Human" }, { "uniprot_canonical_ac": "P17693-1", "protein_name": "HLA class I histocompatibility antigen, alpha chain G", "gene_name": "HLA-G", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01563-1", "protein_name": "Interferon alpha-2", "gene_name": "IFNA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01567-1", "protein_name": "Interferon alpha-7", "gene_name": "IFNA7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01568-1", "protein_name": "Interferon alpha-21", "gene_name": "IFNA21", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01569-1", "protein_name": "Interferon alpha-5", "gene_name": "IFNA5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01570-1", "protein_name": "Interferon alpha-14", "gene_name": "IFNA14", "tax_name": "Human" }, { "uniprot_canonical_ac": "P09914-1", "protein_name": "Antiviral innate immune response effector IFIT1", "gene_name": "IFIT1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P32881-1", "protein_name": "Interferon alpha-8", "gene_name": "IFNA8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UHH9-1", "protein_name": "Inositol hexakisphosphate kinase 2", "gene_name": "IP6K2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05013-1", "protein_name": "Interferon alpha-6", "gene_name": "IFNA6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P09913-1", "protein_name": "Interferon-induced protein with tetratricopeptide repeats 2", "gene_name": "IFIT2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8WXG1-1", "protein_name": "S-adenosylmethionine-dependent nucleotide dehydratase RSAD2", "gene_name": "RSAD2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P20592-1", "protein_name": "Interferon-induced GTP-binding protein Mx2", "gene_name": "MX2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P14316-1", "protein_name": "Interferon regulatory factor 2", "gene_name": "IRF2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P29350-1", "protein_name": "Tyrosine-protein phosphatase non-receptor type 6", "gene_name": "PTPN6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14653-1", "protein_name": "Interferon regulatory factor 3", "gene_name": "IRF3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P20591-1", "protein_name": "Interferon-induced GTP-binding protein Mx1", "gene_name": "MX1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13568-1", "protein_name": "Interferon regulatory factor 5", "gene_name": "IRF5", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14879-1", "protein_name": "Interferon-induced protein with tetratricopeptide repeats 3", "gene_name": "IFIT3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q05823-1", "protein_name": "2-5A-dependent ribonuclease", "gene_name": "RNASEL", "tax_name": "Human" }, { "uniprot_canonical_ac": "P10914-1", "protein_name": "Interferon regulatory factor 1", "gene_name": "IRF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6GPH4-1", "protein_name": "XIAP-associated factor 1", "gene_name": "XAF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P52630-3", "protein_name": "Signal transducer and activator of transcription 2", "gene_name": "STAT2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P09912-1", "protein_name": "Interferon alpha-inducible protein 6", "gene_name": "IFI6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P10321-1", "protein_name": "HLA class I histocompatibility antigen, C alpha chain", "gene_name": "HLA-C", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04439-1", "protein_name": "HLA class I histocompatibility antigen, A alpha chain", "gene_name": "HLA-A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92985-1", "protein_name": "Interferon regulatory factor 7", "gene_name": "IRF7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61221-1", "protein_name": "ATP-binding cassette sub-family E member 1", "gene_name": "ABCE1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P00973-1", "protein_name": "2'-5'-oligoadenylate synthase 1", "gene_name": "OAS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05014-1", "protein_name": "Interferon alpha-4", "gene_name": "IFNA4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q06124-2", "protein_name": "Tyrosine-protein phosphatase non-receptor type 11", "gene_name": "PTPN11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P29597-1", "protein_name": "Non-receptor tyrosine-protein kinase TYK2", "gene_name": "TYK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14543-1", "protein_name": "Suppressor of cytokine signaling 3", "gene_name": "SOCS3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DY56-1", "protein_name": "Interferon alpha-1", "gene_name": "IFNA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62979-1", "protein_name": "Ubiquitin-ribosomal protein eS31 fusion protein", "gene_name": "RPS27A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q10589-1", "protein_name": "Bone marrow stromal antigen 2", "gene_name": "BST2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15306-1", "protein_name": "Interferon regulatory factor 4", "gene_name": "IRF4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P55265-1", "protein_name": "Double-stranded RNA-specific adenosine deaminase", "gene_name": "ADAR", "tax_name": "Human" }, { "uniprot_canonical_ac": "P13164-1", "protein_name": "Interferon-induced transmembrane protein 1", "gene_name": "IFITM1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P40305-2", "protein_name": "Interferon alpha-inducible protein 27, mitochondrial", "gene_name": "IFI27", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01629-1", "protein_name": "Interferon-induced transmembrane protein 2", "gene_name": "IFITM2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01566-1", "protein_name": "Interferon alpha-10", "gene_name": "IFNA10", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01571-1", "protein_name": "Interferon alpha-17", "gene_name": "IFNA17", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01574-1", "protein_name": "Interferon beta", "gene_name": "IFNB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05015-1", "protein_name": "Interferon alpha-16", "gene_name": "IFNA16", "tax_name": "Human" }, { "uniprot_canonical_ac": "P28062-1", "protein_name": "Proteasome subunit beta type-8", "gene_name": "PSMB8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13325-1", "protein_name": "Interferon-induced protein with tetratricopeptide repeats 5", "gene_name": "IFIT5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P19525-1", "protein_name": "Interferon-induced, double-stranded RNA-activated protein kinase", "gene_name": "EIF2AK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG47-1", "protein_name": "Polyubiquitin-B", "gene_name": "UBB", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42224-1", "protein_name": "Signal transducer and activator of transcription 1-alpha/beta", "gene_name": "STAT1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P80217-1", "protein_name": "Interferon-induced 35 kDa protein", "gene_name": "IFI35", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62987-1", "protein_name": "Ubiquitin-ribosomal protein eL40 fusion protein", "gene_name": "UBA52", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01628-1", "protein_name": "Interferon-induced transmembrane protein 3", "gene_name": "IFITM3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y3Z3-1", "protein_name": "Deoxynucleoside triphosphate triphosphohydrolase SAMHD1", "gene_name": "SAMHD1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P32456-1", "protein_name": "Guanylate-binding protein 2", "gene_name": "GBP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q00978-1", "protein_name": "Interferon regulatory factor 9", "gene_name": "IRF9", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01893-1", "protein_name": "Putative HLA class I histocompatibility antigen, alpha chain H", "gene_name": "HLA-H", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05161-1", "protein_name": "Ubiquitin-like protein ISG15", "gene_name": "ISG15", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14974-1", "protein_name": "Importin subunit beta-1", "gene_name": "KPNB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P23458-1", "protein_name": "Tyrosine-protein kinase JAK1", "gene_name": "JAK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P17181-1", "protein_name": "Interferon alpha/beta receptor 1", "gene_name": "IFNAR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG48-1", "protein_name": "Polyubiquitin-C", "gene_name": "UBC", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01889-1", "protein_name": "HLA class I histocompatibility antigen, B alpha chain", "gene_name": "HLA-B", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P52294", "url": "https://www.uniprot.org/uniprotkb/P52294" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.33396578", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 74 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Investigation of the Interaction of Human Origin Recognition Complex Subunit 1 with G-Quadruplex DNAs of Human c-myc Promoter and Telomere Regions.", "journal": "International journal of molecular sciences", "date": "2021", "authors": "Eladl A, Yamaoki Y, Hoshina S, Horinouchi H, Kondo K, Waga S, Nagata T, Katahira M", "reference": { "type": "PubMed", "id": "33801762", "url": "https://pubmed.ncbi.nlm.nih.gov/33801762" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P52294-1", "protein_name": "Importin subunit alpha-5", "gene_name": "KPNA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UBD5-1", "protein_name": "Origin recognition complex subunit 3", "gene_name": "ORC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13415-1", "protein_name": "Origin recognition complex subunit 1", "gene_name": "ORC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13416-1", "protein_name": "Origin recognition complex subunit 2", "gene_name": "ORC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60684-1", "protein_name": "Importin subunit alpha-7", "gene_name": "KPNA6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P84243-1", "protein_name": "Histone H3.3", "gene_name": "H3-3A; H3-3B", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43913-1", "protein_name": "Origin recognition complex subunit 5", "gene_name": "ORC5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62805-1", "protein_name": "Histone H4", "gene_name": "H4C11; H4C12; H4C13; H4C14; H4C15; H4C16; H4C1; H4C2; H4C3; H4C4; H4C5; H4C6; H4C8; H4C9", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68431-1", "protein_name": "Histone H3.1", "gene_name": "H3C10; H3C11; H3C12; H3C1; H3C2; H3C3; H3C4; H3C6; H3C7; H3C8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16778-1", "protein_name": "Histone H2B type 2-E", "gene_name": "H2BC21", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62807-1", "protein_name": "Histone H2B type 1-C/E/F/G/I", "gene_name": "H2BC10; H2BC4; H2BC6; H2BC7; H2BC8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q71DI3-1", "protein_name": "Histone H3.2", "gene_name": "H3C13; H3C14; H3C15", "tax_name": "Human" }, { "uniprot_canonical_ac": "P16104-1", "protein_name": "Histone H2AX", "gene_name": "H2AX", "tax_name": "Human" }, { "uniprot_canonical_ac": "P33778-1", "protein_name": "Histone H2B type 1-B", "gene_name": "H2BC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P58876-1", "protein_name": "Histone H2B type 1-D", "gene_name": "H2BC5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96A08-1", "protein_name": "Histone H2B type 1-A", "gene_name": "H2BC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P23527-1", "protein_name": "Histone H2B type 1-O", "gene_name": "H2BC17", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0C5Y9-1", "protein_name": "Histone H2A-Bbd type 1", "gene_name": "H2AB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BTM1-1", "protein_name": "Histone H2A.J", "gene_name": "H2AJ", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60814-1", "protein_name": "Histone H2B type 1-K", "gene_name": "H2BC12", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q93077-1", "protein_name": "Histone H2A type 1-C", "gene_name": "H2AC6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q93079-1", "protein_name": "Histone H2B type 1-H", "gene_name": "H2BC9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99879-1", "protein_name": "Histone H2B type 1-M", "gene_name": "H2BC14", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43929-1", "protein_name": "Origin recognition complex subunit 4", "gene_name": "ORC4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q71UI9-1", "protein_name": "Histone H2A.V", "gene_name": "H2AZ2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y5N6-1", "protein_name": "Origin recognition complex subunit 6", "gene_name": "ORC6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04908-1", "protein_name": "Histone H2A type 1-B/E", "gene_name": "H2AC4; H2AC8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06899-1", "protein_name": "Histone H2B type 1-J", "gene_name": "H2BC11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P20671-1", "protein_name": "Histone H2A type 1-D", "gene_name": "H2AC7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P57053-1", "protein_name": "Histone H2B type F-S", "gene_name": "H2BC12L", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16777-1", "protein_name": "Histone H2A type 2-C", "gene_name": "H2AC20", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6FI13-1", "protein_name": "Histone H2A type 2-A", "gene_name": "H2AC18; H2AC19", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N257-1", "protein_name": "Histone H2B type 3-B", "gene_name": "H2BC26", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99877-1", "protein_name": "Histone H2B type 1-N", "gene_name": "H2BC15", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99878-1", "protein_name": "Histone H2A type 1-J", "gene_name": "H2AC14", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99880-1", "protein_name": "Histone H2B type 1-L", "gene_name": "H2BC13", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14974-1", "protein_name": "Importin subunit beta-1", "gene_name": "KPNB1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P52294", "url": "https://www.uniprot.org/uniprotkb/P52294" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.33801762", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 37 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "KPNA1 regulates nuclear import of NCOR2 splice variant BQ323636.1 to confer tamoxifen resistance in breast cancer.", "journal": "Clinical and translational medicine", "date": "2021", "authors": "Tsoi H, Man EP, Leung MH, Mok KC, Chau KM, Wong LS, Chan WL, Chan SY, Luk MY, Cheng CN, Khoo US", "reference": { "type": "PubMed", "id": "34709749", "url": "https://pubmed.ncbi.nlm.nih.gov/34709749" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P52294-1", "protein_name": "Importin subunit alpha-5", "gene_name": "KPNA1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P52294", "url": "https://www.uniprot.org/uniprotkb/P52294" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.34709749", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Tumor suppressor BAP1 nuclear import is governed by transportin-1.", "journal": "The Journal of cell biology", "date": "2022", "authors": "Yang TJ, Li TN, Huang RS, Pan MY, Lin SY, Lin S, Wu KP, Wang LH, Hsu SD", "reference": { "type": "PubMed", "id": "35446349", "url": "https://pubmed.ncbi.nlm.nih.gov/35446349" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P52294-1", "protein_name": "Importin subunit alpha-5", "gene_name": "KPNA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92560-1", "protein_name": "Ubiquitin carboxyl-terminal hydrolase BAP1", "gene_name": "BAP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P52292-1", "protein_name": "Importin subunit alpha-1", "gene_name": "KPNA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92973-1", "protein_name": "Transportin-1", "gene_name": "TNPO1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99PU7-1", "protein_name": "Ubiquitin carboxyl-terminal hydrolase BAP1", "gene_name": "Bap1", "tax_name": "Mouse" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P52294", "url": "https://www.uniprot.org/uniprotkb/P52294" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 684, "end_pos": 729, "sequence_org": "QEGMLANLVEQNISVRRRQGVSIGRLHKQRKPDRRKRSRPYKAKRQ", "sequence_mut": "", "comment": "Predominantly localizes to the cytosol.", "evidence": [ { "database": "UniProtKB", "id": "Q92560", "url": "https://www.uniprot.org/uniprotkb/Q92560" }, { "database": "PubMed", "id": "35446349", "url": "https://pubmed.ncbi.nlm.nih.gov/35446349" } ], "uniprot_canonical_ac": "Q92560-1" } ], "record_id": "pubmed.35446349", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 5 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Decreased Expression of Karyopherin-alpha 1 is Related to the Malignant Degree of Cervical Cancer and is Critical for the Proliferation of Hela Cells.", "journal": "Pathology oncology research : POR", "date": "2022", "authors": "Jiang L, Li D, Wang C, Liao J, Liu J, Wei Q, Wang Y", "reference": { "type": "PubMed", "id": "35991835", "url": "https://pubmed.ncbi.nlm.nih.gov/35991835" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P52294-1", "protein_name": "Importin subunit alpha-5", "gene_name": "KPNA1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P52294", "url": "https://www.uniprot.org/uniprotkb/P52294" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.35991835", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Karyopherin Subunit Alpha 1 Enhances the Malignant Behaviors of Colon Cancer Cells via Promoting Nuclear Factor-\u03baB p65 Nuclear Translocation.", "journal": "Digestive diseases and sciences", "date": "2023-04-10", "authors": "Zhao Lianrong, Wu Di, Qu Qiao, Li Zhilong, Yin Hongzhuan", "reference": { "type": "PubMed", "id": "37038032", "url": "https://pubmed.ncbi.nlm.nih.gov/37038032" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P52294-1", "protein_name": "Importin subunit alpha-5", "gene_name": "KPNA1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P52294", "url": "https://www.uniprot.org/uniprotkb/P52294" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.37038032", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Interferon action--sequence specificity of the ppp(A2'p)nA-dependent ribonuclease.", "journal": "Nature", "date": "1981", "authors": "Wreschner DH, McCauley JW, Skehel JJ, Kerr IM", "reference": { "type": "PubMed", "id": "6162102", "url": "https://pubmed.ncbi.nlm.nih.gov/6162102" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P52294-1", "protein_name": "Importin subunit alpha-5", "gene_name": "KPNA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P18146-1", "protein_name": "Early growth response protein 1", "gene_name": "EGR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15646-1", "protein_name": "2'-5'-oligoadenylate synthase-like protein", "gene_name": "OASL", "tax_name": "Human" }, { "uniprot_canonical_ac": "P29728-1", "protein_name": "2'-5'-oligoadenylate synthase 2", "gene_name": "OAS2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15524-1", "protein_name": "Suppressor of cytokine signaling 1", "gene_name": "SOCS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y6K5-1", "protein_name": "2'-5'-oligoadenylate synthase 3", "gene_name": "OAS3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q02556-1", "protein_name": "Interferon regulatory factor 8", "gene_name": "IRF8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96AZ6-1", "protein_name": "Interferon-stimulated gene 20 kDa protein", "gene_name": "ISG20", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14896-1", "protein_name": "Interferon regulatory factor 6", "gene_name": "IRF6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P30511-1", "protein_name": "HLA class I histocompatibility antigen, alpha chain F", "gene_name": "HLA-F", "tax_name": "Human" }, { "uniprot_canonical_ac": "P13747-1", "protein_name": "HLA class I histocompatibility antigen, alpha chain E", "gene_name": "HLA-E", "tax_name": "Human" }, { "uniprot_canonical_ac": "P17693-1", "protein_name": "HLA class I histocompatibility antigen, alpha chain G", "gene_name": "HLA-G", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01563-1", "protein_name": "Interferon alpha-2", "gene_name": "IFNA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01567-1", "protein_name": "Interferon alpha-7", "gene_name": "IFNA7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01568-1", "protein_name": "Interferon alpha-21", "gene_name": "IFNA21", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01569-1", "protein_name": "Interferon alpha-5", "gene_name": "IFNA5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01570-1", "protein_name": "Interferon alpha-14", "gene_name": "IFNA14", "tax_name": "Human" }, { "uniprot_canonical_ac": "P09914-1", "protein_name": "Antiviral innate immune response effector IFIT1", "gene_name": "IFIT1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P32881-1", "protein_name": "Interferon alpha-8", "gene_name": "IFNA8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UHH9-1", "protein_name": "Inositol hexakisphosphate kinase 2", "gene_name": "IP6K2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05013-1", "protein_name": "Interferon alpha-6", "gene_name": "IFNA6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P09913-1", "protein_name": "Interferon-induced protein with tetratricopeptide repeats 2", "gene_name": "IFIT2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8WXG1-1", "protein_name": "S-adenosylmethionine-dependent nucleotide dehydratase RSAD2", "gene_name": "RSAD2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P20592-1", "protein_name": "Interferon-induced GTP-binding protein Mx2", "gene_name": "MX2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P14316-1", "protein_name": "Interferon regulatory factor 2", "gene_name": "IRF2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P29350-1", "protein_name": "Tyrosine-protein phosphatase non-receptor type 6", "gene_name": "PTPN6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14653-1", "protein_name": "Interferon regulatory factor 3", "gene_name": "IRF3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P20591-1", "protein_name": "Interferon-induced GTP-binding protein Mx1", "gene_name": "MX1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13568-1", "protein_name": "Interferon regulatory factor 5", "gene_name": "IRF5", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14879-1", "protein_name": "Interferon-induced protein with tetratricopeptide repeats 3", "gene_name": "IFIT3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q05823-1", "protein_name": "2-5A-dependent ribonuclease", "gene_name": "RNASEL", "tax_name": "Human" }, { "uniprot_canonical_ac": "P10914-1", "protein_name": "Interferon regulatory factor 1", "gene_name": "IRF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6GPH4-1", "protein_name": "XIAP-associated factor 1", "gene_name": "XAF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P52630-3", "protein_name": "Signal transducer and activator of transcription 2", "gene_name": "STAT2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P09912-1", "protein_name": "Interferon alpha-inducible protein 6", "gene_name": "IFI6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P10321-1", "protein_name": "HLA class I histocompatibility antigen, C alpha chain", "gene_name": "HLA-C", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04439-1", "protein_name": "HLA class I histocompatibility antigen, A alpha chain", "gene_name": "HLA-A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92985-1", "protein_name": "Interferon regulatory factor 7", "gene_name": "IRF7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61221-1", "protein_name": "ATP-binding cassette sub-family E member 1", "gene_name": "ABCE1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P00973-1", "protein_name": "2'-5'-oligoadenylate synthase 1", "gene_name": "OAS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05014-1", "protein_name": "Interferon alpha-4", "gene_name": "IFNA4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q06124-2", "protein_name": "Tyrosine-protein phosphatase non-receptor type 11", "gene_name": "PTPN11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P29597-1", "protein_name": "Non-receptor tyrosine-protein kinase TYK2", "gene_name": "TYK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14543-1", "protein_name": "Suppressor of cytokine signaling 3", "gene_name": "SOCS3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DY56-1", "protein_name": "Interferon alpha-1", "gene_name": "IFNA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62979-1", "protein_name": "Ubiquitin-ribosomal protein eS31 fusion protein", "gene_name": "RPS27A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q10589-1", "protein_name": "Bone marrow stromal antigen 2", "gene_name": "BST2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15306-1", "protein_name": "Interferon regulatory factor 4", "gene_name": "IRF4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P55265-1", "protein_name": "Double-stranded RNA-specific adenosine deaminase", "gene_name": "ADAR", "tax_name": "Human" }, { "uniprot_canonical_ac": "P13164-1", "protein_name": "Interferon-induced transmembrane protein 1", "gene_name": "IFITM1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P40305-2", "protein_name": "Interferon alpha-inducible protein 27, mitochondrial", "gene_name": "IFI27", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01629-1", "protein_name": "Interferon-induced transmembrane protein 2", "gene_name": "IFITM2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01566-1", "protein_name": "Interferon alpha-10", "gene_name": "IFNA10", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01571-1", "protein_name": "Interferon alpha-17", "gene_name": "IFNA17", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01574-1", "protein_name": "Interferon beta", "gene_name": "IFNB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05015-1", "protein_name": "Interferon alpha-16", "gene_name": "IFNA16", "tax_name": "Human" }, { "uniprot_canonical_ac": "P28062-1", "protein_name": "Proteasome subunit beta type-8", "gene_name": "PSMB8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13325-1", "protein_name": "Interferon-induced protein with tetratricopeptide repeats 5", "gene_name": "IFIT5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P19525-1", "protein_name": "Interferon-induced, double-stranded RNA-activated protein kinase", "gene_name": "EIF2AK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG47-1", "protein_name": "Polyubiquitin-B", "gene_name": "UBB", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42224-1", "protein_name": "Signal transducer and activator of transcription 1-alpha/beta", "gene_name": "STAT1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P80217-1", "protein_name": "Interferon-induced 35 kDa protein", "gene_name": "IFI35", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62987-1", "protein_name": "Ubiquitin-ribosomal protein eL40 fusion protein", "gene_name": "UBA52", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01628-1", "protein_name": "Interferon-induced transmembrane protein 3", "gene_name": "IFITM3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y3Z3-1", "protein_name": "Deoxynucleoside triphosphate triphosphohydrolase SAMHD1", "gene_name": "SAMHD1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P32456-1", "protein_name": "Guanylate-binding protein 2", "gene_name": "GBP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q00978-1", "protein_name": "Interferon regulatory factor 9", "gene_name": "IRF9", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01893-1", "protein_name": "Putative HLA class I histocompatibility antigen, alpha chain H", "gene_name": "HLA-H", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05161-1", "protein_name": "Ubiquitin-like protein ISG15", "gene_name": "ISG15", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14974-1", "protein_name": "Importin subunit beta-1", "gene_name": "KPNB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P23458-1", "protein_name": "Tyrosine-protein kinase JAK1", "gene_name": "JAK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P17181-1", "protein_name": "Interferon alpha/beta receptor 1", "gene_name": "IFNAR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG48-1", "protein_name": "Polyubiquitin-C", "gene_name": "UBC", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01889-1", "protein_name": "HLA class I histocompatibility antigen, B alpha chain", "gene_name": "HLA-B", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P52294", "url": "https://www.uniprot.org/uniprotkb/P52294" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.6162102", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 74 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Transcriptional and posttranscriptional regulation of interferon-induced gene expression in human cells.", "journal": "Cell", "date": "1984", "authors": "Friedman RL, Manly SP, McMahon M, Kerr IM, Stark GR", "reference": { "type": "PubMed", "id": "6548414", "url": "https://pubmed.ncbi.nlm.nih.gov/6548414" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P52294-1", "protein_name": "Importin subunit alpha-5", "gene_name": "KPNA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P18146-1", "protein_name": "Early growth response protein 1", "gene_name": "EGR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15646-1", "protein_name": "2'-5'-oligoadenylate synthase-like protein", "gene_name": "OASL", "tax_name": "Human" }, { "uniprot_canonical_ac": "P29728-1", "protein_name": "2'-5'-oligoadenylate synthase 2", "gene_name": "OAS2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15524-1", "protein_name": "Suppressor of cytokine signaling 1", "gene_name": "SOCS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y6K5-1", "protein_name": "2'-5'-oligoadenylate synthase 3", "gene_name": "OAS3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q02556-1", "protein_name": "Interferon regulatory factor 8", "gene_name": "IRF8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96AZ6-1", "protein_name": "Interferon-stimulated gene 20 kDa protein", "gene_name": "ISG20", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14896-1", "protein_name": "Interferon regulatory factor 6", "gene_name": "IRF6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P30511-1", "protein_name": "HLA class I histocompatibility antigen, alpha chain F", "gene_name": "HLA-F", "tax_name": "Human" }, { "uniprot_canonical_ac": "P13747-1", "protein_name": "HLA class I histocompatibility antigen, alpha chain E", "gene_name": "HLA-E", "tax_name": "Human" }, { "uniprot_canonical_ac": "P17693-1", "protein_name": "HLA class I histocompatibility antigen, alpha chain G", "gene_name": "HLA-G", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01563-1", "protein_name": "Interferon alpha-2", "gene_name": "IFNA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01567-1", "protein_name": "Interferon alpha-7", "gene_name": "IFNA7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01568-1", "protein_name": "Interferon alpha-21", "gene_name": "IFNA21", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01569-1", "protein_name": "Interferon alpha-5", "gene_name": "IFNA5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01570-1", "protein_name": "Interferon alpha-14", "gene_name": "IFNA14", "tax_name": "Human" }, { "uniprot_canonical_ac": "P09914-1", "protein_name": "Antiviral innate immune response effector IFIT1", "gene_name": "IFIT1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P32881-1", "protein_name": "Interferon alpha-8", "gene_name": "IFNA8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UHH9-1", "protein_name": "Inositol hexakisphosphate kinase 2", "gene_name": "IP6K2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05013-1", "protein_name": "Interferon alpha-6", "gene_name": "IFNA6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P09913-1", "protein_name": "Interferon-induced protein with tetratricopeptide repeats 2", "gene_name": "IFIT2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8WXG1-1", "protein_name": "S-adenosylmethionine-dependent nucleotide dehydratase RSAD2", "gene_name": "RSAD2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P20592-1", "protein_name": "Interferon-induced GTP-binding protein Mx2", "gene_name": "MX2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P14316-1", "protein_name": "Interferon regulatory factor 2", "gene_name": "IRF2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P29350-1", "protein_name": "Tyrosine-protein phosphatase non-receptor type 6", "gene_name": "PTPN6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14653-1", "protein_name": "Interferon regulatory factor 3", "gene_name": "IRF3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P20591-1", "protein_name": "Interferon-induced GTP-binding protein Mx1", "gene_name": "MX1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13568-1", "protein_name": "Interferon regulatory factor 5", "gene_name": "IRF5", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14879-1", "protein_name": "Interferon-induced protein with tetratricopeptide repeats 3", "gene_name": "IFIT3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q05823-1", "protein_name": "2-5A-dependent ribonuclease", "gene_name": "RNASEL", "tax_name": "Human" }, { "uniprot_canonical_ac": "P10914-1", "protein_name": "Interferon regulatory factor 1", "gene_name": "IRF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6GPH4-1", "protein_name": "XIAP-associated factor 1", "gene_name": "XAF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P52630-3", "protein_name": "Signal transducer and activator of transcription 2", "gene_name": "STAT2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P09912-1", "protein_name": "Interferon alpha-inducible protein 6", "gene_name": "IFI6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P10321-1", "protein_name": "HLA class I histocompatibility antigen, C alpha chain", "gene_name": "HLA-C", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04439-1", "protein_name": "HLA class I histocompatibility antigen, A alpha chain", "gene_name": "HLA-A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92985-1", "protein_name": "Interferon regulatory factor 7", "gene_name": "IRF7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61221-1", "protein_name": "ATP-binding cassette sub-family E member 1", "gene_name": "ABCE1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P00973-1", "protein_name": "2'-5'-oligoadenylate synthase 1", "gene_name": "OAS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05014-1", "protein_name": "Interferon alpha-4", "gene_name": "IFNA4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q06124-2", "protein_name": "Tyrosine-protein phosphatase non-receptor type 11", "gene_name": "PTPN11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P29597-1", "protein_name": "Non-receptor tyrosine-protein kinase TYK2", "gene_name": "TYK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14543-1", "protein_name": "Suppressor of cytokine signaling 3", "gene_name": "SOCS3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DY56-1", "protein_name": "Interferon alpha-1", "gene_name": "IFNA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62979-1", "protein_name": "Ubiquitin-ribosomal protein eS31 fusion protein", "gene_name": "RPS27A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q10589-1", "protein_name": "Bone marrow stromal antigen 2", "gene_name": "BST2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15306-1", "protein_name": "Interferon regulatory factor 4", "gene_name": "IRF4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P55265-1", "protein_name": "Double-stranded RNA-specific adenosine deaminase", "gene_name": "ADAR", "tax_name": "Human" }, { "uniprot_canonical_ac": "P13164-1", "protein_name": "Interferon-induced transmembrane protein 1", "gene_name": "IFITM1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P40305-2", "protein_name": "Interferon alpha-inducible protein 27, mitochondrial", "gene_name": "IFI27", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01629-1", "protein_name": "Interferon-induced transmembrane protein 2", "gene_name": "IFITM2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01566-1", "protein_name": "Interferon alpha-10", "gene_name": "IFNA10", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01571-1", "protein_name": "Interferon alpha-17", "gene_name": "IFNA17", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01574-1", "protein_name": "Interferon beta", "gene_name": "IFNB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05015-1", "protein_name": "Interferon alpha-16", "gene_name": "IFNA16", "tax_name": "Human" }, { "uniprot_canonical_ac": "P28062-1", "protein_name": "Proteasome subunit beta type-8", "gene_name": "PSMB8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13325-1", "protein_name": "Interferon-induced protein with tetratricopeptide repeats 5", "gene_name": "IFIT5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P19525-1", "protein_name": "Interferon-induced, double-stranded RNA-activated protein kinase", "gene_name": "EIF2AK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG47-1", "protein_name": "Polyubiquitin-B", "gene_name": "UBB", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42224-1", "protein_name": "Signal transducer and activator of transcription 1-alpha/beta", "gene_name": "STAT1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P80217-1", "protein_name": "Interferon-induced 35 kDa protein", "gene_name": "IFI35", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62987-1", "protein_name": "Ubiquitin-ribosomal protein eL40 fusion protein", "gene_name": "UBA52", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01628-1", "protein_name": "Interferon-induced transmembrane protein 3", "gene_name": "IFITM3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y3Z3-1", "protein_name": "Deoxynucleoside triphosphate triphosphohydrolase SAMHD1", "gene_name": "SAMHD1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P32456-1", "protein_name": "Guanylate-binding protein 2", "gene_name": "GBP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q00978-1", "protein_name": "Interferon regulatory factor 9", "gene_name": "IRF9", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01893-1", "protein_name": "Putative HLA class I histocompatibility antigen, alpha chain H", "gene_name": "HLA-H", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62328-1", "protein_name": "Thymosin beta-4", "gene_name": "TMSB4X", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05161-1", "protein_name": "Ubiquitin-like protein ISG15", "gene_name": "ISG15", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14974-1", "protein_name": "Importin subunit beta-1", "gene_name": "KPNB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P23458-1", "protein_name": "Tyrosine-protein kinase JAK1", "gene_name": "JAK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P17181-1", "protein_name": "Interferon alpha/beta receptor 1", "gene_name": "IFNAR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG48-1", "protein_name": "Polyubiquitin-C", "gene_name": "UBC", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01889-1", "protein_name": "HLA class I histocompatibility antigen, B alpha chain", "gene_name": "HLA-B", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P52294", "url": "https://www.uniprot.org/uniprotkb/P52294" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.6548414", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 75 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Interferon-associated, dsRNA-dependent enzyme activities in a mutant 3T6 cell engaged in the semiconstitutive synthesis of interferon.", "journal": "Cell", "date": "1978-08", "authors": "Jarvis A P, White C, Ball A, Gupta S L, Ratner L, Sen G C, Colby C", "reference": { "type": "PubMed", "id": "688397", "url": "https://pubmed.ncbi.nlm.nih.gov/688397" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P52294-1", "protein_name": "Importin subunit alpha-5", "gene_name": "KPNA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P18146-1", "protein_name": "Early growth response protein 1", "gene_name": "EGR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15646-1", "protein_name": "2'-5'-oligoadenylate synthase-like protein", "gene_name": "OASL", "tax_name": "Human" }, { "uniprot_canonical_ac": "P29728-1", "protein_name": "2'-5'-oligoadenylate synthase 2", "gene_name": "OAS2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15524-1", "protein_name": "Suppressor of cytokine signaling 1", "gene_name": "SOCS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y6K5-1", "protein_name": "2'-5'-oligoadenylate synthase 3", "gene_name": "OAS3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q02556-1", "protein_name": "Interferon regulatory factor 8", "gene_name": "IRF8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96AZ6-1", "protein_name": "Interferon-stimulated gene 20 kDa protein", "gene_name": "ISG20", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14896-1", "protein_name": "Interferon regulatory factor 6", "gene_name": "IRF6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P30511-1", "protein_name": "HLA class I histocompatibility antigen, alpha chain F", "gene_name": "HLA-F", "tax_name": "Human" }, { "uniprot_canonical_ac": "P13747-1", "protein_name": "HLA class I histocompatibility antigen, alpha chain E", "gene_name": "HLA-E", "tax_name": "Human" }, { "uniprot_canonical_ac": "P17693-1", "protein_name": "HLA class I histocompatibility antigen, alpha chain G", "gene_name": "HLA-G", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01563-1", "protein_name": "Interferon alpha-2", "gene_name": "IFNA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01567-1", "protein_name": "Interferon alpha-7", "gene_name": "IFNA7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01568-1", "protein_name": "Interferon alpha-21", "gene_name": "IFNA21", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01569-1", "protein_name": "Interferon alpha-5", "gene_name": "IFNA5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01570-1", "protein_name": "Interferon alpha-14", "gene_name": "IFNA14", "tax_name": "Human" }, { "uniprot_canonical_ac": "P09914-1", "protein_name": "Antiviral innate immune response effector IFIT1", "gene_name": "IFIT1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P32881-1", "protein_name": "Interferon alpha-8", "gene_name": "IFNA8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UHH9-1", "protein_name": "Inositol hexakisphosphate kinase 2", "gene_name": "IP6K2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05013-1", "protein_name": "Interferon alpha-6", "gene_name": "IFNA6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P09913-1", "protein_name": "Interferon-induced protein with tetratricopeptide repeats 2", "gene_name": "IFIT2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8WXG1-1", "protein_name": "S-adenosylmethionine-dependent nucleotide dehydratase RSAD2", "gene_name": "RSAD2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P20592-1", "protein_name": "Interferon-induced GTP-binding protein Mx2", "gene_name": "MX2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P14316-1", "protein_name": "Interferon regulatory factor 2", "gene_name": "IRF2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P29350-1", "protein_name": "Tyrosine-protein phosphatase non-receptor type 6", "gene_name": "PTPN6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14653-1", "protein_name": "Interferon regulatory factor 3", "gene_name": "IRF3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P20591-1", "protein_name": "Interferon-induced GTP-binding protein Mx1", "gene_name": "MX1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13568-1", "protein_name": "Interferon regulatory factor 5", "gene_name": "IRF5", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14879-1", "protein_name": "Interferon-induced protein with tetratricopeptide repeats 3", "gene_name": "IFIT3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q05823-1", "protein_name": "2-5A-dependent ribonuclease", "gene_name": "RNASEL", "tax_name": "Human" }, { "uniprot_canonical_ac": "P10914-1", "protein_name": "Interferon regulatory factor 1", "gene_name": "IRF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6GPH4-1", "protein_name": "XIAP-associated factor 1", "gene_name": "XAF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P52630-3", "protein_name": "Signal transducer and activator of transcription 2", "gene_name": "STAT2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P09912-1", "protein_name": "Interferon alpha-inducible protein 6", "gene_name": "IFI6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P10321-1", "protein_name": "HLA class I histocompatibility antigen, C alpha chain", "gene_name": "HLA-C", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04439-1", "protein_name": "HLA class I histocompatibility antigen, A alpha chain", "gene_name": "HLA-A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92985-1", "protein_name": "Interferon regulatory factor 7", "gene_name": "IRF7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61221-1", "protein_name": "ATP-binding cassette sub-family E member 1", "gene_name": "ABCE1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P00973-1", "protein_name": "2'-5'-oligoadenylate synthase 1", "gene_name": "OAS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05014-1", "protein_name": "Interferon alpha-4", "gene_name": "IFNA4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q06124-2", "protein_name": "Tyrosine-protein phosphatase non-receptor type 11", "gene_name": "PTPN11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P29597-1", "protein_name": "Non-receptor tyrosine-protein kinase TYK2", "gene_name": "TYK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14543-1", "protein_name": "Suppressor of cytokine signaling 3", "gene_name": "SOCS3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DY56-1", "protein_name": "Interferon alpha-1", "gene_name": "IFNA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62979-1", "protein_name": "Ubiquitin-ribosomal protein eS31 fusion protein", "gene_name": "RPS27A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q10589-1", "protein_name": "Bone marrow stromal antigen 2", "gene_name": "BST2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15306-1", "protein_name": "Interferon regulatory factor 4", "gene_name": "IRF4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P55265-1", "protein_name": "Double-stranded RNA-specific adenosine deaminase", "gene_name": "ADAR", "tax_name": "Human" }, { "uniprot_canonical_ac": "P13164-1", "protein_name": "Interferon-induced transmembrane protein 1", "gene_name": "IFITM1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P40305-2", "protein_name": "Interferon alpha-inducible protein 27, mitochondrial", "gene_name": "IFI27", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01629-1", "protein_name": "Interferon-induced transmembrane protein 2", "gene_name": "IFITM2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01566-1", "protein_name": "Interferon alpha-10", "gene_name": "IFNA10", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01571-1", "protein_name": "Interferon alpha-17", "gene_name": "IFNA17", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01574-1", "protein_name": "Interferon beta", "gene_name": "IFNB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05015-1", "protein_name": "Interferon alpha-16", "gene_name": "IFNA16", "tax_name": "Human" }, { "uniprot_canonical_ac": "P28062-1", "protein_name": "Proteasome subunit beta type-8", "gene_name": "PSMB8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13325-1", "protein_name": "Interferon-induced protein with tetratricopeptide repeats 5", "gene_name": "IFIT5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P19525-1", "protein_name": "Interferon-induced, double-stranded RNA-activated protein kinase", "gene_name": "EIF2AK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG47-1", "protein_name": "Polyubiquitin-B", "gene_name": "UBB", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42224-1", "protein_name": "Signal transducer and activator of transcription 1-alpha/beta", "gene_name": "STAT1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P80217-1", "protein_name": "Interferon-induced 35 kDa protein", "gene_name": "IFI35", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62987-1", "protein_name": "Ubiquitin-ribosomal protein eL40 fusion protein", "gene_name": "UBA52", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01628-1", "protein_name": "Interferon-induced transmembrane protein 3", "gene_name": "IFITM3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y3Z3-1", "protein_name": "Deoxynucleoside triphosphate triphosphohydrolase SAMHD1", "gene_name": "SAMHD1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P32456-1", "protein_name": "Guanylate-binding protein 2", "gene_name": "GBP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q00978-1", "protein_name": "Interferon regulatory factor 9", "gene_name": "IRF9", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01893-1", "protein_name": "Putative HLA class I histocompatibility antigen, alpha chain H", "gene_name": "HLA-H", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05161-1", "protein_name": "Ubiquitin-like protein ISG15", "gene_name": "ISG15", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14974-1", "protein_name": "Importin subunit beta-1", "gene_name": "KPNB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P23458-1", "protein_name": "Tyrosine-protein kinase JAK1", "gene_name": "JAK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P17181-1", "protein_name": "Interferon alpha/beta receptor 1", "gene_name": "IFNAR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG48-1", "protein_name": "Polyubiquitin-C", "gene_name": "UBC", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01889-1", "protein_name": "HLA class I histocompatibility antigen, B alpha chain", "gene_name": "HLA-B", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P52294", "url": "https://www.uniprot.org/uniprotkb/P52294" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.688397", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 74 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Direct binding to and tyrosine phosphorylation of the alpha subunit of the type I interferon receptor by p135tyk2 tyrosine kinase.", "journal": "Molecular and cellular biology", "date": "1994", "authors": "Colamonici O, Yan H, Domanski P, Handa R, Smalley D, Mullersman J, Witte M, Krishnan K, Krolewski J", "reference": { "type": "PubMed", "id": "7526154", "url": "https://pubmed.ncbi.nlm.nih.gov/7526154" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P52294-1", "protein_name": "Importin subunit alpha-5", "gene_name": "KPNA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P18146-1", "protein_name": "Early growth response protein 1", "gene_name": "EGR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15646-1", "protein_name": "2'-5'-oligoadenylate synthase-like protein", "gene_name": "OASL", "tax_name": "Human" }, { "uniprot_canonical_ac": "P29728-1", "protein_name": "2'-5'-oligoadenylate synthase 2", "gene_name": "OAS2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15524-1", "protein_name": "Suppressor of cytokine signaling 1", "gene_name": "SOCS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y6K5-1", "protein_name": "2'-5'-oligoadenylate synthase 3", "gene_name": "OAS3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q02556-1", "protein_name": "Interferon regulatory factor 8", "gene_name": "IRF8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96AZ6-1", "protein_name": "Interferon-stimulated gene 20 kDa protein", "gene_name": "ISG20", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14896-1", "protein_name": "Interferon regulatory factor 6", "gene_name": "IRF6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P30511-1", "protein_name": "HLA class I histocompatibility antigen, alpha chain F", "gene_name": "HLA-F", "tax_name": "Human" }, { "uniprot_canonical_ac": "P13747-1", "protein_name": "HLA class I histocompatibility antigen, alpha chain E", "gene_name": "HLA-E", "tax_name": "Human" }, { "uniprot_canonical_ac": "P17693-1", "protein_name": "HLA class I histocompatibility antigen, alpha chain G", "gene_name": "HLA-G", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01563-1", "protein_name": "Interferon alpha-2", "gene_name": "IFNA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01567-1", "protein_name": "Interferon alpha-7", "gene_name": "IFNA7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01568-1", "protein_name": "Interferon alpha-21", "gene_name": "IFNA21", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01569-1", "protein_name": "Interferon alpha-5", "gene_name": "IFNA5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01570-1", "protein_name": "Interferon alpha-14", "gene_name": "IFNA14", "tax_name": "Human" }, { "uniprot_canonical_ac": "P09914-1", "protein_name": "Antiviral innate immune response effector IFIT1", "gene_name": "IFIT1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P32881-1", "protein_name": "Interferon alpha-8", "gene_name": "IFNA8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UHH9-1", "protein_name": "Inositol hexakisphosphate kinase 2", "gene_name": "IP6K2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05013-1", "protein_name": "Interferon alpha-6", "gene_name": "IFNA6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P09913-1", "protein_name": "Interferon-induced protein with tetratricopeptide repeats 2", "gene_name": "IFIT2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8WXG1-1", "protein_name": "S-adenosylmethionine-dependent nucleotide dehydratase RSAD2", "gene_name": "RSAD2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P20592-1", "protein_name": "Interferon-induced GTP-binding protein Mx2", "gene_name": "MX2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P14316-1", "protein_name": "Interferon regulatory factor 2", "gene_name": "IRF2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P29350-1", "protein_name": "Tyrosine-protein phosphatase non-receptor type 6", "gene_name": "PTPN6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14653-1", "protein_name": "Interferon regulatory factor 3", "gene_name": "IRF3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P20591-1", "protein_name": "Interferon-induced GTP-binding protein Mx1", "gene_name": "MX1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13568-1", "protein_name": "Interferon regulatory factor 5", "gene_name": "IRF5", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14879-1", "protein_name": "Interferon-induced protein with tetratricopeptide repeats 3", "gene_name": "IFIT3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q05823-1", "protein_name": "2-5A-dependent ribonuclease", "gene_name": "RNASEL", "tax_name": "Human" }, { "uniprot_canonical_ac": "P10914-1", "protein_name": "Interferon regulatory factor 1", "gene_name": "IRF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6GPH4-1", "protein_name": "XIAP-associated factor 1", "gene_name": "XAF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P52630-3", "protein_name": "Signal transducer and activator of transcription 2", "gene_name": "STAT2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P09912-1", "protein_name": "Interferon alpha-inducible protein 6", "gene_name": "IFI6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P10321-1", "protein_name": "HLA class I histocompatibility antigen, C alpha chain", "gene_name": "HLA-C", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04439-1", "protein_name": "HLA class I histocompatibility antigen, A alpha chain", "gene_name": "HLA-A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92985-1", "protein_name": "Interferon regulatory factor 7", "gene_name": "IRF7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61221-1", "protein_name": "ATP-binding cassette sub-family E member 1", "gene_name": "ABCE1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P00973-1", "protein_name": "2'-5'-oligoadenylate synthase 1", "gene_name": "OAS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05014-1", "protein_name": "Interferon alpha-4", "gene_name": "IFNA4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q06124-2", "protein_name": "Tyrosine-protein phosphatase non-receptor type 11", "gene_name": "PTPN11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P29597-1", "protein_name": "Non-receptor tyrosine-protein kinase TYK2", "gene_name": "TYK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14543-1", "protein_name": "Suppressor of cytokine signaling 3", "gene_name": "SOCS3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DY56-1", "protein_name": "Interferon alpha-1", "gene_name": "IFNA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62979-1", "protein_name": "Ubiquitin-ribosomal protein eS31 fusion protein", "gene_name": "RPS27A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q10589-1", "protein_name": "Bone marrow stromal antigen 2", "gene_name": "BST2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15306-1", "protein_name": "Interferon regulatory factor 4", "gene_name": "IRF4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P55265-1", "protein_name": "Double-stranded RNA-specific adenosine deaminase", "gene_name": "ADAR", "tax_name": "Human" }, { "uniprot_canonical_ac": "P13164-1", "protein_name": "Interferon-induced transmembrane protein 1", "gene_name": "IFITM1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P40305-2", "protein_name": "Interferon alpha-inducible protein 27, mitochondrial", "gene_name": "IFI27", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01629-1", "protein_name": "Interferon-induced transmembrane protein 2", "gene_name": "IFITM2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01566-1", "protein_name": "Interferon alpha-10", "gene_name": "IFNA10", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01571-1", "protein_name": "Interferon alpha-17", "gene_name": "IFNA17", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01574-1", "protein_name": "Interferon beta", "gene_name": "IFNB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05015-1", "protein_name": "Interferon alpha-16", "gene_name": "IFNA16", "tax_name": "Human" }, { "uniprot_canonical_ac": "P28062-1", "protein_name": "Proteasome subunit beta type-8", "gene_name": "PSMB8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13325-1", "protein_name": "Interferon-induced protein with tetratricopeptide repeats 5", "gene_name": "IFIT5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P19525-1", "protein_name": "Interferon-induced, double-stranded RNA-activated protein kinase", "gene_name": "EIF2AK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG47-1", "protein_name": "Polyubiquitin-B", "gene_name": "UBB", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42224-1", "protein_name": "Signal transducer and activator of transcription 1-alpha/beta", "gene_name": "STAT1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P80217-1", "protein_name": "Interferon-induced 35 kDa protein", "gene_name": "IFI35", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62987-1", "protein_name": "Ubiquitin-ribosomal protein eL40 fusion protein", "gene_name": "UBA52", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01628-1", "protein_name": "Interferon-induced transmembrane protein 3", "gene_name": "IFITM3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y3Z3-1", "protein_name": "Deoxynucleoside triphosphate triphosphohydrolase SAMHD1", "gene_name": "SAMHD1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P32456-1", "protein_name": "Guanylate-binding protein 2", "gene_name": "GBP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q00978-1", "protein_name": "Interferon regulatory factor 9", "gene_name": "IRF9", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01893-1", "protein_name": "Putative HLA class I histocompatibility antigen, alpha chain H", "gene_name": "HLA-H", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05161-1", "protein_name": "Ubiquitin-like protein ISG15", "gene_name": "ISG15", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14974-1", "protein_name": "Importin subunit beta-1", "gene_name": "KPNB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P23458-1", "protein_name": "Tyrosine-protein kinase JAK1", "gene_name": "JAK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P17181-1", "protein_name": "Interferon alpha/beta receptor 1", "gene_name": "IFNAR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG48-1", "protein_name": "Polyubiquitin-C", "gene_name": "UBC", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01889-1", "protein_name": "HLA class I histocompatibility antigen, B alpha chain", "gene_name": "HLA-B", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P52294", "url": "https://www.uniprot.org/uniprotkb/P52294" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 466, "end_pos": 466, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "Phosphotyrosine; by TYK2", "evidence": [ { "database": "UniProtKB", "id": "P17181", "url": "https://www.uniprot.org/uniprotkb/P17181" }, { "database": "IntAct", "id": "P17181", "url": "https://www.ebi.ac.uk/intact/interactors/id:P17181*" }, { "database": "iPTMnet", "id": "P17181", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P17181" }, { "database": "PubMed", "id": "12220192", "url": "https://pubmed.ncbi.nlm.nih.gov/12220192" }, { "database": "PubMed", "id": "9121453", "url": "https://pubmed.ncbi.nlm.nih.gov/9121453" }, { "database": "PubMed", "id": "8605876", "url": "https://pubmed.ncbi.nlm.nih.gov/8605876" }, { "database": "PubMed", "id": "9677371", "url": "https://pubmed.ncbi.nlm.nih.gov/9677371" }, { "database": "PRO", "id": "P17181", "url": "https://proconsortium.org/cgi-bin/entry_pro?id=P17181" }, { "database": "PubMed", "id": "11786546", "url": "https://pubmed.ncbi.nlm.nih.gov/11786546" }, { "database": "PubMed", "id": "7526154", "url": "https://pubmed.ncbi.nlm.nih.gov/7526154" } ], "site_lbl": "Tyr466", "uniprot_canonical_ac": "P17181-1" }, { "start_pos": 481, "end_pos": 481, "kinase_uniprot_canonical_ac": "P29597-1", "kinase_gene_name": "TYK2", "residue": "Tyr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P17181", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P17181" }, { "database": "PubMed", "id": "7526154", "url": "https://pubmed.ncbi.nlm.nih.gov/7526154" } ], "site_lbl": "Tyr481", "uniprot_canonical_ac": "P17181-1" }, { "start_pos": 481, "end_pos": 481, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "Phosphotyrosine; by TYK2", "evidence": [ { "database": "UniProtKB", "id": "P17181", "url": "https://www.uniprot.org/uniprotkb/P17181" }, { "database": "PRO", "id": "P17181", "url": "https://proconsortium.org/cgi-bin/entry_pro?id=P17181" }, { "database": "iPTMnet", "id": "P17181", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P17181" }, { "database": "PubMed", "id": "7526154", "url": "https://pubmed.ncbi.nlm.nih.gov/7526154" } ], "site_lbl": "Tyr481", "uniprot_canonical_ac": "P17181-1" } ], "record_id": "pubmed.7526154", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 74 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 3 }, { "field": "total_sites", "count": 2 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Tyrosine-phosphorylated Stat1 and Stat2 plus a 48-kDa protein all contact DNA in forming interferon-stimulated-gene factor 3.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1995", "authors": "Qureshi SA, Salditt-Georgieff M, Darnell JE Jr", "reference": { "type": "PubMed", "id": "7537377", "url": "https://pubmed.ncbi.nlm.nih.gov/7537377" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P52294-1", "protein_name": "Importin subunit alpha-5", "gene_name": "KPNA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P18146-1", "protein_name": "Early growth response protein 1", "gene_name": "EGR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15646-1", "protein_name": "2'-5'-oligoadenylate synthase-like protein", "gene_name": "OASL", "tax_name": "Human" }, { "uniprot_canonical_ac": "P29728-1", "protein_name": "2'-5'-oligoadenylate synthase 2", "gene_name": "OAS2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15524-1", "protein_name": "Suppressor of cytokine signaling 1", "gene_name": "SOCS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y6K5-1", "protein_name": "2'-5'-oligoadenylate synthase 3", "gene_name": "OAS3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q02556-1", "protein_name": "Interferon regulatory factor 8", "gene_name": "IRF8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96AZ6-1", "protein_name": "Interferon-stimulated gene 20 kDa protein", "gene_name": "ISG20", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14896-1", "protein_name": "Interferon regulatory factor 6", "gene_name": "IRF6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P30511-1", "protein_name": "HLA class I histocompatibility antigen, alpha chain F", "gene_name": "HLA-F", "tax_name": "Human" }, { "uniprot_canonical_ac": "P13747-1", "protein_name": "HLA class I histocompatibility antigen, alpha chain E", "gene_name": "HLA-E", "tax_name": "Human" }, { "uniprot_canonical_ac": "P17693-1", "protein_name": "HLA class I histocompatibility antigen, alpha chain G", "gene_name": "HLA-G", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01563-1", "protein_name": "Interferon alpha-2", "gene_name": "IFNA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01567-1", "protein_name": "Interferon alpha-7", "gene_name": "IFNA7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01568-1", "protein_name": "Interferon alpha-21", "gene_name": "IFNA21", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01569-1", "protein_name": "Interferon alpha-5", "gene_name": "IFNA5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01570-1", "protein_name": "Interferon alpha-14", "gene_name": "IFNA14", "tax_name": "Human" }, { "uniprot_canonical_ac": "P09914-1", "protein_name": "Antiviral innate immune response effector IFIT1", "gene_name": "IFIT1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P32881-1", "protein_name": "Interferon alpha-8", "gene_name": "IFNA8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UHH9-1", "protein_name": "Inositol hexakisphosphate kinase 2", "gene_name": "IP6K2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05013-1", "protein_name": "Interferon alpha-6", "gene_name": "IFNA6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P09913-1", "protein_name": "Interferon-induced protein with tetratricopeptide repeats 2", "gene_name": "IFIT2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8WXG1-1", "protein_name": "S-adenosylmethionine-dependent nucleotide dehydratase RSAD2", "gene_name": "RSAD2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P20592-1", "protein_name": "Interferon-induced GTP-binding protein Mx2", "gene_name": "MX2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P14316-1", "protein_name": "Interferon regulatory factor 2", "gene_name": "IRF2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P29350-1", "protein_name": "Tyrosine-protein phosphatase non-receptor type 6", "gene_name": "PTPN6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14653-1", "protein_name": "Interferon regulatory factor 3", "gene_name": "IRF3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P20591-1", "protein_name": "Interferon-induced GTP-binding protein Mx1", "gene_name": "MX1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13568-1", "protein_name": "Interferon regulatory factor 5", "gene_name": "IRF5", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14879-1", "protein_name": "Interferon-induced protein with tetratricopeptide repeats 3", "gene_name": "IFIT3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q05823-1", "protein_name": "2-5A-dependent ribonuclease", "gene_name": "RNASEL", "tax_name": "Human" }, { "uniprot_canonical_ac": "P10914-1", "protein_name": "Interferon regulatory factor 1", "gene_name": "IRF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6GPH4-1", "protein_name": "XIAP-associated factor 1", "gene_name": "XAF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P52630-3", "protein_name": "Signal transducer and activator of transcription 2", "gene_name": "STAT2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P09912-1", "protein_name": "Interferon alpha-inducible protein 6", "gene_name": "IFI6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P10321-1", "protein_name": "HLA class I histocompatibility antigen, C alpha chain", "gene_name": "HLA-C", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04439-1", "protein_name": "HLA class I histocompatibility antigen, A alpha chain", "gene_name": "HLA-A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92985-1", "protein_name": "Interferon regulatory factor 7", "gene_name": "IRF7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61221-1", "protein_name": "ATP-binding cassette sub-family E member 1", "gene_name": "ABCE1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P00973-1", "protein_name": "2'-5'-oligoadenylate synthase 1", "gene_name": "OAS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05014-1", "protein_name": "Interferon alpha-4", "gene_name": "IFNA4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q06124-2", "protein_name": "Tyrosine-protein phosphatase non-receptor type 11", "gene_name": "PTPN11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P29597-1", "protein_name": "Non-receptor tyrosine-protein kinase TYK2", "gene_name": "TYK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14543-1", "protein_name": "Suppressor of cytokine signaling 3", "gene_name": "SOCS3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DY56-1", "protein_name": "Interferon alpha-1", "gene_name": "IFNA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62979-1", "protein_name": "Ubiquitin-ribosomal protein eS31 fusion protein", "gene_name": "RPS27A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q10589-1", "protein_name": "Bone marrow stromal antigen 2", "gene_name": "BST2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15306-1", "protein_name": "Interferon regulatory factor 4", "gene_name": "IRF4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P55265-1", "protein_name": "Double-stranded RNA-specific adenosine deaminase", "gene_name": "ADAR", "tax_name": "Human" }, { "uniprot_canonical_ac": "P13164-1", "protein_name": "Interferon-induced transmembrane protein 1", "gene_name": "IFITM1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P40305-2", "protein_name": "Interferon alpha-inducible protein 27, mitochondrial", "gene_name": "IFI27", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01629-1", "protein_name": "Interferon-induced transmembrane protein 2", "gene_name": "IFITM2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01566-1", "protein_name": "Interferon alpha-10", "gene_name": "IFNA10", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01571-1", "protein_name": "Interferon alpha-17", "gene_name": "IFNA17", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01574-1", "protein_name": "Interferon beta", "gene_name": "IFNB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05015-1", "protein_name": "Interferon alpha-16", "gene_name": "IFNA16", "tax_name": "Human" }, { "uniprot_canonical_ac": "P28062-1", "protein_name": "Proteasome subunit beta type-8", "gene_name": "PSMB8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13325-1", "protein_name": "Interferon-induced protein with tetratricopeptide repeats 5", "gene_name": "IFIT5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P19525-1", "protein_name": "Interferon-induced, double-stranded RNA-activated protein kinase", "gene_name": "EIF2AK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG47-1", "protein_name": "Polyubiquitin-B", "gene_name": "UBB", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42224-1", "protein_name": "Signal transducer and activator of transcription 1-alpha/beta", "gene_name": "STAT1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P80217-1", "protein_name": "Interferon-induced 35 kDa protein", "gene_name": "IFI35", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62987-1", "protein_name": "Ubiquitin-ribosomal protein eL40 fusion protein", "gene_name": "UBA52", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01628-1", "protein_name": "Interferon-induced transmembrane protein 3", "gene_name": "IFITM3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y3Z3-1", "protein_name": "Deoxynucleoside triphosphate triphosphohydrolase SAMHD1", "gene_name": "SAMHD1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P32456-1", "protein_name": "Guanylate-binding protein 2", "gene_name": "GBP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q00978-1", "protein_name": "Interferon regulatory factor 9", "gene_name": "IRF9", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01893-1", "protein_name": "Putative HLA class I histocompatibility antigen, alpha chain H", "gene_name": "HLA-H", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05161-1", "protein_name": "Ubiquitin-like protein ISG15", "gene_name": "ISG15", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14974-1", "protein_name": "Importin subunit beta-1", "gene_name": "KPNB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P23458-1", "protein_name": "Tyrosine-protein kinase JAK1", "gene_name": "JAK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P17181-1", "protein_name": "Interferon alpha/beta receptor 1", "gene_name": "IFNAR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG48-1", "protein_name": "Polyubiquitin-C", "gene_name": "UBC", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01889-1", "protein_name": "HLA class I histocompatibility antigen, B alpha chain", "gene_name": "HLA-B", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P52294", "url": "https://www.uniprot.org/uniprotkb/P52294" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.7537377", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 74 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Transcription factors in interferon signaling.", "journal": "Pharmacology & therapeutics", "date": "1995", "authors": "David M", "reference": { "type": "PubMed", "id": "7540766", "url": "https://pubmed.ncbi.nlm.nih.gov/7540766" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P52294-1", "protein_name": "Importin subunit alpha-5", "gene_name": "KPNA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P18146-1", "protein_name": "Early growth response protein 1", "gene_name": "EGR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15646-1", "protein_name": "2'-5'-oligoadenylate synthase-like protein", "gene_name": "OASL", "tax_name": "Human" }, { "uniprot_canonical_ac": "P29728-1", "protein_name": "2'-5'-oligoadenylate synthase 2", "gene_name": "OAS2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15524-1", "protein_name": "Suppressor of cytokine signaling 1", "gene_name": "SOCS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y6K5-1", "protein_name": "2'-5'-oligoadenylate synthase 3", "gene_name": "OAS3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q02556-1", "protein_name": "Interferon regulatory factor 8", "gene_name": "IRF8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96AZ6-1", "protein_name": "Interferon-stimulated gene 20 kDa protein", "gene_name": "ISG20", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14896-1", "protein_name": "Interferon regulatory factor 6", "gene_name": "IRF6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P30511-1", "protein_name": "HLA class I histocompatibility antigen, alpha chain F", "gene_name": "HLA-F", "tax_name": "Human" }, { "uniprot_canonical_ac": "P13747-1", "protein_name": "HLA class I histocompatibility antigen, alpha chain E", "gene_name": "HLA-E", "tax_name": "Human" }, { "uniprot_canonical_ac": "P17693-1", "protein_name": "HLA class I histocompatibility antigen, alpha chain G", "gene_name": "HLA-G", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01563-1", "protein_name": "Interferon alpha-2", "gene_name": "IFNA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01567-1", "protein_name": "Interferon alpha-7", "gene_name": "IFNA7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01568-1", "protein_name": "Interferon alpha-21", "gene_name": "IFNA21", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01569-1", "protein_name": "Interferon alpha-5", "gene_name": "IFNA5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01570-1", "protein_name": "Interferon alpha-14", "gene_name": "IFNA14", "tax_name": "Human" }, { "uniprot_canonical_ac": "P09914-1", "protein_name": "Antiviral innate immune response effector IFIT1", "gene_name": "IFIT1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P32881-1", "protein_name": "Interferon alpha-8", "gene_name": "IFNA8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UHH9-1", "protein_name": "Inositol hexakisphosphate kinase 2", "gene_name": "IP6K2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05013-1", "protein_name": "Interferon alpha-6", "gene_name": "IFNA6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P09913-1", "protein_name": "Interferon-induced protein with tetratricopeptide repeats 2", "gene_name": "IFIT2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8WXG1-1", "protein_name": "S-adenosylmethionine-dependent nucleotide dehydratase RSAD2", "gene_name": "RSAD2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P20592-1", "protein_name": "Interferon-induced GTP-binding protein Mx2", "gene_name": "MX2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P14316-1", "protein_name": "Interferon regulatory factor 2", "gene_name": "IRF2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P29350-1", "protein_name": "Tyrosine-protein phosphatase non-receptor type 6", "gene_name": "PTPN6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14653-1", "protein_name": "Interferon regulatory factor 3", "gene_name": "IRF3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P20591-1", "protein_name": "Interferon-induced GTP-binding protein Mx1", "gene_name": "MX1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13568-1", "protein_name": "Interferon regulatory factor 5", "gene_name": "IRF5", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14879-1", "protein_name": "Interferon-induced protein with tetratricopeptide repeats 3", "gene_name": "IFIT3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q05823-1", "protein_name": "2-5A-dependent ribonuclease", "gene_name": "RNASEL", "tax_name": "Human" }, { "uniprot_canonical_ac": "P10914-1", "protein_name": "Interferon regulatory factor 1", "gene_name": "IRF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6GPH4-1", "protein_name": "XIAP-associated factor 1", "gene_name": "XAF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P52630-3", "protein_name": "Signal transducer and activator of transcription 2", "gene_name": "STAT2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P09912-1", "protein_name": "Interferon alpha-inducible protein 6", "gene_name": "IFI6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P10321-1", "protein_name": "HLA class I histocompatibility antigen, C alpha chain", "gene_name": "HLA-C", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04439-1", "protein_name": "HLA class I histocompatibility antigen, A alpha chain", "gene_name": "HLA-A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92985-1", "protein_name": "Interferon regulatory factor 7", "gene_name": "IRF7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61221-1", "protein_name": "ATP-binding cassette sub-family E member 1", "gene_name": "ABCE1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P00973-1", "protein_name": "2'-5'-oligoadenylate synthase 1", "gene_name": "OAS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05014-1", "protein_name": "Interferon alpha-4", "gene_name": "IFNA4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q06124-2", "protein_name": "Tyrosine-protein phosphatase non-receptor type 11", "gene_name": "PTPN11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P29597-1", "protein_name": "Non-receptor tyrosine-protein kinase TYK2", "gene_name": "TYK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14543-1", "protein_name": "Suppressor of cytokine signaling 3", "gene_name": "SOCS3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DY56-1", "protein_name": "Interferon alpha-1", "gene_name": "IFNA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62979-1", "protein_name": "Ubiquitin-ribosomal protein eS31 fusion protein", "gene_name": "RPS27A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q10589-1", "protein_name": "Bone marrow stromal antigen 2", "gene_name": "BST2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15306-1", "protein_name": "Interferon regulatory factor 4", "gene_name": "IRF4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P55265-1", "protein_name": "Double-stranded RNA-specific adenosine deaminase", "gene_name": "ADAR", "tax_name": "Human" }, { "uniprot_canonical_ac": "P13164-1", "protein_name": "Interferon-induced transmembrane protein 1", "gene_name": "IFITM1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P40305-2", "protein_name": "Interferon alpha-inducible protein 27, mitochondrial", "gene_name": "IFI27", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01629-1", "protein_name": "Interferon-induced transmembrane protein 2", "gene_name": "IFITM2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01566-1", "protein_name": "Interferon alpha-10", "gene_name": "IFNA10", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01571-1", "protein_name": "Interferon alpha-17", "gene_name": "IFNA17", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01574-1", "protein_name": "Interferon beta", "gene_name": "IFNB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05015-1", "protein_name": "Interferon alpha-16", "gene_name": "IFNA16", "tax_name": "Human" }, { "uniprot_canonical_ac": "P28062-1", "protein_name": "Proteasome subunit beta type-8", "gene_name": "PSMB8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13325-1", "protein_name": "Interferon-induced protein with tetratricopeptide repeats 5", "gene_name": "IFIT5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P19525-1", "protein_name": "Interferon-induced, double-stranded RNA-activated protein kinase", "gene_name": "EIF2AK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG47-1", "protein_name": "Polyubiquitin-B", "gene_name": "UBB", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42224-1", "protein_name": "Signal transducer and activator of transcription 1-alpha/beta", "gene_name": "STAT1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P80217-1", "protein_name": "Interferon-induced 35 kDa protein", "gene_name": "IFI35", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62987-1", "protein_name": "Ubiquitin-ribosomal protein eL40 fusion protein", "gene_name": "UBA52", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01628-1", "protein_name": "Interferon-induced transmembrane protein 3", "gene_name": "IFITM3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y3Z3-1", "protein_name": "Deoxynucleoside triphosphate triphosphohydrolase SAMHD1", "gene_name": "SAMHD1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P32456-1", "protein_name": "Guanylate-binding protein 2", "gene_name": "GBP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q00978-1", "protein_name": "Interferon regulatory factor 9", "gene_name": "IRF9", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01893-1", "protein_name": "Putative HLA class I histocompatibility antigen, alpha chain H", "gene_name": "HLA-H", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05161-1", "protein_name": "Ubiquitin-like protein ISG15", "gene_name": "ISG15", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14974-1", "protein_name": "Importin subunit beta-1", "gene_name": "KPNB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P23458-1", "protein_name": "Tyrosine-protein kinase JAK1", "gene_name": "JAK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P17181-1", "protein_name": "Interferon alpha/beta receptor 1", "gene_name": "IFNAR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG48-1", "protein_name": "Polyubiquitin-C", "gene_name": "UBC", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01889-1", "protein_name": "HLA class I histocompatibility antigen, B alpha chain", "gene_name": "HLA-B", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P52294", "url": "https://www.uniprot.org/uniprotkb/P52294" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.7540766", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 74 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Mammalian karyopherin alpha 1 beta and alpha 2 beta heterodimers: alpha 1 or alpha 2 subunit binds nuclear localization signal and beta subunit interacts with peptide repeat-containing nucleoporins.", "journal": "Proc. Natl. Acad. Sci. U.S.A.", "date": "1995", "authors": "Moroianu J, Hijikata M, Blobel G, Radu A", "reference": { "type": "PubMed", "id": "7604027", "url": "https://pubmed.ncbi.nlm.nih.gov/7604027" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P52294-1", "protein_name": "Importin subunit alpha-5", "gene_name": "KPNA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P52292-1", "protein_name": "Importin subunit alpha-1", "gene_name": "KPNA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P52296-1", "protein_name": "Importin subunit beta-1", "gene_name": "Kpnb1", "tax_name": "Rat" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P52294", "url": "https://www.uniprot.org/uniprotkb/P52294" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.7604027", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "NPI-1, the human homolog of SRP-1, interacts with influenza virus nucleoprotein.", "journal": "Virology", "date": "1995", "authors": "O'Neill R E, Palese P", "reference": { "type": "PubMed", "id": "7831767", "url": "https://pubmed.ncbi.nlm.nih.gov/7831767" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P52294-1", "protein_name": "Importin subunit alpha-5", "gene_name": "KPNA1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P52294", "url": "https://www.uniprot.org/uniprotkb/P52294" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.7831767", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Previously identified protein of uncertain function is karyopherin alpha and together with karyopherin beta docks import substrate at nuclear pore complexes.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1995-03-14", "authors": "Moroianu J, Blobel G, Radu A", "reference": { "type": "PubMed", "id": "7892216", "url": "https://pubmed.ncbi.nlm.nih.gov/7892216" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P52294-1", "protein_name": "Importin subunit alpha-5", "gene_name": "KPNA1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P52294", "url": "https://www.uniprot.org/uniprotkb/P52294" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.7892216", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "RAG-1 interacts with the repeated amino acid motif of the human homologue of the yeast protein SRP1.", "journal": "Proc. Natl. Acad. Sci. U.S.A.", "date": "1994", "authors": "Cortes P, Ye Z S, Baltimore D", "reference": { "type": "PubMed", "id": "8052633", "url": "https://pubmed.ncbi.nlm.nih.gov/8052633" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P52294-1", "protein_name": "Importin subunit alpha-5", "gene_name": "KPNA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q60960-1", "protein_name": "Importin subunit alpha-5", "gene_name": "Kpna1", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "P15918-1", "protein_name": "V(D)J recombination-activating protein 1", "gene_name": "RAG1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P52294", "url": "https://www.uniprot.org/uniprotkb/P52294" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.8052633", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Transcription factor ISGF-3 formation requires phosphorylated Stat91 protein, but Stat113 protein is phosphorylated independently of Stat91 protein.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1994", "authors": "Improta T, Schindler C, Horvath CM, Kerr IM, Stark GR, Darnell JE Jr", "reference": { "type": "PubMed", "id": "8197134", "url": "https://pubmed.ncbi.nlm.nih.gov/8197134" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P52294-1", "protein_name": "Importin subunit alpha-5", "gene_name": "KPNA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P18146-1", "protein_name": "Early growth response protein 1", "gene_name": "EGR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15646-1", "protein_name": "2'-5'-oligoadenylate synthase-like protein", "gene_name": "OASL", "tax_name": "Human" }, { "uniprot_canonical_ac": "P29728-1", "protein_name": "2'-5'-oligoadenylate synthase 2", "gene_name": "OAS2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15524-1", "protein_name": "Suppressor of cytokine signaling 1", "gene_name": "SOCS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y6K5-1", "protein_name": "2'-5'-oligoadenylate synthase 3", "gene_name": "OAS3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q02556-1", "protein_name": "Interferon regulatory factor 8", "gene_name": "IRF8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96AZ6-1", "protein_name": "Interferon-stimulated gene 20 kDa protein", "gene_name": "ISG20", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14896-1", "protein_name": "Interferon regulatory factor 6", "gene_name": "IRF6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P30511-1", "protein_name": "HLA class I histocompatibility antigen, alpha chain F", "gene_name": "HLA-F", "tax_name": "Human" }, { "uniprot_canonical_ac": "P13747-1", "protein_name": "HLA class I histocompatibility antigen, alpha chain E", "gene_name": "HLA-E", "tax_name": "Human" }, { "uniprot_canonical_ac": "P17693-1", "protein_name": "HLA class I histocompatibility antigen, alpha chain G", "gene_name": "HLA-G", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01563-1", "protein_name": "Interferon alpha-2", "gene_name": "IFNA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01567-1", "protein_name": "Interferon alpha-7", "gene_name": "IFNA7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01568-1", "protein_name": "Interferon alpha-21", "gene_name": "IFNA21", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01569-1", "protein_name": "Interferon alpha-5", "gene_name": "IFNA5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01570-1", "protein_name": "Interferon alpha-14", "gene_name": "IFNA14", "tax_name": "Human" }, { "uniprot_canonical_ac": "P09914-1", "protein_name": "Antiviral innate immune response effector IFIT1", "gene_name": "IFIT1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P32881-1", "protein_name": "Interferon alpha-8", "gene_name": "IFNA8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UHH9-1", "protein_name": "Inositol hexakisphosphate kinase 2", "gene_name": "IP6K2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05013-1", "protein_name": "Interferon alpha-6", "gene_name": "IFNA6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P09913-1", "protein_name": "Interferon-induced protein with tetratricopeptide repeats 2", "gene_name": "IFIT2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8WXG1-1", "protein_name": "S-adenosylmethionine-dependent nucleotide dehydratase RSAD2", "gene_name": "RSAD2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P20592-1", "protein_name": "Interferon-induced GTP-binding protein Mx2", "gene_name": "MX2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P14316-1", "protein_name": "Interferon regulatory factor 2", "gene_name": "IRF2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P29350-1", "protein_name": "Tyrosine-protein phosphatase non-receptor type 6", "gene_name": "PTPN6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14653-1", "protein_name": "Interferon regulatory factor 3", "gene_name": "IRF3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P20591-1", "protein_name": "Interferon-induced GTP-binding protein Mx1", "gene_name": "MX1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13568-1", "protein_name": "Interferon regulatory factor 5", "gene_name": "IRF5", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14879-1", "protein_name": "Interferon-induced protein with tetratricopeptide repeats 3", "gene_name": "IFIT3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q05823-1", "protein_name": "2-5A-dependent ribonuclease", "gene_name": "RNASEL", "tax_name": "Human" }, { "uniprot_canonical_ac": "P10914-1", "protein_name": "Interferon regulatory factor 1", "gene_name": "IRF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6GPH4-1", "protein_name": "XIAP-associated factor 1", "gene_name": "XAF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P52630-3", "protein_name": "Signal transducer and activator of transcription 2", "gene_name": "STAT2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P09912-1", "protein_name": "Interferon alpha-inducible protein 6", "gene_name": "IFI6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P10321-1", "protein_name": "HLA class I histocompatibility antigen, C alpha chain", "gene_name": "HLA-C", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04439-1", "protein_name": "HLA class I histocompatibility antigen, A alpha chain", "gene_name": "HLA-A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92985-1", "protein_name": "Interferon regulatory factor 7", "gene_name": "IRF7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61221-1", "protein_name": "ATP-binding cassette sub-family E member 1", "gene_name": "ABCE1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P00973-1", "protein_name": "2'-5'-oligoadenylate synthase 1", "gene_name": "OAS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05014-1", "protein_name": "Interferon alpha-4", "gene_name": "IFNA4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q06124-2", "protein_name": "Tyrosine-protein phosphatase non-receptor type 11", "gene_name": "PTPN11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P29597-1", "protein_name": "Non-receptor tyrosine-protein kinase TYK2", "gene_name": "TYK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14543-1", "protein_name": "Suppressor of cytokine signaling 3", "gene_name": "SOCS3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DY56-1", "protein_name": "Interferon alpha-1", "gene_name": "IFNA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62979-1", "protein_name": "Ubiquitin-ribosomal protein eS31 fusion protein", "gene_name": "RPS27A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q10589-1", "protein_name": "Bone marrow stromal antigen 2", "gene_name": "BST2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15306-1", "protein_name": "Interferon regulatory factor 4", "gene_name": "IRF4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P55265-1", "protein_name": "Double-stranded RNA-specific adenosine deaminase", "gene_name": "ADAR", "tax_name": "Human" }, { "uniprot_canonical_ac": "P13164-1", "protein_name": "Interferon-induced transmembrane protein 1", "gene_name": "IFITM1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P40305-2", "protein_name": "Interferon alpha-inducible protein 27, mitochondrial", "gene_name": "IFI27", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01629-1", "protein_name": "Interferon-induced transmembrane protein 2", "gene_name": "IFITM2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01566-1", "protein_name": "Interferon alpha-10", "gene_name": "IFNA10", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01571-1", "protein_name": "Interferon alpha-17", "gene_name": "IFNA17", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01574-1", "protein_name": "Interferon beta", "gene_name": "IFNB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05015-1", "protein_name": "Interferon alpha-16", "gene_name": "IFNA16", "tax_name": "Human" }, { "uniprot_canonical_ac": "P28062-1", "protein_name": "Proteasome subunit beta type-8", "gene_name": "PSMB8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13325-1", "protein_name": "Interferon-induced protein with tetratricopeptide repeats 5", "gene_name": "IFIT5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P19525-1", "protein_name": "Interferon-induced, double-stranded RNA-activated protein kinase", "gene_name": "EIF2AK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG47-1", "protein_name": "Polyubiquitin-B", "gene_name": "UBB", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42224-1", "protein_name": "Signal transducer and activator of transcription 1-alpha/beta", "gene_name": "STAT1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P80217-1", "protein_name": "Interferon-induced 35 kDa protein", "gene_name": "IFI35", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62987-1", "protein_name": "Ubiquitin-ribosomal protein eL40 fusion protein", "gene_name": "UBA52", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01628-1", "protein_name": "Interferon-induced transmembrane protein 3", "gene_name": "IFITM3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y3Z3-1", "protein_name": "Deoxynucleoside triphosphate triphosphohydrolase SAMHD1", "gene_name": "SAMHD1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P32456-1", "protein_name": "Guanylate-binding protein 2", "gene_name": "GBP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q00978-1", "protein_name": "Interferon regulatory factor 9", "gene_name": "IRF9", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01893-1", "protein_name": "Putative HLA class I histocompatibility antigen, alpha chain H", "gene_name": "HLA-H", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05161-1", "protein_name": "Ubiquitin-like protein ISG15", "gene_name": "ISG15", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14974-1", "protein_name": "Importin subunit beta-1", "gene_name": "KPNB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P23458-1", "protein_name": "Tyrosine-protein kinase JAK1", "gene_name": "JAK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P17181-1", "protein_name": "Interferon alpha/beta receptor 1", "gene_name": "IFNAR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG48-1", "protein_name": "Polyubiquitin-C", "gene_name": "UBC", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01889-1", "protein_name": "HLA class I histocompatibility antigen, B alpha chain", "gene_name": "HLA-B", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P52294", "url": "https://www.uniprot.org/uniprotkb/P52294" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 690, "end_pos": 690, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "Phosphotyrosine; by JAK", "evidence": [ { "database": "UniProtKB", "id": "P52630", "url": "https://www.uniprot.org/uniprotkb/P52630" }, { "database": "IntAct", "id": "P52630", "url": "https://www.ebi.ac.uk/intact/interactors/id:P52630*" }, { "database": "iPTMnet", "id": "P52630", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P52630" }, { "database": "PubMed", "id": "8605877", "url": "https://pubmed.ncbi.nlm.nih.gov/8605877" }, { "database": "PRO", "id": "P52630", "url": "https://proconsortium.org/cgi-bin/entry_pro?id=P52630" }, { "database": "PubMed", "id": "16324217", "url": "https://pubmed.ncbi.nlm.nih.gov/16324217" }, { "database": "PubMed", "id": "22306001", "url": "https://pubmed.ncbi.nlm.nih.gov/22306001" }, { "database": "PubMed", "id": "22704065", "url": "https://pubmed.ncbi.nlm.nih.gov/22704065" }, { "database": "PubMed", "id": "25564224", "url": "https://pubmed.ncbi.nlm.nih.gov/25564224" }, { "database": "PubMed", "id": "26342467", "url": "https://pubmed.ncbi.nlm.nih.gov/26342467" }, { "database": "PubMed", "id": "29317535", "url": "https://pubmed.ncbi.nlm.nih.gov/29317535" }, { "database": "PubMed", "id": "29581268", "url": "https://pubmed.ncbi.nlm.nih.gov/29581268" }, { "database": "PubMed", "id": "32196427", "url": "https://pubmed.ncbi.nlm.nih.gov/32196427" }, { "database": "PubMed", "id": "32696599", "url": "https://pubmed.ncbi.nlm.nih.gov/32696599" }, { "database": "PubMed", "id": "32778820", "url": "https://pubmed.ncbi.nlm.nih.gov/32778820" }, { "database": "PubMed", "id": "36148221", "url": "https://pubmed.ncbi.nlm.nih.gov/36148221" }, { "database": "PubMed", "id": "8197134", "url": "https://pubmed.ncbi.nlm.nih.gov/8197134" }, { "database": "PubMed", "id": "9121453", "url": "https://pubmed.ncbi.nlm.nih.gov/9121453" }, { "database": "PubMed", "id": "7532278", "url": "https://pubmed.ncbi.nlm.nih.gov/7532278" } ], "site_lbl": "Tyr690", "uniprot_canonical_ac": "P52630-3" } ], "record_id": "pubmed.8197134", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 74 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The protein tyrosine kinase JAK1 complements defects in interferon-alpha/beta and -gamma signal transduction.", "journal": "Nature", "date": "1993", "authors": "Muller M, Briscoe J, Laxton C, Guschin D, Ziemiecki A, Silvennoinen O, Harpur AG, Barbieri G, Witthuhn BA, Schindler C, et al.", "reference": { "type": "PubMed", "id": "8232552", "url": "https://pubmed.ncbi.nlm.nih.gov/8232552" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P52294-1", "protein_name": "Importin subunit alpha-5", "gene_name": "KPNA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P18146-1", "protein_name": "Early growth response protein 1", "gene_name": "EGR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15646-1", "protein_name": "2'-5'-oligoadenylate synthase-like protein", "gene_name": "OASL", "tax_name": "Human" }, { "uniprot_canonical_ac": "P29728-1", "protein_name": "2'-5'-oligoadenylate synthase 2", "gene_name": "OAS2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15524-1", "protein_name": "Suppressor of cytokine signaling 1", "gene_name": "SOCS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y6K5-1", "protein_name": "2'-5'-oligoadenylate synthase 3", "gene_name": "OAS3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q02556-1", "protein_name": "Interferon regulatory factor 8", "gene_name": "IRF8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96AZ6-1", "protein_name": "Interferon-stimulated gene 20 kDa protein", "gene_name": "ISG20", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14896-1", "protein_name": "Interferon regulatory factor 6", "gene_name": "IRF6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P30511-1", "protein_name": "HLA class I histocompatibility antigen, alpha chain F", "gene_name": "HLA-F", "tax_name": "Human" }, { "uniprot_canonical_ac": "P13747-1", "protein_name": "HLA class I histocompatibility antigen, alpha chain E", "gene_name": "HLA-E", "tax_name": "Human" }, { "uniprot_canonical_ac": "P17693-1", "protein_name": "HLA class I histocompatibility antigen, alpha chain G", "gene_name": "HLA-G", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01563-1", "protein_name": "Interferon alpha-2", "gene_name": "IFNA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01567-1", "protein_name": "Interferon alpha-7", "gene_name": "IFNA7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01568-1", "protein_name": "Interferon alpha-21", "gene_name": "IFNA21", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01569-1", "protein_name": "Interferon alpha-5", "gene_name": "IFNA5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01570-1", "protein_name": "Interferon alpha-14", "gene_name": "IFNA14", "tax_name": "Human" }, { "uniprot_canonical_ac": "P09914-1", "protein_name": "Antiviral innate immune response effector IFIT1", "gene_name": "IFIT1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P32881-1", "protein_name": "Interferon alpha-8", "gene_name": "IFNA8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UHH9-1", "protein_name": "Inositol hexakisphosphate kinase 2", "gene_name": "IP6K2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05013-1", "protein_name": "Interferon alpha-6", "gene_name": "IFNA6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P09913-1", "protein_name": "Interferon-induced protein with tetratricopeptide repeats 2", "gene_name": "IFIT2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8WXG1-1", "protein_name": "S-adenosylmethionine-dependent nucleotide dehydratase RSAD2", "gene_name": "RSAD2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P20592-1", "protein_name": "Interferon-induced GTP-binding protein Mx2", "gene_name": "MX2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P14316-1", "protein_name": "Interferon regulatory factor 2", "gene_name": "IRF2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P29350-1", "protein_name": "Tyrosine-protein phosphatase non-receptor type 6", "gene_name": "PTPN6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14653-1", "protein_name": "Interferon regulatory factor 3", "gene_name": "IRF3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P20591-1", "protein_name": "Interferon-induced GTP-binding protein Mx1", "gene_name": "MX1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13568-1", "protein_name": "Interferon regulatory factor 5", "gene_name": "IRF5", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14879-1", "protein_name": "Interferon-induced protein with tetratricopeptide repeats 3", "gene_name": "IFIT3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q05823-1", "protein_name": "2-5A-dependent ribonuclease", "gene_name": "RNASEL", "tax_name": "Human" }, { "uniprot_canonical_ac": "P10914-1", "protein_name": "Interferon regulatory factor 1", "gene_name": "IRF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6GPH4-1", "protein_name": "XIAP-associated factor 1", "gene_name": "XAF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P52630-3", "protein_name": "Signal transducer and activator of transcription 2", "gene_name": "STAT2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P09912-1", "protein_name": "Interferon alpha-inducible protein 6", "gene_name": "IFI6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P10321-1", "protein_name": "HLA class I histocompatibility antigen, C alpha chain", "gene_name": "HLA-C", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04439-1", "protein_name": "HLA class I histocompatibility antigen, A alpha chain", "gene_name": "HLA-A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92985-1", "protein_name": "Interferon regulatory factor 7", "gene_name": "IRF7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61221-1", "protein_name": "ATP-binding cassette sub-family E member 1", "gene_name": "ABCE1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P00973-1", "protein_name": "2'-5'-oligoadenylate synthase 1", "gene_name": "OAS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05014-1", "protein_name": "Interferon alpha-4", "gene_name": "IFNA4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q06124-2", "protein_name": "Tyrosine-protein phosphatase non-receptor type 11", "gene_name": "PTPN11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P29597-1", "protein_name": "Non-receptor tyrosine-protein kinase TYK2", "gene_name": "TYK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14543-1", "protein_name": "Suppressor of cytokine signaling 3", "gene_name": "SOCS3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DY56-1", "protein_name": "Interferon alpha-1", "gene_name": "IFNA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62979-1", "protein_name": "Ubiquitin-ribosomal protein eS31 fusion protein", "gene_name": "RPS27A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q10589-1", "protein_name": "Bone marrow stromal antigen 2", "gene_name": "BST2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15306-1", "protein_name": "Interferon regulatory factor 4", "gene_name": "IRF4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P55265-1", "protein_name": "Double-stranded RNA-specific adenosine deaminase", "gene_name": "ADAR", "tax_name": "Human" }, { "uniprot_canonical_ac": "P13164-1", "protein_name": "Interferon-induced transmembrane protein 1", "gene_name": "IFITM1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P40305-2", "protein_name": "Interferon alpha-inducible protein 27, mitochondrial", "gene_name": "IFI27", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01629-1", "protein_name": "Interferon-induced transmembrane protein 2", "gene_name": "IFITM2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01566-1", "protein_name": "Interferon alpha-10", "gene_name": "IFNA10", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01571-1", "protein_name": "Interferon alpha-17", "gene_name": "IFNA17", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01574-1", "protein_name": "Interferon beta", "gene_name": "IFNB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05015-1", "protein_name": "Interferon alpha-16", "gene_name": "IFNA16", "tax_name": "Human" }, { "uniprot_canonical_ac": "P28062-1", "protein_name": "Proteasome subunit beta type-8", "gene_name": "PSMB8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13325-1", "protein_name": "Interferon-induced protein with tetratricopeptide repeats 5", "gene_name": "IFIT5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P19525-1", "protein_name": "Interferon-induced, double-stranded RNA-activated protein kinase", "gene_name": "EIF2AK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG47-1", "protein_name": "Polyubiquitin-B", "gene_name": "UBB", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42224-1", "protein_name": "Signal transducer and activator of transcription 1-alpha/beta", "gene_name": "STAT1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P80217-1", "protein_name": "Interferon-induced 35 kDa protein", "gene_name": "IFI35", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62987-1", "protein_name": "Ubiquitin-ribosomal protein eL40 fusion protein", "gene_name": "UBA52", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01628-1", "protein_name": "Interferon-induced transmembrane protein 3", "gene_name": "IFITM3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y3Z3-1", "protein_name": "Deoxynucleoside triphosphate triphosphohydrolase SAMHD1", "gene_name": "SAMHD1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P32456-1", "protein_name": "Guanylate-binding protein 2", "gene_name": "GBP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q00978-1", "protein_name": "Interferon regulatory factor 9", "gene_name": "IRF9", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01893-1", "protein_name": "Putative HLA class I histocompatibility antigen, alpha chain H", "gene_name": "HLA-H", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05161-1", "protein_name": "Ubiquitin-like protein ISG15", "gene_name": "ISG15", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14974-1", "protein_name": "Importin subunit beta-1", "gene_name": "KPNB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P23458-1", "protein_name": "Tyrosine-protein kinase JAK1", "gene_name": "JAK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P17181-1", "protein_name": "Interferon alpha/beta receptor 1", "gene_name": "IFNAR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG48-1", "protein_name": "Polyubiquitin-C", "gene_name": "UBC", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01889-1", "protein_name": "HLA class I histocompatibility antigen, B alpha chain", "gene_name": "HLA-B", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P52294", "url": "https://www.uniprot.org/uniprotkb/P52294" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.8232552", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 74 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Phosphorylated interferon-alpha receptor 1 subunit (IFNaR1) acts as a docking site for the latent form of the 113 kDa STAT2 protein.", "journal": "The EMBO journal", "date": "1996", "authors": "Yan H, Krishnan K, Greenlund AC, Gupta S, Lim JT, Schreiber RD, Schindler CW, Krolewski JJ", "reference": { "type": "PubMed", "id": "8605876", "url": "https://pubmed.ncbi.nlm.nih.gov/8605876" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P52294-1", "protein_name": "Importin subunit alpha-5", "gene_name": "KPNA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P18146-1", "protein_name": "Early growth response protein 1", "gene_name": "EGR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15646-1", "protein_name": "2'-5'-oligoadenylate synthase-like protein", "gene_name": "OASL", "tax_name": "Human" }, { "uniprot_canonical_ac": "P29728-1", "protein_name": "2'-5'-oligoadenylate synthase 2", "gene_name": "OAS2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15524-1", "protein_name": "Suppressor of cytokine signaling 1", "gene_name": "SOCS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y6K5-1", "protein_name": "2'-5'-oligoadenylate synthase 3", "gene_name": "OAS3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q02556-1", "protein_name": "Interferon regulatory factor 8", "gene_name": "IRF8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96AZ6-1", "protein_name": "Interferon-stimulated gene 20 kDa protein", "gene_name": "ISG20", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14896-1", "protein_name": "Interferon regulatory factor 6", "gene_name": "IRF6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P30511-1", "protein_name": "HLA class I histocompatibility antigen, alpha chain F", "gene_name": "HLA-F", "tax_name": "Human" }, { "uniprot_canonical_ac": "P13747-1", "protein_name": "HLA class I histocompatibility antigen, alpha chain E", "gene_name": "HLA-E", "tax_name": "Human" }, { "uniprot_canonical_ac": "P17693-1", "protein_name": "HLA class I histocompatibility antigen, alpha chain G", "gene_name": "HLA-G", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01563-1", "protein_name": "Interferon alpha-2", "gene_name": "IFNA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01567-1", "protein_name": "Interferon alpha-7", "gene_name": "IFNA7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01568-1", "protein_name": "Interferon alpha-21", "gene_name": "IFNA21", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01569-1", "protein_name": "Interferon alpha-5", "gene_name": "IFNA5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01570-1", "protein_name": "Interferon alpha-14", "gene_name": "IFNA14", "tax_name": "Human" }, { "uniprot_canonical_ac": "P09914-1", "protein_name": "Antiviral innate immune response effector IFIT1", "gene_name": "IFIT1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P32881-1", "protein_name": "Interferon alpha-8", "gene_name": "IFNA8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UHH9-1", "protein_name": "Inositol hexakisphosphate kinase 2", "gene_name": "IP6K2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05013-1", "protein_name": "Interferon alpha-6", "gene_name": "IFNA6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P09913-1", "protein_name": "Interferon-induced protein with tetratricopeptide repeats 2", "gene_name": "IFIT2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8WXG1-1", "protein_name": "S-adenosylmethionine-dependent nucleotide dehydratase RSAD2", "gene_name": "RSAD2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P20592-1", "protein_name": "Interferon-induced GTP-binding protein Mx2", "gene_name": "MX2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P14316-1", "protein_name": "Interferon regulatory factor 2", "gene_name": "IRF2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P29350-1", "protein_name": "Tyrosine-protein phosphatase non-receptor type 6", "gene_name": "PTPN6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14653-1", "protein_name": "Interferon regulatory factor 3", "gene_name": "IRF3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P20591-1", "protein_name": "Interferon-induced GTP-binding protein Mx1", "gene_name": "MX1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13568-1", "protein_name": "Interferon regulatory factor 5", "gene_name": "IRF5", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14879-1", "protein_name": "Interferon-induced protein with tetratricopeptide repeats 3", "gene_name": "IFIT3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q05823-1", "protein_name": "2-5A-dependent ribonuclease", "gene_name": "RNASEL", "tax_name": "Human" }, { "uniprot_canonical_ac": "P10914-1", "protein_name": "Interferon regulatory factor 1", "gene_name": "IRF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6GPH4-1", "protein_name": "XIAP-associated factor 1", "gene_name": "XAF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P52630-3", "protein_name": "Signal transducer and activator of transcription 2", "gene_name": "STAT2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P09912-1", "protein_name": "Interferon alpha-inducible protein 6", "gene_name": "IFI6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P10321-1", "protein_name": "HLA class I histocompatibility antigen, C alpha chain", "gene_name": "HLA-C", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04439-1", "protein_name": "HLA class I histocompatibility antigen, A alpha chain", "gene_name": "HLA-A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92985-1", "protein_name": "Interferon regulatory factor 7", "gene_name": "IRF7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61221-1", "protein_name": "ATP-binding cassette sub-family E member 1", "gene_name": "ABCE1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P00973-1", "protein_name": "2'-5'-oligoadenylate synthase 1", "gene_name": "OAS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05014-1", "protein_name": "Interferon alpha-4", "gene_name": "IFNA4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q06124-2", "protein_name": "Tyrosine-protein phosphatase non-receptor type 11", "gene_name": "PTPN11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P29597-1", "protein_name": "Non-receptor tyrosine-protein kinase TYK2", "gene_name": "TYK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14543-1", "protein_name": "Suppressor of cytokine signaling 3", "gene_name": "SOCS3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DY56-1", "protein_name": "Interferon alpha-1", "gene_name": "IFNA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62979-1", "protein_name": "Ubiquitin-ribosomal protein eS31 fusion protein", "gene_name": "RPS27A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q10589-1", "protein_name": "Bone marrow stromal antigen 2", "gene_name": "BST2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15306-1", "protein_name": "Interferon regulatory factor 4", "gene_name": "IRF4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P55265-1", "protein_name": "Double-stranded RNA-specific adenosine deaminase", "gene_name": "ADAR", "tax_name": "Human" }, { "uniprot_canonical_ac": "P13164-1", "protein_name": "Interferon-induced transmembrane protein 1", "gene_name": "IFITM1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P40305-2", "protein_name": "Interferon alpha-inducible protein 27, mitochondrial", "gene_name": "IFI27", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01629-1", "protein_name": "Interferon-induced transmembrane protein 2", "gene_name": "IFITM2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01566-1", "protein_name": "Interferon alpha-10", "gene_name": "IFNA10", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01571-1", "protein_name": "Interferon alpha-17", "gene_name": "IFNA17", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01574-1", "protein_name": "Interferon beta", "gene_name": "IFNB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05015-1", "protein_name": "Interferon alpha-16", "gene_name": "IFNA16", "tax_name": "Human" }, { "uniprot_canonical_ac": "P28062-1", "protein_name": "Proteasome subunit beta type-8", "gene_name": "PSMB8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13325-1", "protein_name": "Interferon-induced protein with tetratricopeptide repeats 5", "gene_name": "IFIT5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P19525-1", "protein_name": "Interferon-induced, double-stranded RNA-activated protein kinase", "gene_name": "EIF2AK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG47-1", "protein_name": "Polyubiquitin-B", "gene_name": "UBB", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42224-1", "protein_name": "Signal transducer and activator of transcription 1-alpha/beta", "gene_name": "STAT1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P80217-1", "protein_name": "Interferon-induced 35 kDa protein", "gene_name": "IFI35", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62987-1", "protein_name": "Ubiquitin-ribosomal protein eL40 fusion protein", "gene_name": "UBA52", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01628-1", "protein_name": "Interferon-induced transmembrane protein 3", "gene_name": "IFITM3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y3Z3-1", "protein_name": "Deoxynucleoside triphosphate triphosphohydrolase SAMHD1", "gene_name": "SAMHD1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P32456-1", "protein_name": "Guanylate-binding protein 2", "gene_name": "GBP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q00978-1", "protein_name": "Interferon regulatory factor 9", "gene_name": "IRF9", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01893-1", "protein_name": "Putative HLA class I histocompatibility antigen, alpha chain H", "gene_name": "HLA-H", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05161-1", "protein_name": "Ubiquitin-like protein ISG15", "gene_name": "ISG15", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14974-1", "protein_name": "Importin subunit beta-1", "gene_name": "KPNB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P23458-1", "protein_name": "Tyrosine-protein kinase JAK1", "gene_name": "JAK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P17181-1", "protein_name": "Interferon alpha/beta receptor 1", "gene_name": "IFNAR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG48-1", "protein_name": "Polyubiquitin-C", "gene_name": "UBC", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01889-1", "protein_name": "HLA class I histocompatibility antigen, B alpha chain", "gene_name": "HLA-B", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P52294", "url": "https://www.uniprot.org/uniprotkb/P52294" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 466, "end_pos": 466, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "Phosphotyrosine; by TYK2", "evidence": [ { "database": "UniProtKB", "id": "P17181", "url": "https://www.uniprot.org/uniprotkb/P17181" }, { "database": "IntAct", "id": "P17181", "url": "https://www.ebi.ac.uk/intact/interactors/id:P17181*" }, { "database": "iPTMnet", "id": "P17181", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P17181" }, { "database": "PubMed", "id": "12220192", "url": "https://pubmed.ncbi.nlm.nih.gov/12220192" }, { "database": "PubMed", "id": "9121453", "url": "https://pubmed.ncbi.nlm.nih.gov/9121453" }, { "database": "PubMed", "id": "8605876", "url": "https://pubmed.ncbi.nlm.nih.gov/8605876" }, { "database": "PubMed", "id": "9677371", "url": "https://pubmed.ncbi.nlm.nih.gov/9677371" }, { "database": "PRO", "id": "P17181", "url": "https://proconsortium.org/cgi-bin/entry_pro?id=P17181" }, { "database": "PubMed", "id": "11786546", "url": "https://pubmed.ncbi.nlm.nih.gov/11786546" }, { "database": "PubMed", "id": "7526154", "url": "https://pubmed.ncbi.nlm.nih.gov/7526154" } ], "site_lbl": "Tyr466", "uniprot_canonical_ac": "P17181-1" } ], "record_id": "pubmed.8605876", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 74 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Formation of STAT1-STAT2 heterodimers and their role in the activation of IRF-1 gene transcription by interferon-alpha.", "journal": "The Journal of biological chemistry", "date": "1996", "authors": "Li X, Leung S, Qureshi S, Darnell JE Jr, Stark GR", "reference": { "type": "PubMed", "id": "8621447", "url": "https://pubmed.ncbi.nlm.nih.gov/8621447" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P52294-1", "protein_name": "Importin subunit alpha-5", "gene_name": "KPNA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P18146-1", "protein_name": "Early growth response protein 1", "gene_name": "EGR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15646-1", "protein_name": "2'-5'-oligoadenylate synthase-like protein", "gene_name": "OASL", "tax_name": "Human" }, { "uniprot_canonical_ac": "P29728-1", "protein_name": "2'-5'-oligoadenylate synthase 2", "gene_name": "OAS2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15524-1", "protein_name": "Suppressor of cytokine signaling 1", "gene_name": "SOCS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y6K5-1", "protein_name": "2'-5'-oligoadenylate synthase 3", "gene_name": "OAS3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q02556-1", "protein_name": "Interferon regulatory factor 8", "gene_name": "IRF8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96AZ6-1", "protein_name": "Interferon-stimulated gene 20 kDa protein", "gene_name": "ISG20", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14896-1", "protein_name": "Interferon regulatory factor 6", "gene_name": "IRF6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P30511-1", "protein_name": "HLA class I histocompatibility antigen, alpha chain F", "gene_name": "HLA-F", "tax_name": "Human" }, { "uniprot_canonical_ac": "P13747-1", "protein_name": "HLA class I histocompatibility antigen, alpha chain E", "gene_name": "HLA-E", "tax_name": "Human" }, { "uniprot_canonical_ac": "P17693-1", "protein_name": "HLA class I histocompatibility antigen, alpha chain G", "gene_name": "HLA-G", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01563-1", "protein_name": "Interferon alpha-2", "gene_name": "IFNA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01567-1", "protein_name": "Interferon alpha-7", "gene_name": "IFNA7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01568-1", "protein_name": "Interferon alpha-21", "gene_name": "IFNA21", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01569-1", "protein_name": "Interferon alpha-5", "gene_name": "IFNA5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01570-1", "protein_name": "Interferon alpha-14", "gene_name": "IFNA14", "tax_name": "Human" }, { "uniprot_canonical_ac": "P09914-1", "protein_name": "Antiviral innate immune response effector IFIT1", "gene_name": "IFIT1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P32881-1", "protein_name": "Interferon alpha-8", "gene_name": "IFNA8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UHH9-1", "protein_name": "Inositol hexakisphosphate kinase 2", "gene_name": "IP6K2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05013-1", "protein_name": "Interferon alpha-6", "gene_name": "IFNA6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P09913-1", "protein_name": "Interferon-induced protein with tetratricopeptide repeats 2", "gene_name": "IFIT2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8WXG1-1", "protein_name": "S-adenosylmethionine-dependent nucleotide dehydratase RSAD2", "gene_name": "RSAD2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P20592-1", "protein_name": "Interferon-induced GTP-binding protein Mx2", "gene_name": "MX2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P14316-1", "protein_name": "Interferon regulatory factor 2", "gene_name": "IRF2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P29350-1", "protein_name": "Tyrosine-protein phosphatase non-receptor type 6", "gene_name": "PTPN6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14653-1", "protein_name": "Interferon regulatory factor 3", "gene_name": "IRF3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P20591-1", "protein_name": "Interferon-induced GTP-binding protein Mx1", "gene_name": "MX1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13568-1", "protein_name": "Interferon regulatory factor 5", "gene_name": "IRF5", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14879-1", "protein_name": "Interferon-induced protein with tetratricopeptide repeats 3", "gene_name": "IFIT3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q05823-1", "protein_name": "2-5A-dependent ribonuclease", "gene_name": "RNASEL", "tax_name": "Human" }, { "uniprot_canonical_ac": "P10914-1", "protein_name": "Interferon regulatory factor 1", "gene_name": "IRF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6GPH4-1", "protein_name": "XIAP-associated factor 1", "gene_name": "XAF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P52630-3", "protein_name": "Signal transducer and activator of transcription 2", "gene_name": "STAT2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P09912-1", "protein_name": "Interferon alpha-inducible protein 6", "gene_name": "IFI6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P10321-1", "protein_name": "HLA class I histocompatibility antigen, C alpha chain", "gene_name": "HLA-C", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04439-1", "protein_name": "HLA class I histocompatibility antigen, A alpha chain", "gene_name": "HLA-A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92985-1", "protein_name": "Interferon regulatory factor 7", "gene_name": "IRF7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61221-1", "protein_name": "ATP-binding cassette sub-family E member 1", "gene_name": "ABCE1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P00973-1", "protein_name": "2'-5'-oligoadenylate synthase 1", "gene_name": "OAS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05014-1", "protein_name": "Interferon alpha-4", "gene_name": "IFNA4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q06124-2", "protein_name": "Tyrosine-protein phosphatase non-receptor type 11", "gene_name": "PTPN11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P29597-1", "protein_name": "Non-receptor tyrosine-protein kinase TYK2", "gene_name": "TYK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14543-1", "protein_name": "Suppressor of cytokine signaling 3", "gene_name": "SOCS3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DY56-1", "protein_name": "Interferon alpha-1", "gene_name": "IFNA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62979-1", "protein_name": "Ubiquitin-ribosomal protein eS31 fusion protein", "gene_name": "RPS27A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q10589-1", "protein_name": "Bone marrow stromal antigen 2", "gene_name": "BST2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15306-1", "protein_name": "Interferon regulatory factor 4", "gene_name": "IRF4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P55265-1", "protein_name": "Double-stranded RNA-specific adenosine deaminase", "gene_name": "ADAR", "tax_name": "Human" }, { "uniprot_canonical_ac": "P13164-1", "protein_name": "Interferon-induced transmembrane protein 1", "gene_name": "IFITM1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P40305-2", "protein_name": "Interferon alpha-inducible protein 27, mitochondrial", "gene_name": "IFI27", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01629-1", "protein_name": "Interferon-induced transmembrane protein 2", "gene_name": "IFITM2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01566-1", "protein_name": "Interferon alpha-10", "gene_name": "IFNA10", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01571-1", "protein_name": "Interferon alpha-17", "gene_name": "IFNA17", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01574-1", "protein_name": "Interferon beta", "gene_name": "IFNB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05015-1", "protein_name": "Interferon alpha-16", "gene_name": "IFNA16", "tax_name": "Human" }, { "uniprot_canonical_ac": "P28062-1", "protein_name": "Proteasome subunit beta type-8", "gene_name": "PSMB8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13325-1", "protein_name": "Interferon-induced protein with tetratricopeptide repeats 5", "gene_name": "IFIT5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P19525-1", "protein_name": "Interferon-induced, double-stranded RNA-activated protein kinase", "gene_name": "EIF2AK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG47-1", "protein_name": "Polyubiquitin-B", "gene_name": "UBB", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42224-1", "protein_name": "Signal transducer and activator of transcription 1-alpha/beta", "gene_name": "STAT1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P80217-1", "protein_name": "Interferon-induced 35 kDa protein", "gene_name": "IFI35", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62987-1", "protein_name": "Ubiquitin-ribosomal protein eL40 fusion protein", "gene_name": "UBA52", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01628-1", "protein_name": "Interferon-induced transmembrane protein 3", "gene_name": "IFITM3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y3Z3-1", "protein_name": "Deoxynucleoside triphosphate triphosphohydrolase SAMHD1", "gene_name": "SAMHD1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P32456-1", "protein_name": "Guanylate-binding protein 2", "gene_name": "GBP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q00978-1", "protein_name": "Interferon regulatory factor 9", "gene_name": "IRF9", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01893-1", "protein_name": "Putative HLA class I histocompatibility antigen, alpha chain H", "gene_name": "HLA-H", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05161-1", "protein_name": "Ubiquitin-like protein ISG15", "gene_name": "ISG15", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14974-1", "protein_name": "Importin subunit beta-1", "gene_name": "KPNB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P23458-1", "protein_name": "Tyrosine-protein kinase JAK1", "gene_name": "JAK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P17181-1", "protein_name": "Interferon alpha/beta receptor 1", "gene_name": "IFNAR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG48-1", "protein_name": "Polyubiquitin-C", "gene_name": "UBC", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01889-1", "protein_name": "HLA class I histocompatibility antigen, B alpha chain", "gene_name": "HLA-B", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P52294", "url": "https://www.uniprot.org/uniprotkb/P52294" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.8621447", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 74 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The binding site of karyopherin alpha for karyopherin beta overlaps with a nuclear localization sequence.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1996-06-25", "authors": "Moroianu J, Blobel G, Radu A", "reference": { "type": "PubMed", "id": "8692858", "url": "https://pubmed.ncbi.nlm.nih.gov/8692858" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P52294-1", "protein_name": "Importin subunit alpha-5", "gene_name": "KPNA1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P52294", "url": "https://www.uniprot.org/uniprotkb/P52294" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.8692858", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Interferon-alpha-dependent activation of Tyk2 requires phosphorylation of positive regulatory tyrosines by another kinase.", "journal": "The Journal of biological chemistry", "date": "1996", "authors": "Gauzzi MC, Velazquez L, McKendry R, Mogensen KE, Fellous M, Pellegrini S", "reference": { "type": "PubMed", "id": "8702790", "url": "https://pubmed.ncbi.nlm.nih.gov/8702790" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P52294-1", "protein_name": "Importin subunit alpha-5", "gene_name": "KPNA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P18146-1", "protein_name": "Early growth response protein 1", "gene_name": "EGR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15646-1", "protein_name": "2'-5'-oligoadenylate synthase-like protein", "gene_name": "OASL", "tax_name": "Human" }, { "uniprot_canonical_ac": "P29728-1", "protein_name": "2'-5'-oligoadenylate synthase 2", "gene_name": "OAS2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15524-1", "protein_name": "Suppressor of cytokine signaling 1", "gene_name": "SOCS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y6K5-1", "protein_name": "2'-5'-oligoadenylate synthase 3", "gene_name": "OAS3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q02556-1", "protein_name": "Interferon regulatory factor 8", "gene_name": "IRF8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96AZ6-1", "protein_name": "Interferon-stimulated gene 20 kDa protein", "gene_name": "ISG20", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14896-1", "protein_name": "Interferon regulatory factor 6", "gene_name": "IRF6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P30511-1", "protein_name": "HLA class I histocompatibility antigen, alpha chain F", "gene_name": "HLA-F", "tax_name": "Human" }, { "uniprot_canonical_ac": "P13747-1", "protein_name": "HLA class I histocompatibility antigen, alpha chain E", "gene_name": "HLA-E", "tax_name": "Human" }, { "uniprot_canonical_ac": "P17693-1", "protein_name": "HLA class I histocompatibility antigen, alpha chain G", "gene_name": "HLA-G", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01563-1", "protein_name": "Interferon alpha-2", "gene_name": "IFNA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01567-1", "protein_name": "Interferon alpha-7", "gene_name": "IFNA7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01568-1", "protein_name": "Interferon alpha-21", "gene_name": "IFNA21", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01569-1", "protein_name": "Interferon alpha-5", "gene_name": "IFNA5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01570-1", "protein_name": "Interferon alpha-14", "gene_name": "IFNA14", "tax_name": "Human" }, { "uniprot_canonical_ac": "P09914-1", "protein_name": "Antiviral innate immune response effector IFIT1", "gene_name": "IFIT1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P32881-1", "protein_name": "Interferon alpha-8", "gene_name": "IFNA8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UHH9-1", "protein_name": "Inositol hexakisphosphate kinase 2", "gene_name": "IP6K2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05013-1", "protein_name": "Interferon alpha-6", "gene_name": "IFNA6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P09913-1", "protein_name": "Interferon-induced protein with tetratricopeptide repeats 2", "gene_name": "IFIT2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8WXG1-1", "protein_name": "S-adenosylmethionine-dependent nucleotide dehydratase RSAD2", "gene_name": "RSAD2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P20592-1", "protein_name": "Interferon-induced GTP-binding protein Mx2", "gene_name": "MX2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P14316-1", "protein_name": "Interferon regulatory factor 2", "gene_name": "IRF2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P29350-1", "protein_name": "Tyrosine-protein phosphatase non-receptor type 6", "gene_name": "PTPN6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14653-1", "protein_name": "Interferon regulatory factor 3", "gene_name": "IRF3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P20591-1", "protein_name": "Interferon-induced GTP-binding protein Mx1", "gene_name": "MX1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13568-1", "protein_name": "Interferon regulatory factor 5", "gene_name": "IRF5", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14879-1", "protein_name": "Interferon-induced protein with tetratricopeptide repeats 3", "gene_name": "IFIT3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q05823-1", "protein_name": "2-5A-dependent ribonuclease", "gene_name": "RNASEL", "tax_name": "Human" }, { "uniprot_canonical_ac": "P10914-1", "protein_name": "Interferon regulatory factor 1", "gene_name": "IRF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6GPH4-1", "protein_name": "XIAP-associated factor 1", "gene_name": "XAF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P52630-3", "protein_name": "Signal transducer and activator of transcription 2", "gene_name": "STAT2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P09912-1", "protein_name": "Interferon alpha-inducible protein 6", "gene_name": "IFI6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P10321-1", "protein_name": "HLA class I histocompatibility antigen, C alpha chain", "gene_name": "HLA-C", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04439-1", "protein_name": "HLA class I histocompatibility antigen, A alpha chain", "gene_name": "HLA-A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92985-1", "protein_name": "Interferon regulatory factor 7", "gene_name": "IRF7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61221-1", "protein_name": "ATP-binding cassette sub-family E member 1", "gene_name": "ABCE1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P00973-1", "protein_name": "2'-5'-oligoadenylate synthase 1", "gene_name": "OAS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05014-1", "protein_name": "Interferon alpha-4", "gene_name": "IFNA4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q06124-2", "protein_name": "Tyrosine-protein phosphatase non-receptor type 11", "gene_name": "PTPN11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P29597-1", "protein_name": "Non-receptor tyrosine-protein kinase TYK2", "gene_name": "TYK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14543-1", "protein_name": "Suppressor of cytokine signaling 3", "gene_name": "SOCS3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DY56-1", "protein_name": "Interferon alpha-1", "gene_name": "IFNA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62979-1", "protein_name": "Ubiquitin-ribosomal protein eS31 fusion protein", "gene_name": "RPS27A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q10589-1", "protein_name": "Bone marrow stromal antigen 2", "gene_name": "BST2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15306-1", "protein_name": "Interferon regulatory factor 4", "gene_name": "IRF4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P55265-1", "protein_name": "Double-stranded RNA-specific adenosine deaminase", "gene_name": "ADAR", "tax_name": "Human" }, { "uniprot_canonical_ac": "P13164-1", "protein_name": "Interferon-induced transmembrane protein 1", "gene_name": "IFITM1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P40305-2", "protein_name": "Interferon alpha-inducible protein 27, mitochondrial", "gene_name": "IFI27", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01629-1", "protein_name": "Interferon-induced transmembrane protein 2", "gene_name": "IFITM2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01566-1", "protein_name": "Interferon alpha-10", "gene_name": "IFNA10", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01571-1", "protein_name": "Interferon alpha-17", "gene_name": "IFNA17", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01574-1", "protein_name": "Interferon beta", "gene_name": "IFNB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05015-1", "protein_name": "Interferon alpha-16", "gene_name": "IFNA16", "tax_name": "Human" }, { "uniprot_canonical_ac": "P28062-1", "protein_name": "Proteasome subunit beta type-8", "gene_name": "PSMB8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13325-1", "protein_name": "Interferon-induced protein with tetratricopeptide repeats 5", "gene_name": "IFIT5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P19525-1", "protein_name": "Interferon-induced, double-stranded RNA-activated protein kinase", "gene_name": "EIF2AK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG47-1", "protein_name": "Polyubiquitin-B", "gene_name": "UBB", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42224-1", "protein_name": "Signal transducer and activator of transcription 1-alpha/beta", "gene_name": "STAT1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P80217-1", "protein_name": "Interferon-induced 35 kDa protein", "gene_name": "IFI35", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62987-1", "protein_name": "Ubiquitin-ribosomal protein eL40 fusion protein", "gene_name": "UBA52", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01628-1", "protein_name": "Interferon-induced transmembrane protein 3", "gene_name": "IFITM3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y3Z3-1", "protein_name": "Deoxynucleoside triphosphate triphosphohydrolase SAMHD1", "gene_name": "SAMHD1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P32456-1", "protein_name": "Guanylate-binding protein 2", "gene_name": "GBP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q00978-1", "protein_name": "Interferon regulatory factor 9", "gene_name": "IRF9", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01893-1", "protein_name": "Putative HLA class I histocompatibility antigen, alpha chain H", "gene_name": "HLA-H", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05161-1", "protein_name": "Ubiquitin-like protein ISG15", "gene_name": "ISG15", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14974-1", "protein_name": "Importin subunit beta-1", "gene_name": "KPNB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P23458-1", "protein_name": "Tyrosine-protein kinase JAK1", "gene_name": "JAK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P17181-1", "protein_name": "Interferon alpha/beta receptor 1", "gene_name": "IFNAR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG48-1", "protein_name": "Polyubiquitin-C", "gene_name": "UBC", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01889-1", "protein_name": "HLA class I histocompatibility antigen, B alpha chain", "gene_name": "HLA-B", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P52294", "url": "https://www.uniprot.org/uniprotkb/P52294" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 1054, "end_pos": 1054, "sequence_org": "Y", "sequence_mut": "F", "comment": "Reduces basal catalytic activity and abolishes IFN-dependent activation.", "evidence": [ { "database": "UniProtKB", "id": "P29597", "url": "https://www.uniprot.org/uniprotkb/P29597" }, { "database": "PubMed", "id": "8702790", "url": "https://pubmed.ncbi.nlm.nih.gov/8702790" } ], "uniprot_canonical_ac": "P29597-1" }, { "start_pos": 1055, "end_pos": 1055, "sequence_org": "Y", "sequence_mut": "F", "comment": "Reduces basal catalytic activity and abolishes IFN-dependent activation.", "evidence": [ { "database": "UniProtKB", "id": "P29597", "url": "https://www.uniprot.org/uniprotkb/P29597" }, { "database": "PubMed", "id": "8702790", "url": "https://pubmed.ncbi.nlm.nih.gov/8702790" } ], "uniprot_canonical_ac": "P29597-1" }, { "start_pos": 1145, "end_pos": 1145, "sequence_org": "Y", "sequence_mut": "F", "comment": "Does not affect phosphorylation state and enzymatic activity.", "evidence": [ { "database": "UniProtKB", "id": "P29597", "url": "https://www.uniprot.org/uniprotkb/P29597" }, { "database": "PubMed", "id": "8702790", "url": "https://pubmed.ncbi.nlm.nih.gov/8702790" } ], "uniprot_canonical_ac": "P29597-1" }, { "start_pos": 1176, "end_pos": 1176, "sequence_org": "Y", "sequence_mut": "F", "comment": "Does not affect phosphorylation state and enzymatic activity.", "evidence": [ { "database": "UniProtKB", "id": "P29597", "url": "https://www.uniprot.org/uniprotkb/P29597" }, { "database": "PubMed", "id": "8702790", "url": "https://pubmed.ncbi.nlm.nih.gov/8702790" } ], "uniprot_canonical_ac": "P29597-1" }, { "start_pos": 930, "end_pos": 930, "sequence_org": "K", "sequence_mut": "R", "comment": "Complete loss of catalytic activity.", "evidence": [ { "database": "UniProtKB", "id": "P29597", "url": "https://www.uniprot.org/uniprotkb/P29597" }, { "database": "PubMed", "id": "8702790", "url": "https://pubmed.ncbi.nlm.nih.gov/8702790" } ], "uniprot_canonical_ac": "P29597-1" } ], "phosphorylation": [ { "start_pos": 1054, "end_pos": 1054, "kinase_uniprot_canonical_ac": "P23458-1", "kinase_gene_name": "JAK1", "residue": "Tyr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P29597", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P29597" }, { "database": "PubMed", "id": "19901323", "url": "https://pubmed.ncbi.nlm.nih.gov/19901323" }, { "database": "PubMed", "id": "8702790", "url": "https://pubmed.ncbi.nlm.nih.gov/8702790" }, { "database": "PubMed", "id": "30029643", "url": "https://pubmed.ncbi.nlm.nih.gov/30029643" } ], "site_lbl": "Tyr1054", "uniprot_canonical_ac": "P29597-1" }, { "start_pos": 1054, "end_pos": 1054, "kinase_uniprot_canonical_ac": "P29597-1", "kinase_gene_name": "TYK2", "residue": "Tyr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P29597", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P29597" }, { "database": "PubMed", "id": "8702790", "url": "https://pubmed.ncbi.nlm.nih.gov/8702790" }, { "database": "UniProtKB", "id": "P29597", "url": "https://www.uniprot.org/uniprotkb/P29597" }, { "database": "PubMed", "id": "20478313", "url": "https://pubmed.ncbi.nlm.nih.gov/20478313" } ], "site_lbl": "Tyr1054", "uniprot_canonical_ac": "P29597-1" }, { "start_pos": 1054, "end_pos": 1054, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "Phosphotyrosine; by autocatalysis", "evidence": [ { "database": "UniProtKB", "id": "P29597", "url": "https://www.uniprot.org/uniprotkb/P29597" }, { "database": "PRO", "id": "P29597", "url": "https://proconsortium.org/cgi-bin/entry_pro?id=P29597" }, { "database": "iPTMnet", "id": "P29597", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P29597" }, { "database": "PubMed", "id": "21625597", "url": "https://pubmed.ncbi.nlm.nih.gov/21625597" }, { "database": "PubMed", "id": "8702790", "url": "https://pubmed.ncbi.nlm.nih.gov/8702790" } ], "site_lbl": "Tyr1054", "uniprot_canonical_ac": "P29597-1" }, { "start_pos": 1055, "end_pos": 1055, "kinase_uniprot_canonical_ac": "P23458-1", "kinase_gene_name": "JAK1", "residue": "Tyr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P29597", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P29597" }, { "database": "PubMed", "id": "19901323", "url": "https://pubmed.ncbi.nlm.nih.gov/19901323" }, { "database": "PubMed", "id": "8702790", "url": "https://pubmed.ncbi.nlm.nih.gov/8702790" } ], "site_lbl": "Tyr1055", "uniprot_canonical_ac": "P29597-1" }, { "start_pos": 1055, "end_pos": 1055, "kinase_uniprot_canonical_ac": "P29597-1", "kinase_gene_name": "TYK2", "residue": "Tyr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P29597", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P29597" }, { "database": "PubMed", "id": "8702790", "url": "https://pubmed.ncbi.nlm.nih.gov/8702790" } ], "site_lbl": "Tyr1055", "uniprot_canonical_ac": "P29597-1" }, { "start_pos": 1055, "end_pos": 1055, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "Phosphotyrosine", "evidence": [ { "database": "UniProtKB", "id": "P29597", "url": "https://www.uniprot.org/uniprotkb/P29597" }, { "database": "PubMed", "id": "8702790", "url": "https://pubmed.ncbi.nlm.nih.gov/8702790" }, { "database": "PRO", "id": "P29597", "url": "https://proconsortium.org/cgi-bin/entry_pro?id=P29597" }, { "database": "iPTMnet", "id": "P29597", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P29597" }, { "database": "PubMed", "id": "21625597", "url": "https://pubmed.ncbi.nlm.nih.gov/21625597" } ], "site_lbl": "Tyr1055", "uniprot_canonical_ac": "P29597-1" } ], "record_id": "pubmed.8702790", "abstract": "", "glycosylation": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 74 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 6 }, { "field": "total_sites", "count": 2 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "HIV cDNA integration: molecular biology and inhibitor development.", "journal": "AIDS (London, England)", "date": "1996", "authors": "Farnet CM, Bushman FD", "reference": { "type": "PubMed", "id": "8883604", "url": "https://pubmed.ncbi.nlm.nih.gov/8883604" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P52294-1", "protein_name": "Importin subunit alpha-5", "gene_name": "KPNA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62937-1", "protein_name": "Peptidyl-prolyl cis-trans isomerase A", "gene_name": "PPIA", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75475-1", "protein_name": "PC4 and SFRS1-interacting protein", "gene_name": "PSIP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75531-1", "protein_name": "Barrier-to-autointegration factor", "gene_name": "BANF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P17096-1", "protein_name": "High mobility group protein HMG-I/HMG-Y", "gene_name": "HMGA1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P52294", "url": "https://www.uniprot.org/uniprotkb/P52294" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.8883604", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 5 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "HIV-1 cDNA integration: requirement of HMG I(Y) protein for function of preintegration complexes in vitro.", "journal": "Cell", "date": "1997", "authors": "Farnet CM, Bushman FD", "reference": { "type": "PubMed", "id": "9038339", "url": "https://pubmed.ncbi.nlm.nih.gov/9038339" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P52294-1", "protein_name": "Importin subunit alpha-5", "gene_name": "KPNA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62937-1", "protein_name": "Peptidyl-prolyl cis-trans isomerase A", "gene_name": "PPIA", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75475-1", "protein_name": "PC4 and SFRS1-interacting protein", "gene_name": "PSIP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75531-1", "protein_name": "Barrier-to-autointegration factor", "gene_name": "BANF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P17096-1", "protein_name": "High mobility group protein HMG-I/HMG-Y", "gene_name": "HMGA1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P52294", "url": "https://www.uniprot.org/uniprotkb/P52294" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.9038339", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 5 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "A double-stranded RNA-activated protein kinase-dependent pathway mediating stress-induced apoptosis.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1997", "authors": "Der SD, Yang YL, Weissmann C, Williams BR", "reference": { "type": "PubMed", "id": "9096384", "url": "https://pubmed.ncbi.nlm.nih.gov/9096384" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P52294-1", "protein_name": "Importin subunit alpha-5", "gene_name": "KPNA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P18146-1", "protein_name": "Early growth response protein 1", "gene_name": "EGR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15646-1", "protein_name": "2'-5'-oligoadenylate synthase-like protein", "gene_name": "OASL", "tax_name": "Human" }, { "uniprot_canonical_ac": "P29728-1", "protein_name": "2'-5'-oligoadenylate synthase 2", "gene_name": "OAS2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15524-1", "protein_name": "Suppressor of cytokine signaling 1", "gene_name": "SOCS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y6K5-1", "protein_name": "2'-5'-oligoadenylate synthase 3", "gene_name": "OAS3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q02556-1", "protein_name": "Interferon regulatory factor 8", "gene_name": "IRF8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96AZ6-1", "protein_name": "Interferon-stimulated gene 20 kDa protein", "gene_name": "ISG20", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14896-1", "protein_name": "Interferon regulatory factor 6", "gene_name": "IRF6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P30511-1", "protein_name": "HLA class I histocompatibility antigen, alpha chain F", "gene_name": "HLA-F", "tax_name": "Human" }, { "uniprot_canonical_ac": "P13747-1", "protein_name": "HLA class I histocompatibility antigen, alpha chain E", "gene_name": "HLA-E", "tax_name": "Human" }, { "uniprot_canonical_ac": "P17693-1", "protein_name": "HLA class I histocompatibility antigen, alpha chain G", "gene_name": "HLA-G", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01563-1", "protein_name": "Interferon alpha-2", "gene_name": "IFNA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01567-1", "protein_name": "Interferon alpha-7", "gene_name": "IFNA7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01568-1", "protein_name": "Interferon alpha-21", "gene_name": "IFNA21", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01569-1", "protein_name": "Interferon alpha-5", "gene_name": "IFNA5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01570-1", "protein_name": "Interferon alpha-14", "gene_name": "IFNA14", "tax_name": "Human" }, { "uniprot_canonical_ac": "P09914-1", "protein_name": "Antiviral innate immune response effector IFIT1", "gene_name": "IFIT1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P32881-1", "protein_name": "Interferon alpha-8", "gene_name": "IFNA8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UHH9-1", "protein_name": "Inositol hexakisphosphate kinase 2", "gene_name": "IP6K2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05013-1", "protein_name": "Interferon alpha-6", "gene_name": "IFNA6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P09913-1", "protein_name": "Interferon-induced protein with tetratricopeptide repeats 2", "gene_name": "IFIT2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8WXG1-1", "protein_name": "S-adenosylmethionine-dependent nucleotide dehydratase RSAD2", "gene_name": "RSAD2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P20592-1", "protein_name": "Interferon-induced GTP-binding protein Mx2", "gene_name": "MX2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P14316-1", "protein_name": "Interferon regulatory factor 2", "gene_name": "IRF2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P29350-1", "protein_name": "Tyrosine-protein phosphatase non-receptor type 6", "gene_name": "PTPN6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14653-1", "protein_name": "Interferon regulatory factor 3", "gene_name": "IRF3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P20591-1", "protein_name": "Interferon-induced GTP-binding protein Mx1", "gene_name": "MX1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13568-1", "protein_name": "Interferon regulatory factor 5", "gene_name": "IRF5", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14879-1", "protein_name": "Interferon-induced protein with tetratricopeptide repeats 3", "gene_name": "IFIT3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q05823-1", "protein_name": "2-5A-dependent ribonuclease", "gene_name": "RNASEL", "tax_name": "Human" }, { "uniprot_canonical_ac": "P10914-1", "protein_name": "Interferon regulatory factor 1", "gene_name": "IRF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6GPH4-1", "protein_name": "XIAP-associated factor 1", "gene_name": "XAF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P52630-3", "protein_name": "Signal transducer and activator of transcription 2", "gene_name": "STAT2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P09912-1", "protein_name": "Interferon alpha-inducible protein 6", "gene_name": "IFI6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P10321-1", "protein_name": "HLA class I histocompatibility antigen, C alpha chain", "gene_name": "HLA-C", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04439-1", "protein_name": "HLA class I histocompatibility antigen, A alpha chain", "gene_name": "HLA-A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92985-1", "protein_name": "Interferon regulatory factor 7", "gene_name": "IRF7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61221-1", "protein_name": "ATP-binding cassette sub-family E member 1", "gene_name": "ABCE1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P00973-1", "protein_name": "2'-5'-oligoadenylate synthase 1", "gene_name": "OAS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05014-1", "protein_name": "Interferon alpha-4", "gene_name": "IFNA4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q06124-2", "protein_name": "Tyrosine-protein phosphatase non-receptor type 11", "gene_name": "PTPN11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P29597-1", "protein_name": "Non-receptor tyrosine-protein kinase TYK2", "gene_name": "TYK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14543-1", "protein_name": "Suppressor of cytokine signaling 3", "gene_name": "SOCS3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DY56-1", "protein_name": "Interferon alpha-1", "gene_name": "IFNA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62979-1", "protein_name": "Ubiquitin-ribosomal protein eS31 fusion protein", "gene_name": "RPS27A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q10589-1", "protein_name": "Bone marrow stromal antigen 2", "gene_name": "BST2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15306-1", "protein_name": "Interferon regulatory factor 4", "gene_name": "IRF4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P55265-1", "protein_name": "Double-stranded RNA-specific adenosine deaminase", "gene_name": "ADAR", "tax_name": "Human" }, { "uniprot_canonical_ac": "P13164-1", "protein_name": "Interferon-induced transmembrane protein 1", "gene_name": "IFITM1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P40305-2", "protein_name": "Interferon alpha-inducible protein 27, mitochondrial", "gene_name": "IFI27", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01629-1", "protein_name": "Interferon-induced transmembrane protein 2", "gene_name": "IFITM2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01566-1", "protein_name": "Interferon alpha-10", "gene_name": "IFNA10", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01571-1", "protein_name": "Interferon alpha-17", "gene_name": "IFNA17", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01574-1", "protein_name": "Interferon beta", "gene_name": "IFNB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05015-1", "protein_name": "Interferon alpha-16", "gene_name": "IFNA16", "tax_name": "Human" }, { "uniprot_canonical_ac": "P28062-1", "protein_name": "Proteasome subunit beta type-8", "gene_name": "PSMB8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13325-1", "protein_name": "Interferon-induced protein with tetratricopeptide repeats 5", "gene_name": "IFIT5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P19525-1", "protein_name": "Interferon-induced, double-stranded RNA-activated protein kinase", "gene_name": "EIF2AK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG47-1", "protein_name": "Polyubiquitin-B", "gene_name": "UBB", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42224-1", "protein_name": "Signal transducer and activator of transcription 1-alpha/beta", "gene_name": "STAT1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P80217-1", "protein_name": "Interferon-induced 35 kDa protein", "gene_name": "IFI35", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62987-1", "protein_name": "Ubiquitin-ribosomal protein eL40 fusion protein", "gene_name": "UBA52", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01628-1", "protein_name": "Interferon-induced transmembrane protein 3", "gene_name": "IFITM3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y3Z3-1", "protein_name": "Deoxynucleoside triphosphate triphosphohydrolase SAMHD1", "gene_name": "SAMHD1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P32456-1", "protein_name": "Guanylate-binding protein 2", "gene_name": "GBP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q00978-1", "protein_name": "Interferon regulatory factor 9", "gene_name": "IRF9", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01893-1", "protein_name": "Putative HLA class I histocompatibility antigen, alpha chain H", "gene_name": "HLA-H", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05161-1", "protein_name": "Ubiquitin-like protein ISG15", "gene_name": "ISG15", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14974-1", "protein_name": "Importin subunit beta-1", "gene_name": "KPNB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P23458-1", "protein_name": "Tyrosine-protein kinase JAK1", "gene_name": "JAK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P17181-1", "protein_name": "Interferon alpha/beta receptor 1", "gene_name": "IFNAR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG48-1", "protein_name": "Polyubiquitin-C", "gene_name": "UBC", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01889-1", "protein_name": "HLA class I histocompatibility antigen, B alpha chain", "gene_name": "HLA-B", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P52294", "url": "https://www.uniprot.org/uniprotkb/P52294" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.9096384", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 74 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "DFF, a heterodimeric protein that functions downstream of caspase-3 to trigger DNA fragmentation during apoptosis.", "journal": "Cell", "date": "1997", "authors": "Liu X, Zou H, Slaughter C, Wang X", "reference": { "type": "PubMed", "id": "9108473", "url": "https://pubmed.ncbi.nlm.nih.gov/9108473" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P52294-1", "protein_name": "Importin subunit alpha-5", "gene_name": "KPNA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P09429-1", "protein_name": "High mobility group protein B1", "gene_name": "HMGB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P10412-1", "protein_name": "Histone H1.4", "gene_name": "H1-4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42574-1", "protein_name": "Caspase-3", "gene_name": "CASP3", "tax_name": "Human" }, { "uniprot_canonical_ac": "O76075-1", "protein_name": "DNA fragmentation factor subunit beta", "gene_name": "DFFB", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00273-1", "protein_name": "DNA fragmentation factor subunit alpha", "gene_name": "DFFA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P16403-1", "protein_name": "Histone H1.2", "gene_name": "H1-2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P07305-1", "protein_name": "Histone H1.0", "gene_name": "H1-0", "tax_name": "Human" }, { "uniprot_canonical_ac": "P16401-1", "protein_name": "Histone H1.5", "gene_name": "H1-5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q02539-1", "protein_name": "Histone H1.1", "gene_name": "H1-1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P26583-1", "protein_name": "High mobility group protein B2", "gene_name": "HMGB2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P16402-1", "protein_name": "Histone H1.3", "gene_name": "H1-3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14974-1", "protein_name": "Importin subunit beta-1", "gene_name": "KPNB1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P52294", "url": "https://www.uniprot.org/uniprotkb/P52294" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.9108473", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 13 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Functional subdomains of STAT2 required for preassociation with the alpha interferon receptor and for signaling.", "journal": "Molecular and cellular biology", "date": "1997", "authors": "Li X, Leung S, Kerr IM, Stark GR", "reference": { "type": "PubMed", "id": "9121453", "url": "https://pubmed.ncbi.nlm.nih.gov/9121453" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P52294-1", "protein_name": "Importin subunit alpha-5", "gene_name": "KPNA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P18146-1", "protein_name": "Early growth response protein 1", "gene_name": "EGR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15646-1", "protein_name": "2'-5'-oligoadenylate synthase-like protein", "gene_name": "OASL", "tax_name": "Human" }, { "uniprot_canonical_ac": "P29728-1", "protein_name": "2'-5'-oligoadenylate synthase 2", "gene_name": "OAS2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15524-1", "protein_name": "Suppressor of cytokine signaling 1", "gene_name": "SOCS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y6K5-1", "protein_name": "2'-5'-oligoadenylate synthase 3", "gene_name": "OAS3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q02556-1", "protein_name": "Interferon regulatory factor 8", "gene_name": "IRF8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96AZ6-1", "protein_name": "Interferon-stimulated gene 20 kDa protein", "gene_name": "ISG20", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14896-1", "protein_name": "Interferon regulatory factor 6", "gene_name": "IRF6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P30511-1", "protein_name": "HLA class I histocompatibility antigen, alpha chain F", "gene_name": "HLA-F", "tax_name": "Human" }, { "uniprot_canonical_ac": "P13747-1", "protein_name": "HLA class I histocompatibility antigen, alpha chain E", "gene_name": "HLA-E", "tax_name": "Human" }, { "uniprot_canonical_ac": "P17693-1", "protein_name": "HLA class I histocompatibility antigen, alpha chain G", "gene_name": "HLA-G", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01563-1", "protein_name": "Interferon alpha-2", "gene_name": "IFNA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01567-1", "protein_name": "Interferon alpha-7", "gene_name": "IFNA7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01568-1", "protein_name": "Interferon alpha-21", "gene_name": "IFNA21", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01569-1", "protein_name": "Interferon alpha-5", "gene_name": "IFNA5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01570-1", "protein_name": "Interferon alpha-14", "gene_name": "IFNA14", "tax_name": "Human" }, { "uniprot_canonical_ac": "P09914-1", "protein_name": "Antiviral innate immune response effector IFIT1", "gene_name": "IFIT1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P32881-1", "protein_name": "Interferon alpha-8", "gene_name": "IFNA8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UHH9-1", "protein_name": "Inositol hexakisphosphate kinase 2", "gene_name": "IP6K2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05013-1", "protein_name": "Interferon alpha-6", "gene_name": "IFNA6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P09913-1", "protein_name": "Interferon-induced protein with tetratricopeptide repeats 2", "gene_name": "IFIT2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8WXG1-1", "protein_name": "S-adenosylmethionine-dependent nucleotide dehydratase RSAD2", "gene_name": "RSAD2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P20592-1", "protein_name": "Interferon-induced GTP-binding protein Mx2", "gene_name": "MX2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P14316-1", "protein_name": "Interferon regulatory factor 2", "gene_name": "IRF2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P29350-1", "protein_name": "Tyrosine-protein phosphatase non-receptor type 6", "gene_name": "PTPN6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P48551-1", "protein_name": "Interferon alpha/beta receptor 2", "gene_name": "IFNAR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14653-1", "protein_name": "Interferon regulatory factor 3", "gene_name": "IRF3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P20591-1", "protein_name": "Interferon-induced GTP-binding protein Mx1", "gene_name": "MX1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13568-1", "protein_name": "Interferon regulatory factor 5", "gene_name": "IRF5", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14879-1", "protein_name": "Interferon-induced protein with tetratricopeptide repeats 3", "gene_name": "IFIT3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q05823-1", "protein_name": "2-5A-dependent ribonuclease", "gene_name": "RNASEL", "tax_name": "Human" }, { "uniprot_canonical_ac": "P10914-1", "protein_name": "Interferon regulatory factor 1", "gene_name": "IRF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6GPH4-1", "protein_name": "XIAP-associated factor 1", "gene_name": "XAF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P52630-3", "protein_name": "Signal transducer and activator of transcription 2", "gene_name": "STAT2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P09912-1", "protein_name": "Interferon alpha-inducible protein 6", "gene_name": "IFI6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P10321-1", "protein_name": "HLA class I histocompatibility antigen, C alpha chain", "gene_name": "HLA-C", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04439-1", "protein_name": "HLA class I histocompatibility antigen, A alpha chain", "gene_name": "HLA-A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92985-1", "protein_name": "Interferon regulatory factor 7", "gene_name": "IRF7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61221-1", "protein_name": "ATP-binding cassette sub-family E member 1", "gene_name": "ABCE1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P00973-1", "protein_name": "2'-5'-oligoadenylate synthase 1", "gene_name": "OAS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05014-1", "protein_name": "Interferon alpha-4", "gene_name": "IFNA4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q06124-2", "protein_name": "Tyrosine-protein phosphatase non-receptor type 11", "gene_name": "PTPN11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P29597-1", "protein_name": "Non-receptor tyrosine-protein kinase TYK2", "gene_name": "TYK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14543-1", "protein_name": "Suppressor of cytokine signaling 3", "gene_name": "SOCS3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DY56-1", "protein_name": "Interferon alpha-1", "gene_name": "IFNA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62979-1", "protein_name": "Ubiquitin-ribosomal protein eS31 fusion protein", "gene_name": "RPS27A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q10589-1", "protein_name": "Bone marrow stromal antigen 2", "gene_name": "BST2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15306-1", "protein_name": "Interferon regulatory factor 4", "gene_name": "IRF4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P55265-1", "protein_name": "Double-stranded RNA-specific adenosine deaminase", "gene_name": "ADAR", "tax_name": "Human" }, { "uniprot_canonical_ac": "P13164-1", "protein_name": "Interferon-induced transmembrane protein 1", "gene_name": "IFITM1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P40305-2", "protein_name": "Interferon alpha-inducible protein 27, mitochondrial", "gene_name": "IFI27", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01629-1", "protein_name": "Interferon-induced transmembrane protein 2", "gene_name": "IFITM2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01566-1", "protein_name": "Interferon alpha-10", "gene_name": "IFNA10", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01571-1", "protein_name": "Interferon alpha-17", "gene_name": "IFNA17", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01574-1", "protein_name": "Interferon beta", "gene_name": "IFNB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05015-1", "protein_name": "Interferon alpha-16", "gene_name": "IFNA16", "tax_name": "Human" }, { "uniprot_canonical_ac": "P28062-1", "protein_name": "Proteasome subunit beta type-8", "gene_name": "PSMB8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13325-1", "protein_name": "Interferon-induced protein with tetratricopeptide repeats 5", "gene_name": "IFIT5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P19525-1", "protein_name": "Interferon-induced, double-stranded RNA-activated protein kinase", "gene_name": "EIF2AK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG47-1", "protein_name": "Polyubiquitin-B", "gene_name": "UBB", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42224-1", "protein_name": "Signal transducer and activator of transcription 1-alpha/beta", "gene_name": "STAT1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P80217-1", "protein_name": "Interferon-induced 35 kDa protein", "gene_name": "IFI35", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62987-1", "protein_name": "Ubiquitin-ribosomal protein eL40 fusion protein", "gene_name": "UBA52", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01628-1", "protein_name": "Interferon-induced transmembrane protein 3", "gene_name": "IFITM3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y3Z3-1", "protein_name": "Deoxynucleoside triphosphate triphosphohydrolase SAMHD1", "gene_name": "SAMHD1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P32456-1", "protein_name": "Guanylate-binding protein 2", "gene_name": "GBP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q00978-1", "protein_name": "Interferon regulatory factor 9", "gene_name": "IRF9", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01893-1", "protein_name": "Putative HLA class I histocompatibility antigen, alpha chain H", "gene_name": "HLA-H", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05161-1", "protein_name": "Ubiquitin-like protein ISG15", "gene_name": "ISG15", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14974-1", "protein_name": "Importin subunit beta-1", "gene_name": "KPNB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P23458-1", "protein_name": "Tyrosine-protein kinase JAK1", "gene_name": "JAK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P17181-1", "protein_name": "Interferon alpha/beta receptor 1", "gene_name": "IFNAR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG48-1", "protein_name": "Polyubiquitin-C", "gene_name": "UBC", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01889-1", "protein_name": "HLA class I histocompatibility antigen, B alpha chain", "gene_name": "HLA-B", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P52294", "url": "https://www.uniprot.org/uniprotkb/P52294" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 690, "end_pos": 690, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "Phosphotyrosine; by JAK", "evidence": [ { "database": "UniProtKB", "id": "P52630", "url": "https://www.uniprot.org/uniprotkb/P52630" }, { "database": "IntAct", "id": "P52630", "url": "https://www.ebi.ac.uk/intact/interactors/id:P52630*" }, { "database": "iPTMnet", "id": "P52630", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P52630" }, { "database": "PubMed", "id": "8605877", "url": "https://pubmed.ncbi.nlm.nih.gov/8605877" }, { "database": "PRO", "id": "P52630", "url": "https://proconsortium.org/cgi-bin/entry_pro?id=P52630" }, { "database": "PubMed", "id": "16324217", "url": "https://pubmed.ncbi.nlm.nih.gov/16324217" }, { "database": "PubMed", "id": "22306001", "url": "https://pubmed.ncbi.nlm.nih.gov/22306001" }, { "database": "PubMed", "id": "22704065", "url": "https://pubmed.ncbi.nlm.nih.gov/22704065" }, { "database": "PubMed", "id": "25564224", "url": "https://pubmed.ncbi.nlm.nih.gov/25564224" }, { "database": "PubMed", "id": "26342467", "url": "https://pubmed.ncbi.nlm.nih.gov/26342467" }, { "database": "PubMed", "id": "29317535", "url": "https://pubmed.ncbi.nlm.nih.gov/29317535" }, { "database": "PubMed", "id": "29581268", "url": "https://pubmed.ncbi.nlm.nih.gov/29581268" }, { "database": "PubMed", "id": "32196427", "url": "https://pubmed.ncbi.nlm.nih.gov/32196427" }, { "database": "PubMed", "id": "32696599", "url": "https://pubmed.ncbi.nlm.nih.gov/32696599" }, { "database": "PubMed", "id": "32778820", "url": "https://pubmed.ncbi.nlm.nih.gov/32778820" }, { "database": "PubMed", "id": "36148221", "url": "https://pubmed.ncbi.nlm.nih.gov/36148221" }, { "database": "PubMed", "id": "8197134", "url": "https://pubmed.ncbi.nlm.nih.gov/8197134" }, { "database": "PubMed", "id": "9121453", "url": "https://pubmed.ncbi.nlm.nih.gov/9121453" }, { "database": "PubMed", "id": "7532278", "url": "https://pubmed.ncbi.nlm.nih.gov/7532278" } ], "site_lbl": "Tyr690", "uniprot_canonical_ac": "P52630-3" }, { "start_pos": 466, "end_pos": 466, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "Phosphotyrosine; by TYK2", "evidence": [ { "database": "UniProtKB", "id": "P17181", "url": "https://www.uniprot.org/uniprotkb/P17181" }, { "database": "IntAct", "id": "P17181", "url": "https://www.ebi.ac.uk/intact/interactors/id:P17181*" }, { "database": "iPTMnet", "id": "P17181", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P17181" }, { "database": "PubMed", "id": "12220192", "url": "https://pubmed.ncbi.nlm.nih.gov/12220192" }, { "database": "PubMed", "id": "9121453", "url": "https://pubmed.ncbi.nlm.nih.gov/9121453" }, { "database": "PubMed", "id": "8605876", "url": "https://pubmed.ncbi.nlm.nih.gov/8605876" }, { "database": "PubMed", "id": "9677371", "url": "https://pubmed.ncbi.nlm.nih.gov/9677371" }, { "database": "PRO", "id": "P17181", "url": "https://proconsortium.org/cgi-bin/entry_pro?id=P17181" }, { "database": "PubMed", "id": "11786546", "url": "https://pubmed.ncbi.nlm.nih.gov/11786546" }, { "database": "PubMed", "id": "7526154", "url": "https://pubmed.ncbi.nlm.nih.gov/7526154" } ], "site_lbl": "Tyr466", "uniprot_canonical_ac": "P17181-1" } ], "record_id": "pubmed.9121453", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 75 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Human immunodeficiency virus type 1 preintegration complexes: studies of organization and composition.", "journal": "Journal of virology", "date": "1997", "authors": "Miller MD, Farnet CM, Bushman FD", "reference": { "type": "PubMed", "id": "9188609", "url": "https://pubmed.ncbi.nlm.nih.gov/9188609" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P52294-1", "protein_name": "Importin subunit alpha-5", "gene_name": "KPNA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62937-1", "protein_name": "Peptidyl-prolyl cis-trans isomerase A", "gene_name": "PPIA", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75475-1", "protein_name": "PC4 and SFRS1-interacting protein", "gene_name": "PSIP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75531-1", "protein_name": "Barrier-to-autointegration factor", "gene_name": "BANF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P17096-1", "protein_name": "High mobility group protein HMG-I/HMG-Y", "gene_name": "HMGA1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P52294", "url": "https://www.uniprot.org/uniprotkb/P52294" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.9188609", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 5 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Distinct STAT structure promotes interaction of STAT2 with the p48 subunit of the interferon-alpha-stimulated transcription factor ISGF3.", "journal": "The Journal of biological chemistry", "date": "1997", "authors": "Martinez-Moczygemba M, Gutch MJ, French DL, Reich NC", "reference": { "type": "PubMed", "id": "9242679", "url": "https://pubmed.ncbi.nlm.nih.gov/9242679" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P52294-1", "protein_name": "Importin subunit alpha-5", "gene_name": "KPNA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P18146-1", "protein_name": "Early growth response protein 1", "gene_name": "EGR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15646-1", "protein_name": "2'-5'-oligoadenylate synthase-like protein", "gene_name": "OASL", "tax_name": "Human" }, { "uniprot_canonical_ac": "P29728-1", "protein_name": "2'-5'-oligoadenylate synthase 2", "gene_name": "OAS2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15524-1", "protein_name": "Suppressor of cytokine signaling 1", "gene_name": "SOCS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y6K5-1", "protein_name": "2'-5'-oligoadenylate synthase 3", "gene_name": "OAS3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q02556-1", "protein_name": "Interferon regulatory factor 8", "gene_name": "IRF8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96AZ6-1", "protein_name": "Interferon-stimulated gene 20 kDa protein", "gene_name": "ISG20", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14896-1", "protein_name": "Interferon regulatory factor 6", "gene_name": "IRF6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P30511-1", "protein_name": "HLA class I histocompatibility antigen, alpha chain F", "gene_name": "HLA-F", "tax_name": "Human" }, { "uniprot_canonical_ac": "P13747-1", "protein_name": "HLA class I histocompatibility antigen, alpha chain E", "gene_name": "HLA-E", "tax_name": "Human" }, { "uniprot_canonical_ac": "P17693-1", "protein_name": "HLA class I histocompatibility antigen, alpha chain G", "gene_name": "HLA-G", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01563-1", "protein_name": "Interferon alpha-2", "gene_name": "IFNA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01567-1", "protein_name": "Interferon alpha-7", "gene_name": "IFNA7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01568-1", "protein_name": "Interferon alpha-21", "gene_name": "IFNA21", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01569-1", "protein_name": "Interferon alpha-5", "gene_name": "IFNA5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01570-1", "protein_name": "Interferon alpha-14", "gene_name": "IFNA14", "tax_name": "Human" }, { "uniprot_canonical_ac": "P09914-1", "protein_name": "Antiviral innate immune response effector IFIT1", "gene_name": "IFIT1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P32881-1", "protein_name": "Interferon alpha-8", "gene_name": "IFNA8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UHH9-1", "protein_name": "Inositol hexakisphosphate kinase 2", "gene_name": "IP6K2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05013-1", "protein_name": "Interferon alpha-6", "gene_name": "IFNA6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P09913-1", "protein_name": "Interferon-induced protein with tetratricopeptide repeats 2", "gene_name": "IFIT2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8WXG1-1", "protein_name": "S-adenosylmethionine-dependent nucleotide dehydratase RSAD2", "gene_name": "RSAD2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P20592-1", "protein_name": "Interferon-induced GTP-binding protein Mx2", "gene_name": "MX2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P14316-1", "protein_name": "Interferon regulatory factor 2", "gene_name": "IRF2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P29350-1", "protein_name": "Tyrosine-protein phosphatase non-receptor type 6", "gene_name": "PTPN6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14653-1", "protein_name": "Interferon regulatory factor 3", "gene_name": "IRF3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P20591-1", "protein_name": "Interferon-induced GTP-binding protein Mx1", "gene_name": "MX1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13568-1", "protein_name": "Interferon regulatory factor 5", "gene_name": "IRF5", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14879-1", "protein_name": "Interferon-induced protein with tetratricopeptide repeats 3", "gene_name": "IFIT3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q05823-1", "protein_name": "2-5A-dependent ribonuclease", "gene_name": "RNASEL", "tax_name": "Human" }, { "uniprot_canonical_ac": "P10914-1", "protein_name": "Interferon regulatory factor 1", "gene_name": "IRF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6GPH4-1", "protein_name": "XIAP-associated factor 1", "gene_name": "XAF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P52630-3", "protein_name": "Signal transducer and activator of transcription 2", "gene_name": "STAT2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P09912-1", "protein_name": "Interferon alpha-inducible protein 6", "gene_name": "IFI6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P10321-1", "protein_name": "HLA class I histocompatibility antigen, C alpha chain", "gene_name": "HLA-C", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04439-1", "protein_name": "HLA class I histocompatibility antigen, A alpha chain", "gene_name": "HLA-A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92985-1", "protein_name": "Interferon regulatory factor 7", "gene_name": "IRF7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61221-1", "protein_name": "ATP-binding cassette sub-family E member 1", "gene_name": "ABCE1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P00973-1", "protein_name": "2'-5'-oligoadenylate synthase 1", "gene_name": "OAS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05014-1", "protein_name": "Interferon alpha-4", "gene_name": "IFNA4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q06124-2", "protein_name": "Tyrosine-protein phosphatase non-receptor type 11", "gene_name": "PTPN11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P29597-1", "protein_name": "Non-receptor tyrosine-protein kinase TYK2", "gene_name": "TYK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14543-1", "protein_name": "Suppressor of cytokine signaling 3", "gene_name": "SOCS3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DY56-1", "protein_name": "Interferon alpha-1", "gene_name": "IFNA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62979-1", "protein_name": "Ubiquitin-ribosomal protein eS31 fusion protein", "gene_name": "RPS27A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q10589-1", "protein_name": "Bone marrow stromal antigen 2", "gene_name": "BST2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15306-1", "protein_name": "Interferon regulatory factor 4", "gene_name": "IRF4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P55265-1", "protein_name": "Double-stranded RNA-specific adenosine deaminase", "gene_name": "ADAR", "tax_name": "Human" }, { "uniprot_canonical_ac": "P13164-1", "protein_name": "Interferon-induced transmembrane protein 1", "gene_name": "IFITM1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P40305-2", "protein_name": "Interferon alpha-inducible protein 27, mitochondrial", "gene_name": "IFI27", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01629-1", "protein_name": "Interferon-induced transmembrane protein 2", "gene_name": "IFITM2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01566-1", "protein_name": "Interferon alpha-10", "gene_name": "IFNA10", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01571-1", "protein_name": "Interferon alpha-17", "gene_name": "IFNA17", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01574-1", "protein_name": "Interferon beta", "gene_name": "IFNB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05015-1", "protein_name": "Interferon alpha-16", "gene_name": "IFNA16", "tax_name": "Human" }, { "uniprot_canonical_ac": "P28062-1", "protein_name": "Proteasome subunit beta type-8", "gene_name": "PSMB8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13325-1", "protein_name": "Interferon-induced protein with tetratricopeptide repeats 5", "gene_name": "IFIT5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P19525-1", "protein_name": "Interferon-induced, double-stranded RNA-activated protein kinase", "gene_name": "EIF2AK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG47-1", "protein_name": "Polyubiquitin-B", "gene_name": "UBB", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42224-1", "protein_name": "Signal transducer and activator of transcription 1-alpha/beta", "gene_name": "STAT1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P80217-1", "protein_name": "Interferon-induced 35 kDa protein", "gene_name": "IFI35", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62987-1", "protein_name": "Ubiquitin-ribosomal protein eL40 fusion protein", "gene_name": "UBA52", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01628-1", "protein_name": "Interferon-induced transmembrane protein 3", "gene_name": "IFITM3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y3Z3-1", "protein_name": "Deoxynucleoside triphosphate triphosphohydrolase SAMHD1", "gene_name": "SAMHD1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P32456-1", "protein_name": "Guanylate-binding protein 2", "gene_name": "GBP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q00978-1", "protein_name": "Interferon regulatory factor 9", "gene_name": "IRF9", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01893-1", "protein_name": "Putative HLA class I histocompatibility antigen, alpha chain H", "gene_name": "HLA-H", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05161-1", "protein_name": "Ubiquitin-like protein ISG15", "gene_name": "ISG15", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14974-1", "protein_name": "Importin subunit beta-1", "gene_name": "KPNB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P23458-1", "protein_name": "Tyrosine-protein kinase JAK1", "gene_name": "JAK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P17181-1", "protein_name": "Interferon alpha/beta receptor 1", "gene_name": "IFNAR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG48-1", "protein_name": "Polyubiquitin-C", "gene_name": "UBC", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01889-1", "protein_name": "HLA class I histocompatibility antigen, B alpha chain", "gene_name": "HLA-B", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P52294", "url": "https://www.uniprot.org/uniprotkb/P52294" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.9242679", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 74 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "A region of the beta subunit of the interferon alpha receptor different from box 1 interacts with Jak1 and is sufficient to activate the Jak-Stat pathway and induce an antiviral state.", "journal": "The Journal of biological chemistry", "date": "1997", "authors": "Domanski P, Fish E, Nadeau OW, Witte M, Platanias LC, Yan H, Krolewski J, Pitha P, Colamonici OR", "reference": { "type": "PubMed", "id": "9334213", "url": "https://pubmed.ncbi.nlm.nih.gov/9334213" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P52294-1", "protein_name": "Importin subunit alpha-5", "gene_name": "KPNA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P18146-1", "protein_name": "Early growth response protein 1", "gene_name": "EGR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15646-1", "protein_name": "2'-5'-oligoadenylate synthase-like protein", "gene_name": "OASL", "tax_name": "Human" }, { "uniprot_canonical_ac": "P29728-1", "protein_name": "2'-5'-oligoadenylate synthase 2", "gene_name": "OAS2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15524-1", "protein_name": "Suppressor of cytokine signaling 1", "gene_name": "SOCS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y6K5-1", "protein_name": "2'-5'-oligoadenylate synthase 3", "gene_name": "OAS3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q02556-1", "protein_name": "Interferon regulatory factor 8", "gene_name": "IRF8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96AZ6-1", "protein_name": "Interferon-stimulated gene 20 kDa protein", "gene_name": "ISG20", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14896-1", "protein_name": "Interferon regulatory factor 6", "gene_name": "IRF6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P30511-1", "protein_name": "HLA class I histocompatibility antigen, alpha chain F", "gene_name": "HLA-F", "tax_name": "Human" }, { "uniprot_canonical_ac": "P13747-1", "protein_name": "HLA class I histocompatibility antigen, alpha chain E", "gene_name": "HLA-E", "tax_name": "Human" }, { "uniprot_canonical_ac": "P17693-1", "protein_name": "HLA class I histocompatibility antigen, alpha chain G", "gene_name": "HLA-G", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01563-1", "protein_name": "Interferon alpha-2", "gene_name": "IFNA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01567-1", "protein_name": "Interferon alpha-7", "gene_name": "IFNA7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01568-1", "protein_name": "Interferon alpha-21", "gene_name": "IFNA21", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01569-1", "protein_name": "Interferon alpha-5", "gene_name": "IFNA5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01570-1", "protein_name": "Interferon alpha-14", "gene_name": "IFNA14", "tax_name": "Human" }, { "uniprot_canonical_ac": "P09914-1", "protein_name": "Antiviral innate immune response effector IFIT1", "gene_name": "IFIT1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P32881-1", "protein_name": "Interferon alpha-8", "gene_name": "IFNA8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UHH9-1", "protein_name": "Inositol hexakisphosphate kinase 2", "gene_name": "IP6K2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05013-1", "protein_name": "Interferon alpha-6", "gene_name": "IFNA6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P09913-1", "protein_name": "Interferon-induced protein with tetratricopeptide repeats 2", "gene_name": "IFIT2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8WXG1-1", "protein_name": "S-adenosylmethionine-dependent nucleotide dehydratase RSAD2", "gene_name": "RSAD2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P20592-1", "protein_name": "Interferon-induced GTP-binding protein Mx2", "gene_name": "MX2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P14316-1", "protein_name": "Interferon regulatory factor 2", "gene_name": "IRF2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P29350-1", "protein_name": "Tyrosine-protein phosphatase non-receptor type 6", "gene_name": "PTPN6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14653-1", "protein_name": "Interferon regulatory factor 3", "gene_name": "IRF3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P20591-1", "protein_name": "Interferon-induced GTP-binding protein Mx1", "gene_name": "MX1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13568-1", "protein_name": "Interferon regulatory factor 5", "gene_name": "IRF5", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14879-1", "protein_name": "Interferon-induced protein with tetratricopeptide repeats 3", "gene_name": "IFIT3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q05823-1", "protein_name": "2-5A-dependent ribonuclease", "gene_name": "RNASEL", "tax_name": "Human" }, { "uniprot_canonical_ac": "P10914-1", "protein_name": "Interferon regulatory factor 1", "gene_name": "IRF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6GPH4-1", "protein_name": "XIAP-associated factor 1", "gene_name": "XAF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P52630-3", "protein_name": "Signal transducer and activator of transcription 2", "gene_name": "STAT2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P09912-1", "protein_name": "Interferon alpha-inducible protein 6", "gene_name": "IFI6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P10321-1", "protein_name": "HLA class I histocompatibility antigen, C alpha chain", "gene_name": "HLA-C", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04439-1", "protein_name": "HLA class I histocompatibility antigen, A alpha chain", "gene_name": "HLA-A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92985-1", "protein_name": "Interferon regulatory factor 7", "gene_name": "IRF7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61221-1", "protein_name": "ATP-binding cassette sub-family E member 1", "gene_name": "ABCE1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P00973-1", "protein_name": "2'-5'-oligoadenylate synthase 1", "gene_name": "OAS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05014-1", "protein_name": "Interferon alpha-4", "gene_name": "IFNA4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q06124-2", "protein_name": "Tyrosine-protein phosphatase non-receptor type 11", "gene_name": "PTPN11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P29597-1", "protein_name": "Non-receptor tyrosine-protein kinase TYK2", "gene_name": "TYK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14543-1", "protein_name": "Suppressor of cytokine signaling 3", "gene_name": "SOCS3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DY56-1", "protein_name": "Interferon alpha-1", "gene_name": "IFNA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62979-1", "protein_name": "Ubiquitin-ribosomal protein eS31 fusion protein", "gene_name": "RPS27A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q10589-1", "protein_name": "Bone marrow stromal antigen 2", "gene_name": "BST2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15306-1", "protein_name": "Interferon regulatory factor 4", "gene_name": "IRF4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P55265-1", "protein_name": "Double-stranded RNA-specific adenosine deaminase", "gene_name": "ADAR", "tax_name": "Human" }, { "uniprot_canonical_ac": "P13164-1", "protein_name": "Interferon-induced transmembrane protein 1", "gene_name": "IFITM1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P40305-2", "protein_name": "Interferon alpha-inducible protein 27, mitochondrial", "gene_name": "IFI27", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01629-1", "protein_name": "Interferon-induced transmembrane protein 2", "gene_name": "IFITM2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01566-1", "protein_name": "Interferon alpha-10", "gene_name": "IFNA10", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01571-1", "protein_name": "Interferon alpha-17", "gene_name": "IFNA17", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01574-1", "protein_name": "Interferon beta", "gene_name": "IFNB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05015-1", "protein_name": "Interferon alpha-16", "gene_name": "IFNA16", "tax_name": "Human" }, { "uniprot_canonical_ac": "P28062-1", "protein_name": "Proteasome subunit beta type-8", "gene_name": "PSMB8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13325-1", "protein_name": "Interferon-induced protein with tetratricopeptide repeats 5", "gene_name": "IFIT5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P19525-1", "protein_name": "Interferon-induced, double-stranded RNA-activated protein kinase", "gene_name": "EIF2AK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG47-1", "protein_name": "Polyubiquitin-B", "gene_name": "UBB", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42224-1", "protein_name": "Signal transducer and activator of transcription 1-alpha/beta", "gene_name": "STAT1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P80217-1", "protein_name": "Interferon-induced 35 kDa protein", "gene_name": "IFI35", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62987-1", "protein_name": "Ubiquitin-ribosomal protein eL40 fusion protein", "gene_name": "UBA52", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01628-1", "protein_name": "Interferon-induced transmembrane protein 3", "gene_name": "IFITM3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y3Z3-1", "protein_name": "Deoxynucleoside triphosphate triphosphohydrolase SAMHD1", "gene_name": "SAMHD1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P32456-1", "protein_name": "Guanylate-binding protein 2", "gene_name": "GBP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q00978-1", "protein_name": "Interferon regulatory factor 9", "gene_name": "IRF9", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01893-1", "protein_name": "Putative HLA class I histocompatibility antigen, alpha chain H", "gene_name": "HLA-H", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05161-1", "protein_name": "Ubiquitin-like protein ISG15", "gene_name": "ISG15", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14974-1", "protein_name": "Importin subunit beta-1", "gene_name": "KPNB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P23458-1", "protein_name": "Tyrosine-protein kinase JAK1", "gene_name": "JAK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P17181-1", "protein_name": "Interferon alpha/beta receptor 1", "gene_name": "IFNAR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG48-1", "protein_name": "Polyubiquitin-C", "gene_name": "UBC", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01889-1", "protein_name": "HLA class I histocompatibility antigen, B alpha chain", "gene_name": "HLA-B", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P52294", "url": "https://www.uniprot.org/uniprotkb/P52294" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.9334213", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 74 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "HIV-1 Vpr interacts with the nuclear transport pathway to promote macrophage infection.", "journal": "Genes & development", "date": "1998", "authors": "Vodicka MA, Koepp DM, Silver PA, Emerman M", "reference": { "type": "PubMed", "id": "9436978", "url": "https://pubmed.ncbi.nlm.nih.gov/9436978" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P52294-1", "protein_name": "Importin subunit alpha-5", "gene_name": "KPNA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "A8CG34-1", "protein_name": "Nuclear envelope pore membrane protein POM 121C", "gene_name": "POM121C", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35658-1", "protein_name": "Nuclear pore complex protein Nup214", "gene_name": "NUP214", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92621-1", "protein_name": "Nuclear pore complex protein Nup205", "gene_name": "NUP205", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5SRE5-1", "protein_name": "Nucleoporin NUP188", "gene_name": "NUP188", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BW27-1", "protein_name": "Nuclear pore complex protein Nup85", "gene_name": "NUP85", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15504-1", "protein_name": "Nucleoporin NUP42", "gene_name": "NUP42", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UKX7-1", "protein_name": "Nuclear pore complex protein Nup50", "gene_name": "NUP50", "tax_name": "Human" }, { "uniprot_canonical_ac": "P57740-1", "protein_name": "Nuclear pore complex protein Nup107", "gene_name": "NUP107", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8WUM0-1", "protein_name": "Nuclear pore complex protein Nup133", "gene_name": "NUP133", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BTX1-1", "protein_name": "Nucleoporin NDC1", "gene_name": "NDC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NFH3-1", "protein_name": "Nucleoporin Nup43", "gene_name": "NUP43", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TEM1-1", "protein_name": "Nuclear pore membrane glycoprotein 210", "gene_name": "NUP210", "tax_name": "Human" }, { "uniprot_canonical_ac": "P55735-1", "protein_name": "Protein SEC13 homolog", "gene_name": "SEC13", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75694-1", "protein_name": "Nuclear pore complex protein Nup155", "gene_name": "NUP155", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NFH5-1", "protein_name": "Nucleoporin NUP35", "gene_name": "NUP35", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96HA1-1", "protein_name": "Nuclear envelope pore membrane protein POM 121", "gene_name": "POM121", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75475-1", "protein_name": "PC4 and SFRS1-interacting protein", "gene_name": "PSIP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49790-1", "protein_name": "Nuclear pore complex protein Nup153", "gene_name": "NUP153", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12769-1", "protein_name": "Nuclear pore complex protein Nup160", "gene_name": "NUP160", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49792-1", "protein_name": "E3 SUMO-protein ligase RanBP2", "gene_name": "RANBP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99567-1", "protein_name": "Nuclear pore complex protein Nup88", "gene_name": "NUP88", "tax_name": "Human" }, { "uniprot_canonical_ac": "P78406-1", "protein_name": "mRNA export factor RAE1", "gene_name": "RAE1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NFH4-1", "protein_name": "Nucleoporin Nup37", "gene_name": "NUP37", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N1F7-1", "protein_name": "Nuclear pore complex protein Nup93", "gene_name": "NUP93", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75531-1", "protein_name": "Barrier-to-autointegration factor", "gene_name": "BANF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q7Z3B4-1", "protein_name": "Nucleoporin p54", "gene_name": "NUP54", "tax_name": "Human" }, { "uniprot_canonical_ac": "P17096-1", "protein_name": "High mobility group protein HMG-I/HMG-Y", "gene_name": "HMGA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P12270-1", "protein_name": "Nucleoprotein TPR", "gene_name": "TPR", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NRG9-1", "protein_name": "Aladin", "gene_name": "AAAS", "tax_name": "Human" }, { "uniprot_canonical_ac": "P37198-1", "protein_name": "Nuclear pore glycoprotein p62", "gene_name": "NUP62", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P52294", "url": "https://www.uniprot.org/uniprotkb/P52294" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.9436978", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 31 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Viral protein R regulates nuclear import of the HIV-1 pre-integration complex.", "journal": "EMBO J.", "date": "1998", "authors": "Popov S, Rexach M, Zybarth G, Reiling N, Lee M A, Ratner L, Lane C M, Moore M S, Blobel G, Bukrinsky M", "reference": { "type": "PubMed", "id": "9463369", "url": "https://pubmed.ncbi.nlm.nih.gov/9463369" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P52294-1", "protein_name": "Importin subunit alpha-5", "gene_name": "KPNA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P52292-1", "protein_name": "Importin subunit alpha-1", "gene_name": "KPNA2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P52294", "url": "https://www.uniprot.org/uniprotkb/P52294" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.9463369", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Viral protein R regulates docking of the HIV-1 preintegration complex to the nuclear pore complex.", "journal": "The Journal of biological chemistry", "date": "1998", "authors": "Popov S, Rexach M, Ratner L, Blobel G, Bukrinsky M", "reference": { "type": "PubMed", "id": "9582382", "url": "https://pubmed.ncbi.nlm.nih.gov/9582382" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P52294-1", "protein_name": "Importin subunit alpha-5", "gene_name": "KPNA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "A8CG34-1", "protein_name": "Nuclear envelope pore membrane protein POM 121C", "gene_name": "POM121C", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35658-1", "protein_name": "Nuclear pore complex protein Nup214", "gene_name": "NUP214", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92621-1", "protein_name": "Nuclear pore complex protein Nup205", "gene_name": "NUP205", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5SRE5-1", "protein_name": "Nucleoporin NUP188", "gene_name": "NUP188", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BW27-1", "protein_name": "Nuclear pore complex protein Nup85", "gene_name": "NUP85", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15504-1", "protein_name": "Nucleoporin NUP42", "gene_name": "NUP42", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UKX7-1", "protein_name": "Nuclear pore complex protein Nup50", "gene_name": "NUP50", "tax_name": "Human" }, { "uniprot_canonical_ac": "P57740-1", "protein_name": "Nuclear pore complex protein Nup107", "gene_name": "NUP107", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8WUM0-1", "protein_name": "Nuclear pore complex protein Nup133", "gene_name": "NUP133", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BTX1-1", "protein_name": "Nucleoporin NDC1", "gene_name": "NDC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NFH3-1", "protein_name": "Nucleoporin Nup43", "gene_name": "NUP43", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TEM1-1", "protein_name": "Nuclear pore membrane glycoprotein 210", "gene_name": "NUP210", "tax_name": "Human" }, { "uniprot_canonical_ac": "P55735-1", "protein_name": "Protein SEC13 homolog", "gene_name": "SEC13", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75694-1", "protein_name": "Nuclear pore complex protein Nup155", "gene_name": "NUP155", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NFH5-1", "protein_name": "Nucleoporin NUP35", "gene_name": "NUP35", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96HA1-1", "protein_name": "Nuclear envelope pore membrane protein POM 121", "gene_name": "POM121", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75475-1", "protein_name": "PC4 and SFRS1-interacting protein", "gene_name": "PSIP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49790-1", "protein_name": "Nuclear pore complex protein Nup153", "gene_name": "NUP153", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12769-1", "protein_name": "Nuclear pore complex protein Nup160", "gene_name": "NUP160", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49792-1", "protein_name": "E3 SUMO-protein ligase RanBP2", "gene_name": "RANBP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99567-1", "protein_name": "Nuclear pore complex protein Nup88", "gene_name": "NUP88", "tax_name": "Human" }, { "uniprot_canonical_ac": "P78406-1", "protein_name": "mRNA export factor RAE1", "gene_name": "RAE1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NFH4-1", "protein_name": "Nucleoporin Nup37", "gene_name": "NUP37", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N1F7-1", "protein_name": "Nuclear pore complex protein Nup93", "gene_name": "NUP93", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75531-1", "protein_name": "Barrier-to-autointegration factor", "gene_name": "BANF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q7Z3B4-1", "protein_name": "Nucleoporin p54", "gene_name": "NUP54", "tax_name": "Human" }, { "uniprot_canonical_ac": "P17096-1", "protein_name": "High mobility group protein HMG-I/HMG-Y", "gene_name": "HMGA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P12270-1", "protein_name": "Nucleoprotein TPR", "gene_name": "TPR", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NRG9-1", "protein_name": "Aladin", "gene_name": "AAAS", "tax_name": "Human" }, { "uniprot_canonical_ac": "P37198-1", "protein_name": "Nuclear pore glycoprotein p62", "gene_name": "NUP62", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P52294", "url": "https://www.uniprot.org/uniprotkb/P52294" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.9582382", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 31 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "RNase L inhibitor (RLI) antisense constructions block partially the down regulation of the 2-5A/RNase L pathway in encephalomyocarditis-virus-(EMCV)-infected cells.", "journal": "European journal of biochemistry", "date": "1998", "authors": "Martinand C, Salehzada T, Silhol M, Lebleu B, Bisbal C", "reference": { "type": "PubMed", "id": "9660177", "url": "https://pubmed.ncbi.nlm.nih.gov/9660177" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P52294-1", "protein_name": "Importin subunit alpha-5", "gene_name": "KPNA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P18146-1", "protein_name": "Early growth response protein 1", "gene_name": "EGR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15646-1", "protein_name": "2'-5'-oligoadenylate synthase-like protein", "gene_name": "OASL", "tax_name": "Human" }, { "uniprot_canonical_ac": "P29728-1", "protein_name": "2'-5'-oligoadenylate synthase 2", "gene_name": "OAS2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15524-1", "protein_name": "Suppressor of cytokine signaling 1", "gene_name": "SOCS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y6K5-1", "protein_name": "2'-5'-oligoadenylate synthase 3", "gene_name": "OAS3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q02556-1", "protein_name": "Interferon regulatory factor 8", "gene_name": "IRF8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96AZ6-1", "protein_name": "Interferon-stimulated gene 20 kDa protein", "gene_name": "ISG20", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14896-1", "protein_name": "Interferon regulatory factor 6", "gene_name": "IRF6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P30511-1", "protein_name": "HLA class I histocompatibility antigen, alpha chain F", "gene_name": "HLA-F", "tax_name": "Human" }, { "uniprot_canonical_ac": "P13747-1", "protein_name": "HLA class I histocompatibility antigen, alpha chain E", "gene_name": "HLA-E", "tax_name": "Human" }, { "uniprot_canonical_ac": "P17693-1", "protein_name": "HLA class I histocompatibility antigen, alpha chain G", "gene_name": "HLA-G", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01563-1", "protein_name": "Interferon alpha-2", "gene_name": "IFNA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01567-1", "protein_name": "Interferon alpha-7", "gene_name": "IFNA7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01568-1", "protein_name": "Interferon alpha-21", "gene_name": "IFNA21", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01569-1", "protein_name": "Interferon alpha-5", "gene_name": "IFNA5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01570-1", "protein_name": "Interferon alpha-14", "gene_name": "IFNA14", "tax_name": "Human" }, { "uniprot_canonical_ac": "P09914-1", "protein_name": "Antiviral innate immune response effector IFIT1", "gene_name": "IFIT1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P32881-1", "protein_name": "Interferon alpha-8", "gene_name": "IFNA8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UHH9-1", "protein_name": "Inositol hexakisphosphate kinase 2", "gene_name": "IP6K2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05013-1", "protein_name": "Interferon alpha-6", "gene_name": "IFNA6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P09913-1", "protein_name": "Interferon-induced protein with tetratricopeptide repeats 2", "gene_name": "IFIT2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8WXG1-1", "protein_name": "S-adenosylmethionine-dependent nucleotide dehydratase RSAD2", "gene_name": "RSAD2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P20592-1", "protein_name": "Interferon-induced GTP-binding protein Mx2", "gene_name": "MX2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P14316-1", "protein_name": "Interferon regulatory factor 2", "gene_name": "IRF2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P29350-1", "protein_name": "Tyrosine-protein phosphatase non-receptor type 6", "gene_name": "PTPN6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14653-1", "protein_name": "Interferon regulatory factor 3", "gene_name": "IRF3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P20591-1", "protein_name": "Interferon-induced GTP-binding protein Mx1", "gene_name": "MX1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13568-1", "protein_name": "Interferon regulatory factor 5", "gene_name": "IRF5", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14879-1", "protein_name": "Interferon-induced protein with tetratricopeptide repeats 3", "gene_name": "IFIT3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q05823-1", "protein_name": "2-5A-dependent ribonuclease", "gene_name": "RNASEL", "tax_name": "Human" }, { "uniprot_canonical_ac": "P10914-1", "protein_name": "Interferon regulatory factor 1", "gene_name": "IRF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6GPH4-1", "protein_name": "XIAP-associated factor 1", "gene_name": "XAF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P52630-3", "protein_name": "Signal transducer and activator of transcription 2", "gene_name": "STAT2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P09912-1", "protein_name": "Interferon alpha-inducible protein 6", "gene_name": "IFI6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P10321-1", "protein_name": "HLA class I histocompatibility antigen, C alpha chain", "gene_name": "HLA-C", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04439-1", "protein_name": "HLA class I histocompatibility antigen, A alpha chain", "gene_name": "HLA-A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92985-1", "protein_name": "Interferon regulatory factor 7", "gene_name": "IRF7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61221-1", "protein_name": "ATP-binding cassette sub-family E member 1", "gene_name": "ABCE1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P00973-1", "protein_name": "2'-5'-oligoadenylate synthase 1", "gene_name": "OAS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05014-1", "protein_name": "Interferon alpha-4", "gene_name": "IFNA4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q06124-2", "protein_name": "Tyrosine-protein phosphatase non-receptor type 11", "gene_name": "PTPN11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P29597-1", "protein_name": "Non-receptor tyrosine-protein kinase TYK2", "gene_name": "TYK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14543-1", "protein_name": "Suppressor of cytokine signaling 3", "gene_name": "SOCS3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DY56-1", "protein_name": "Interferon alpha-1", "gene_name": "IFNA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62979-1", "protein_name": "Ubiquitin-ribosomal protein eS31 fusion protein", "gene_name": "RPS27A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q10589-1", "protein_name": "Bone marrow stromal antigen 2", "gene_name": "BST2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15306-1", "protein_name": "Interferon regulatory factor 4", "gene_name": "IRF4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P55265-1", "protein_name": "Double-stranded RNA-specific adenosine deaminase", "gene_name": "ADAR", "tax_name": "Human" }, { "uniprot_canonical_ac": "P13164-1", "protein_name": "Interferon-induced transmembrane protein 1", "gene_name": "IFITM1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P40305-2", "protein_name": "Interferon alpha-inducible protein 27, mitochondrial", "gene_name": "IFI27", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01629-1", "protein_name": "Interferon-induced transmembrane protein 2", "gene_name": "IFITM2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01566-1", "protein_name": "Interferon alpha-10", "gene_name": "IFNA10", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01571-1", "protein_name": "Interferon alpha-17", "gene_name": "IFNA17", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01574-1", "protein_name": "Interferon beta", "gene_name": "IFNB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05015-1", "protein_name": "Interferon alpha-16", "gene_name": "IFNA16", "tax_name": "Human" }, { "uniprot_canonical_ac": "P28062-1", "protein_name": "Proteasome subunit beta type-8", "gene_name": "PSMB8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13325-1", "protein_name": "Interferon-induced protein with tetratricopeptide repeats 5", "gene_name": "IFIT5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P19525-1", "protein_name": "Interferon-induced, double-stranded RNA-activated protein kinase", "gene_name": "EIF2AK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG47-1", "protein_name": "Polyubiquitin-B", "gene_name": "UBB", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42224-1", "protein_name": "Signal transducer and activator of transcription 1-alpha/beta", "gene_name": "STAT1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P80217-1", "protein_name": "Interferon-induced 35 kDa protein", "gene_name": "IFI35", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62987-1", "protein_name": "Ubiquitin-ribosomal protein eL40 fusion protein", "gene_name": "UBA52", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01628-1", "protein_name": "Interferon-induced transmembrane protein 3", "gene_name": "IFITM3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y3Z3-1", "protein_name": "Deoxynucleoside triphosphate triphosphohydrolase SAMHD1", "gene_name": "SAMHD1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P32456-1", "protein_name": "Guanylate-binding protein 2", "gene_name": "GBP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q00978-1", "protein_name": "Interferon regulatory factor 9", "gene_name": "IRF9", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01893-1", "protein_name": "Putative HLA class I histocompatibility antigen, alpha chain H", "gene_name": "HLA-H", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05161-1", "protein_name": "Ubiquitin-like protein ISG15", "gene_name": "ISG15", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14974-1", "protein_name": "Importin subunit beta-1", "gene_name": "KPNB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P23458-1", "protein_name": "Tyrosine-protein kinase JAK1", "gene_name": "JAK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P17181-1", "protein_name": "Interferon alpha/beta receptor 1", "gene_name": "IFNAR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG48-1", "protein_name": "Polyubiquitin-C", "gene_name": "UBC", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01889-1", "protein_name": "HLA class I histocompatibility antigen, B alpha chain", "gene_name": "HLA-B", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P52294", "url": "https://www.uniprot.org/uniprotkb/P52294" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.9660177", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 74 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "RNase L inhibitor is induced during human immunodeficiency virus type 1 infection and down regulates the 2-5A/RNase L pathway in human T cells.", "journal": "Journal of virology", "date": "1999", "authors": "Martinand C, Montavon C, Salehzada T, Silhol M, Lebleu B, Bisbal C", "reference": { "type": "PubMed", "id": "9847332", "url": "https://pubmed.ncbi.nlm.nih.gov/9847332" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P52294-1", "protein_name": "Importin subunit alpha-5", "gene_name": "KPNA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P18146-1", "protein_name": "Early growth response protein 1", "gene_name": "EGR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15646-1", "protein_name": "2'-5'-oligoadenylate synthase-like protein", "gene_name": "OASL", "tax_name": "Human" }, { "uniprot_canonical_ac": "P29728-1", "protein_name": "2'-5'-oligoadenylate synthase 2", "gene_name": "OAS2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15524-1", "protein_name": "Suppressor of cytokine signaling 1", "gene_name": "SOCS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y6K5-1", "protein_name": "2'-5'-oligoadenylate synthase 3", "gene_name": "OAS3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q02556-1", "protein_name": "Interferon regulatory factor 8", "gene_name": "IRF8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96AZ6-1", "protein_name": "Interferon-stimulated gene 20 kDa protein", "gene_name": "ISG20", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14896-1", "protein_name": "Interferon regulatory factor 6", "gene_name": "IRF6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P30511-1", "protein_name": "HLA class I histocompatibility antigen, alpha chain F", "gene_name": "HLA-F", "tax_name": "Human" }, { "uniprot_canonical_ac": "P13747-1", "protein_name": "HLA class I histocompatibility antigen, alpha chain E", "gene_name": "HLA-E", "tax_name": "Human" }, { "uniprot_canonical_ac": "P17693-1", "protein_name": "HLA class I histocompatibility antigen, alpha chain G", "gene_name": "HLA-G", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01563-1", "protein_name": "Interferon alpha-2", "gene_name": "IFNA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01567-1", "protein_name": "Interferon alpha-7", "gene_name": "IFNA7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01568-1", "protein_name": "Interferon alpha-21", "gene_name": "IFNA21", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01569-1", "protein_name": "Interferon alpha-5", "gene_name": "IFNA5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01570-1", "protein_name": "Interferon alpha-14", "gene_name": "IFNA14", "tax_name": "Human" }, { "uniprot_canonical_ac": "P09914-1", "protein_name": "Antiviral innate immune response effector IFIT1", "gene_name": "IFIT1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P32881-1", "protein_name": "Interferon alpha-8", "gene_name": "IFNA8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UHH9-1", "protein_name": "Inositol hexakisphosphate kinase 2", "gene_name": "IP6K2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05013-1", "protein_name": "Interferon alpha-6", "gene_name": "IFNA6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P09913-1", "protein_name": "Interferon-induced protein with tetratricopeptide repeats 2", "gene_name": "IFIT2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8WXG1-1", "protein_name": "S-adenosylmethionine-dependent nucleotide dehydratase RSAD2", "gene_name": "RSAD2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P20592-1", "protein_name": "Interferon-induced GTP-binding protein Mx2", "gene_name": "MX2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P14316-1", "protein_name": "Interferon regulatory factor 2", "gene_name": "IRF2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P29350-1", "protein_name": "Tyrosine-protein phosphatase non-receptor type 6", "gene_name": "PTPN6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14653-1", "protein_name": "Interferon regulatory factor 3", "gene_name": "IRF3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P20591-1", "protein_name": "Interferon-induced GTP-binding protein Mx1", "gene_name": "MX1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13568-1", "protein_name": "Interferon regulatory factor 5", "gene_name": "IRF5", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14879-1", "protein_name": "Interferon-induced protein with tetratricopeptide repeats 3", "gene_name": "IFIT3", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95786-1", "protein_name": "Antiviral innate immune response receptor RIG-I", "gene_name": "DDX58; RIGI", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q05823-1", "protein_name": "2-5A-dependent ribonuclease", "gene_name": "RNASEL", "tax_name": "Human" }, { "uniprot_canonical_ac": "P10914-1", "protein_name": "Interferon regulatory factor 1", "gene_name": "IRF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6GPH4-1", "protein_name": "XIAP-associated factor 1", "gene_name": "XAF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P52630-3", "protein_name": "Signal transducer and activator of transcription 2", "gene_name": "STAT2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P09912-1", "protein_name": "Interferon alpha-inducible protein 6", "gene_name": "IFI6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P10321-1", "protein_name": "HLA class I histocompatibility antigen, C alpha chain", "gene_name": "HLA-C", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04439-1", "protein_name": "HLA class I histocompatibility antigen, A alpha chain", "gene_name": "HLA-A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92985-1", "protein_name": "Interferon regulatory factor 7", "gene_name": "IRF7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61221-1", "protein_name": "ATP-binding cassette sub-family E member 1", "gene_name": "ABCE1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P00973-1", "protein_name": "2'-5'-oligoadenylate synthase 1", "gene_name": "OAS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05014-1", "protein_name": "Interferon alpha-4", "gene_name": "IFNA4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q06124-2", "protein_name": "Tyrosine-protein phosphatase non-receptor type 11", "gene_name": "PTPN11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P29597-1", "protein_name": "Non-receptor tyrosine-protein kinase TYK2", "gene_name": "TYK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14543-1", "protein_name": "Suppressor of cytokine signaling 3", "gene_name": "SOCS3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DY56-1", "protein_name": "Interferon alpha-1", "gene_name": "IFNA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62979-1", "protein_name": "Ubiquitin-ribosomal protein eS31 fusion protein", "gene_name": "RPS27A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q10589-1", "protein_name": "Bone marrow stromal antigen 2", "gene_name": "BST2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15306-1", "protein_name": "Interferon regulatory factor 4", "gene_name": "IRF4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P55265-1", "protein_name": "Double-stranded RNA-specific adenosine deaminase", "gene_name": "ADAR", "tax_name": "Human" }, { "uniprot_canonical_ac": "P13164-1", "protein_name": "Interferon-induced transmembrane protein 1", "gene_name": "IFITM1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P40305-2", "protein_name": "Interferon alpha-inducible protein 27, mitochondrial", "gene_name": "IFI27", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01629-1", "protein_name": "Interferon-induced transmembrane protein 2", "gene_name": "IFITM2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01566-1", "protein_name": "Interferon alpha-10", "gene_name": "IFNA10", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01571-1", "protein_name": "Interferon alpha-17", "gene_name": "IFNA17", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01574-1", "protein_name": "Interferon beta", "gene_name": "IFNB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05015-1", "protein_name": "Interferon alpha-16", "gene_name": "IFNA16", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6L8Q7-1", "protein_name": "2',5'-phosphodiesterase 12", "gene_name": "PDE12", "tax_name": "Human" }, { "uniprot_canonical_ac": "P28062-1", "protein_name": "Proteasome subunit beta type-8", "gene_name": "PSMB8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13325-1", "protein_name": "Interferon-induced protein with tetratricopeptide repeats 5", "gene_name": "IFIT5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P19525-1", "protein_name": "Interferon-induced, double-stranded RNA-activated protein kinase", "gene_name": "EIF2AK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P21333-1", "protein_name": "Filamin-A", "gene_name": "FLNA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG47-1", "protein_name": "Polyubiquitin-B", "gene_name": "UBB", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42224-1", "protein_name": "Signal transducer and activator of transcription 1-alpha/beta", "gene_name": "STAT1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P80217-1", "protein_name": "Interferon-induced 35 kDa protein", "gene_name": "IFI35", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62987-1", "protein_name": "Ubiquitin-ribosomal protein eL40 fusion protein", "gene_name": "UBA52", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01628-1", "protein_name": "Interferon-induced transmembrane protein 3", "gene_name": "IFITM3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y3Z3-1", "protein_name": "Deoxynucleoside triphosphate triphosphohydrolase SAMHD1", "gene_name": "SAMHD1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P32456-1", "protein_name": "Guanylate-binding protein 2", "gene_name": "GBP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q00978-1", "protein_name": "Interferon regulatory factor 9", "gene_name": "IRF9", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01893-1", "protein_name": "Putative HLA class I histocompatibility antigen, alpha chain H", "gene_name": "HLA-H", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05161-1", "protein_name": "Ubiquitin-like protein ISG15", "gene_name": "ISG15", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14974-1", "protein_name": "Importin subunit beta-1", "gene_name": "KPNB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P23458-1", "protein_name": "Tyrosine-protein kinase JAK1", "gene_name": "JAK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P17181-1", "protein_name": "Interferon alpha/beta receptor 1", "gene_name": "IFNAR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG48-1", "protein_name": "Polyubiquitin-C", "gene_name": "UBC", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01889-1", "protein_name": "HLA class I histocompatibility antigen, B alpha chain", "gene_name": "HLA-B", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P52294", "url": "https://www.uniprot.org/uniprotkb/P52294" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.9847332", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 77 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The barrier-to-autointegration protein is a host factor for HIV type 1 integration.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1998", "authors": "Chen H, Engelman A", "reference": { "type": "PubMed", "id": "9860958", "url": "https://pubmed.ncbi.nlm.nih.gov/9860958" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P52294-1", "protein_name": "Importin subunit alpha-5", "gene_name": "KPNA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62937-1", "protein_name": "Peptidyl-prolyl cis-trans isomerase A", "gene_name": "PPIA", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75475-1", "protein_name": "PC4 and SFRS1-interacting protein", "gene_name": "PSIP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75531-1", "protein_name": "Barrier-to-autointegration factor", "gene_name": "BANF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P17096-1", "protein_name": "High mobility group protein HMG-I/HMG-Y", "gene_name": "HMGA1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P52294", "url": "https://www.uniprot.org/uniprotkb/P52294" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.9860958", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 5 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Identification of genes differentially regulated by interferon alpha, beta, or gamma using oligonucleotide arrays.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1998", "authors": "Der SD, Zhou A, Williams BR, Silverman RH", "reference": { "type": "PubMed", "id": "9861020", "url": "https://pubmed.ncbi.nlm.nih.gov/9861020" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P52294-1", "protein_name": "Importin subunit alpha-5", "gene_name": "KPNA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P18146-1", "protein_name": "Early growth response protein 1", "gene_name": "EGR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15646-1", "protein_name": "2'-5'-oligoadenylate synthase-like protein", "gene_name": "OASL", "tax_name": "Human" }, { "uniprot_canonical_ac": "P29728-1", "protein_name": "2'-5'-oligoadenylate synthase 2", "gene_name": "OAS2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15524-1", "protein_name": "Suppressor of cytokine signaling 1", "gene_name": "SOCS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y6K5-1", "protein_name": "2'-5'-oligoadenylate synthase 3", "gene_name": "OAS3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q02556-1", "protein_name": "Interferon regulatory factor 8", "gene_name": "IRF8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96AZ6-1", "protein_name": "Interferon-stimulated gene 20 kDa protein", "gene_name": "ISG20", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14896-1", "protein_name": "Interferon regulatory factor 6", "gene_name": "IRF6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P30511-1", "protein_name": "HLA class I histocompatibility antigen, alpha chain F", "gene_name": "HLA-F", "tax_name": "Human" }, { "uniprot_canonical_ac": "P13747-1", "protein_name": "HLA class I histocompatibility antigen, alpha chain E", "gene_name": "HLA-E", "tax_name": "Human" }, { "uniprot_canonical_ac": "P17693-1", "protein_name": "HLA class I histocompatibility antigen, alpha chain G", "gene_name": "HLA-G", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01563-1", "protein_name": "Interferon alpha-2", "gene_name": "IFNA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01567-1", "protein_name": "Interferon alpha-7", "gene_name": "IFNA7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01568-1", "protein_name": "Interferon alpha-21", "gene_name": "IFNA21", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01569-1", "protein_name": "Interferon alpha-5", "gene_name": "IFNA5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01570-1", "protein_name": "Interferon alpha-14", "gene_name": "IFNA14", "tax_name": "Human" }, { "uniprot_canonical_ac": "P09914-1", "protein_name": "Antiviral innate immune response effector IFIT1", "gene_name": "IFIT1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P32881-1", "protein_name": "Interferon alpha-8", "gene_name": "IFNA8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UHH9-1", "protein_name": "Inositol hexakisphosphate kinase 2", "gene_name": "IP6K2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05013-1", "protein_name": "Interferon alpha-6", "gene_name": "IFNA6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P09913-1", "protein_name": "Interferon-induced protein with tetratricopeptide repeats 2", "gene_name": "IFIT2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8WXG1-1", "protein_name": "S-adenosylmethionine-dependent nucleotide dehydratase RSAD2", "gene_name": "RSAD2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P20592-1", "protein_name": "Interferon-induced GTP-binding protein Mx2", "gene_name": "MX2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P14316-1", "protein_name": "Interferon regulatory factor 2", "gene_name": "IRF2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P29350-1", "protein_name": "Tyrosine-protein phosphatase non-receptor type 6", "gene_name": "PTPN6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14653-1", "protein_name": "Interferon regulatory factor 3", "gene_name": "IRF3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P20591-1", "protein_name": "Interferon-induced GTP-binding protein Mx1", "gene_name": "MX1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13568-1", "protein_name": "Interferon regulatory factor 5", "gene_name": "IRF5", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14879-1", "protein_name": "Interferon-induced protein with tetratricopeptide repeats 3", "gene_name": "IFIT3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q05823-1", "protein_name": "2-5A-dependent ribonuclease", "gene_name": "RNASEL", "tax_name": "Human" }, { "uniprot_canonical_ac": "P10914-1", "protein_name": "Interferon regulatory factor 1", "gene_name": "IRF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6GPH4-1", "protein_name": "XIAP-associated factor 1", "gene_name": "XAF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P52630-3", "protein_name": "Signal transducer and activator of transcription 2", "gene_name": "STAT2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P09912-1", "protein_name": "Interferon alpha-inducible protein 6", "gene_name": "IFI6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P10321-1", "protein_name": "HLA class I histocompatibility antigen, C alpha chain", "gene_name": "HLA-C", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04439-1", "protein_name": "HLA class I histocompatibility antigen, A alpha chain", "gene_name": "HLA-A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92985-1", "protein_name": "Interferon regulatory factor 7", "gene_name": "IRF7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61221-1", "protein_name": "ATP-binding cassette sub-family E member 1", "gene_name": "ABCE1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P00973-1", "protein_name": "2'-5'-oligoadenylate synthase 1", "gene_name": "OAS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05014-1", "protein_name": "Interferon alpha-4", "gene_name": "IFNA4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q06124-2", "protein_name": "Tyrosine-protein phosphatase non-receptor type 11", "gene_name": "PTPN11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P29597-1", "protein_name": "Non-receptor tyrosine-protein kinase TYK2", "gene_name": "TYK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14543-1", "protein_name": "Suppressor of cytokine signaling 3", "gene_name": "SOCS3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DY56-1", "protein_name": "Interferon alpha-1", "gene_name": "IFNA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62979-1", "protein_name": "Ubiquitin-ribosomal protein eS31 fusion protein", "gene_name": "RPS27A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q10589-1", "protein_name": "Bone marrow stromal antigen 2", "gene_name": "BST2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15306-1", "protein_name": "Interferon regulatory factor 4", "gene_name": "IRF4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P55265-1", "protein_name": "Double-stranded RNA-specific adenosine deaminase", "gene_name": "ADAR", "tax_name": "Human" }, { "uniprot_canonical_ac": "P13164-1", "protein_name": "Interferon-induced transmembrane protein 1", "gene_name": "IFITM1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P40305-2", "protein_name": "Interferon alpha-inducible protein 27, mitochondrial", "gene_name": "IFI27", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01629-1", "protein_name": "Interferon-induced transmembrane protein 2", "gene_name": "IFITM2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01566-1", "protein_name": "Interferon alpha-10", "gene_name": "IFNA10", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01571-1", "protein_name": "Interferon alpha-17", "gene_name": "IFNA17", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01574-1", "protein_name": "Interferon beta", "gene_name": "IFNB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05015-1", "protein_name": "Interferon alpha-16", "gene_name": "IFNA16", "tax_name": "Human" }, { "uniprot_canonical_ac": "P28062-1", "protein_name": "Proteasome subunit beta type-8", "gene_name": "PSMB8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13325-1", "protein_name": "Interferon-induced protein with tetratricopeptide repeats 5", "gene_name": "IFIT5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P19525-1", "protein_name": "Interferon-induced, double-stranded RNA-activated protein kinase", "gene_name": "EIF2AK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG47-1", "protein_name": "Polyubiquitin-B", "gene_name": "UBB", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42224-1", "protein_name": "Signal transducer and activator of transcription 1-alpha/beta", "gene_name": "STAT1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P80217-1", "protein_name": "Interferon-induced 35 kDa protein", "gene_name": "IFI35", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62987-1", "protein_name": "Ubiquitin-ribosomal protein eL40 fusion protein", "gene_name": "UBA52", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01628-1", "protein_name": "Interferon-induced transmembrane protein 3", "gene_name": "IFITM3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y3Z3-1", "protein_name": "Deoxynucleoside triphosphate triphosphohydrolase SAMHD1", "gene_name": "SAMHD1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P32456-1", "protein_name": "Guanylate-binding protein 2", "gene_name": "GBP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q00978-1", "protein_name": "Interferon regulatory factor 9", "gene_name": "IRF9", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01893-1", "protein_name": "Putative HLA class I histocompatibility antigen, alpha chain H", "gene_name": "HLA-H", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05161-1", "protein_name": "Ubiquitin-like protein ISG15", "gene_name": "ISG15", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14974-1", "protein_name": "Importin subunit beta-1", "gene_name": "KPNB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P23458-1", "protein_name": "Tyrosine-protein kinase JAK1", "gene_name": "JAK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P17181-1", "protein_name": "Interferon alpha/beta receptor 1", "gene_name": "IFNAR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG48-1", "protein_name": "Polyubiquitin-C", "gene_name": "UBC", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01889-1", "protein_name": "HLA class I histocompatibility antigen, B alpha chain", "gene_name": "HLA-B", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P52294", "url": "https://www.uniprot.org/uniprotkb/P52294" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.9861020", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 74 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Cleavage of the death domain kinase RIP by caspase-8 prompts TNF-induced apoptosis.", "journal": "Genes & development", "date": "1999", "authors": "Lin Y, Devin A, Rodriguez Y, Liu ZG", "reference": { "type": "PubMed", "id": "10521396", "url": "https://pubmed.ncbi.nlm.nih.gov/10521396" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q14164-1", "protein_name": "Inhibitor of nuclear factor kappa-B kinase subunit epsilon", "gene_name": "IKBKE", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UHD2-1", "protein_name": "Serine/threonine-protein kinase TBK1", "gene_name": "TBK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15111-1", "protein_name": "Inhibitor of nuclear factor kappa-B kinase subunit alpha", "gene_name": "CHUK", "tax_name": "Human" }, { "uniprot_canonical_ac": "P98170-1", "protein_name": "E3 ubiquitin-protein ligase XIAP", "gene_name": "XIAP", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13546-1", "protein_name": "Receptor-interacting serine/threonine-protein kinase 1", "gene_name": "RIPK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75385-1", "protein_name": "Serine/threonine-protein kinase ULK1", "gene_name": "ULK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P21580-1", "protein_name": "Tumor necrosis factor alpha-induced protein 3", "gene_name": "TNFAIP3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68036-1", "protein_name": "Ubiquitin-conjugating enzyme E2 L3", "gene_name": "UBE2L3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96DZ5-1", "protein_name": "CAP-Gly domain-containing linker protein 3", "gene_name": "CLIP3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P19438-1", "protein_name": "Tumor necrosis factor receptor superfamily member 1A", "gene_name": "TNFRSF1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UM82-1", "protein_name": "Spermatogenesis-associated protein 2", "gene_name": "SPATA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49137-1", "protein_name": "MAP kinase-activated protein kinase 2", "gene_name": "MAPKAPK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BYM8-1", "protein_name": "RanBP-type and C3HC4-type zinc finger-containing protein 1", "gene_name": "RBCK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96EP0-1", "protein_name": "E3 ubiquitin-protein ligase RNF31", "gene_name": "RNF31", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H0F6-1", "protein_name": "Sharpin", "gene_name": "SHARPIN", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5VV17-1", "protein_name": "OTU domain-containing protein 1", "gene_name": "OTUD1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96AX9-1", "protein_name": "E3 ubiquitin-protein ligase MIB2", "gene_name": "MIB2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TCT8-1", "protein_name": "Signal peptide peptidase-like 2A", "gene_name": "SPPL2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14920-1", "protein_name": "Inhibitor of nuclear factor kappa-B kinase subunit beta", "gene_name": "IKBKB", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61077-1", "protein_name": "Ubiquitin-conjugating enzyme E2 D3", "gene_name": "UBE2D3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51668-1", "protein_name": "Ubiquitin-conjugating enzyme E2 D1", "gene_name": "UBE2D1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86VP1-1", "protein_name": "Tax1-binding protein 1", "gene_name": "TAX1BP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13158-1", "protein_name": "FAS-associated death domain protein", "gene_name": "FADD", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6GQQ9-1", "protein_name": "OTU domain-containing protein 7B", "gene_name": "OTUD7B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NQC7-1", "protein_name": "Ubiquitin carboxyl-terminal hydrolase CYLD", "gene_name": "CYLD", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UK80-1", "protein_name": "Ubiquitin carboxyl-terminal hydrolase 21", "gene_name": "USP21", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TCT7-1", "protein_name": "Signal peptide peptidase-like 2B", "gene_name": "SPPL2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96CV9-1", "protein_name": "Optineurin", "gene_name": "OPTN", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13077-1", "protein_name": "TNF receptor-associated factor 1", "gene_name": "TRAF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14790-1", "protein_name": "Caspase-8", "gene_name": "CASP8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15628-1", "protein_name": "Tumor necrosis factor receptor type 1-associated DEATH domain protein", "gene_name": "TRADD", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13490-1", "protein_name": "Baculoviral IAP repeat-containing protein 2", "gene_name": "BIRC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62979-1", "protein_name": "Ubiquitin-ribosomal protein eS31 fusion protein", "gene_name": "RPS27A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62837-1", "protein_name": "Ubiquitin-conjugating enzyme E2 D2", "gene_name": "UBE2D2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13489-1", "protein_name": "Baculoviral IAP repeat-containing protein 3", "gene_name": "BIRC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01375-1", "protein_name": "Tumor necrosis factor", "gene_name": "TNF", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG47-1", "protein_name": "Polyubiquitin-B", "gene_name": "UBB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96BN8-1", "protein_name": "Ubiquitin thioesterase otulin", "gene_name": "OTULIN", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62987-1", "protein_name": "Ubiquitin-ribosomal protein eL40 fusion protein", "gene_name": "UBA52", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12933-1", "protein_name": "TNF receptor-associated factor 2", "gene_name": "TRAF2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y6K9-1", "protein_name": "NF-kappa-B essential modulator", "gene_name": "IKBKG", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13107-1", "protein_name": "Ubiquitin carboxyl-terminal hydrolase 4", "gene_name": "USP4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P63244-1", "protein_name": "Small ribosomal subunit protein RACK1", "gene_name": "RACK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG48-1", "protein_name": "Polyubiquitin-C", "gene_name": "UBC", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75604-1", "protein_name": "Ubiquitin carboxyl-terminal hydrolase 2", "gene_name": "USP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UNE7-1", "protein_name": "E3 ubiquitin-protein ligase CHIP", "gene_name": "STUB1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q14164", "url": "https://www.uniprot.org/uniprotkb/Q14164" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 324, "end_pos": 324, "sequence_org": "D", "sequence_mut": "K", "comment": "Abolishes cleavage by caspase-8.", "evidence": [ { "database": "UniProtKB", "id": "Q13546", "url": "https://www.uniprot.org/uniprotkb/Q13546" }, { "database": "PubMed", "id": "10521396", "url": "https://pubmed.ncbi.nlm.nih.gov/10521396" } ], "uniprot_canonical_ac": "Q13546-1" } ], "record_id": "pubmed.10521396", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 46 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The caspase-8 inhibitor FLIP promotes activation of NF-kappaB and Erk signaling pathways.", "journal": "Current biology : CB", "date": "2000", "authors": "Kataoka T, Budd RC, Holler N, Thome M, Martinon F, Irmler M, Burns K, Hahne M, Kennedy N, Kovacsovics M, Tschopp J", "reference": { "type": "PubMed", "id": "10837247", "url": "https://pubmed.ncbi.nlm.nih.gov/10837247" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q14164-1", "protein_name": "Inhibitor of nuclear factor kappa-B kinase subunit epsilon", "gene_name": "IKBKE", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UHD2-1", "protein_name": "Serine/threonine-protein kinase TBK1", "gene_name": "TBK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15111-1", "protein_name": "Inhibitor of nuclear factor kappa-B kinase subunit alpha", "gene_name": "CHUK", "tax_name": "Human" }, { "uniprot_canonical_ac": "P98170-1", "protein_name": "E3 ubiquitin-protein ligase XIAP", "gene_name": "XIAP", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13546-1", "protein_name": "Receptor-interacting serine/threonine-protein kinase 1", "gene_name": "RIPK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00220-1", "protein_name": "Tumor necrosis factor receptor superfamily member 10A", "gene_name": "TNFRSF10A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75385-1", "protein_name": "Serine/threonine-protein kinase ULK1", "gene_name": "ULK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P21580-1", "protein_name": "Tumor necrosis factor alpha-induced protein 3", "gene_name": "TNFAIP3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68036-1", "protein_name": "Ubiquitin-conjugating enzyme E2 L3", "gene_name": "UBE2L3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96DZ5-1", "protein_name": "CAP-Gly domain-containing linker protein 3", "gene_name": "CLIP3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P19438-1", "protein_name": "Tumor necrosis factor receptor superfamily member 1A", "gene_name": "TNFRSF1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UM82-1", "protein_name": "Spermatogenesis-associated protein 2", "gene_name": "SPATA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49137-1", "protein_name": "MAP kinase-activated protein kinase 2", "gene_name": "MAPKAPK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BYM8-1", "protein_name": "RanBP-type and C3HC4-type zinc finger-containing protein 1", "gene_name": "RBCK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96EP0-1", "protein_name": "E3 ubiquitin-protein ligase RNF31", "gene_name": "RNF31", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H0F6-1", "protein_name": "Sharpin", "gene_name": "SHARPIN", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5VV17-1", "protein_name": "OTU domain-containing protein 1", "gene_name": "OTUD1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96AX9-1", "protein_name": "E3 ubiquitin-protein ligase MIB2", "gene_name": "MIB2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TCT8-1", "protein_name": "Signal peptide peptidase-like 2A", "gene_name": "SPPL2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14920-1", "protein_name": "Inhibitor of nuclear factor kappa-B kinase subunit beta", "gene_name": "IKBKB", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61077-1", "protein_name": "Ubiquitin-conjugating enzyme E2 D3", "gene_name": "UBE2D3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51668-1", "protein_name": "Ubiquitin-conjugating enzyme E2 D1", "gene_name": "UBE2D1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86VP1-1", "protein_name": "Tax1-binding protein 1", "gene_name": "TAX1BP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P25445-1", "protein_name": "Tumor necrosis factor receptor superfamily member 6", "gene_name": "FAS", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13158-1", "protein_name": "FAS-associated death domain protein", "gene_name": "FADD", "tax_name": "Human" }, { "uniprot_canonical_ac": "P48023-1", "protein_name": "Tumor necrosis factor ligand superfamily member 6", "gene_name": "FASLG", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6GQQ9-1", "protein_name": "OTU domain-containing protein 7B", "gene_name": "OTUD7B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NQC7-1", "protein_name": "Ubiquitin carboxyl-terminal hydrolase CYLD", "gene_name": "CYLD", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UK80-1", "protein_name": "Ubiquitin carboxyl-terminal hydrolase 21", "gene_name": "USP21", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TCT7-1", "protein_name": "Signal peptide peptidase-like 2B", "gene_name": "SPPL2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96CV9-1", "protein_name": "Optineurin", "gene_name": "OPTN", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13077-1", "protein_name": "TNF receptor-associated factor 1", "gene_name": "TRAF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14790-1", "protein_name": "Caspase-8", "gene_name": "CASP8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P50591-1", "protein_name": "Tumor necrosis factor ligand superfamily member 10", "gene_name": "TNFSF10", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15628-1", "protein_name": "Tumor necrosis factor receptor type 1-associated DEATH domain protein", "gene_name": "TRADD", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13490-1", "protein_name": "Baculoviral IAP repeat-containing protein 2", "gene_name": "BIRC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62979-1", "protein_name": "Ubiquitin-ribosomal protein eS31 fusion protein", "gene_name": "RPS27A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62837-1", "protein_name": "Ubiquitin-conjugating enzyme E2 D2", "gene_name": "UBE2D2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13489-1", "protein_name": "Baculoviral IAP repeat-containing protein 3", "gene_name": "BIRC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01375-1", "protein_name": "Tumor necrosis factor", "gene_name": "TNF", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG47-1", "protein_name": "Polyubiquitin-B", "gene_name": "UBB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96BN8-1", "protein_name": "Ubiquitin thioesterase otulin", "gene_name": "OTULIN", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62987-1", "protein_name": "Ubiquitin-ribosomal protein eL40 fusion protein", "gene_name": "UBA52", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14763-1", "protein_name": "Tumor necrosis factor receptor superfamily member 10B", "gene_name": "TNFRSF10B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12933-1", "protein_name": "TNF receptor-associated factor 2", "gene_name": "TRAF2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y6K9-1", "protein_name": "NF-kappa-B essential modulator", "gene_name": "IKBKG", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13107-1", "protein_name": "Ubiquitin carboxyl-terminal hydrolase 4", "gene_name": "USP4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P63244-1", "protein_name": "Small ribosomal subunit protein RACK1", "gene_name": "RACK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG48-1", "protein_name": "Polyubiquitin-C", "gene_name": "UBC", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75604-1", "protein_name": "Ubiquitin carboxyl-terminal hydrolase 2", "gene_name": "USP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UNE7-1", "protein_name": "E3 ubiquitin-protein ligase CHIP", "gene_name": "STUB1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q14164", "url": "https://www.uniprot.org/uniprotkb/Q14164" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.10837247", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 51 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "IKK epsilon is part of a novel PMA-inducible IkappaB kinase complex.", "journal": "Mol. Cell", "date": "2000", "authors": "Peters RT, Liao SM, Maniatis T", "reference": { "type": "PubMed", "id": "10882136", "url": "https://pubmed.ncbi.nlm.nih.gov/10882136" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q14164-1", "protein_name": "Inhibitor of nuclear factor kappa-B kinase subunit epsilon", "gene_name": "IKBKE", "tax_name": "Human" }, { "uniprot_canonical_ac": "P25963-1", "protein_name": "NF-kappa-B inhibitor alpha", "gene_name": "NFKBIA", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q14164", "url": "https://www.uniprot.org/uniprotkb/Q14164" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 32, "end_pos": 32, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by IKKA and IKKE", "evidence": [ { "database": "UniProtKB", "id": "P25963", "url": "https://www.uniprot.org/uniprotkb/P25963" }, { "database": "PRO", "id": "P25963", "url": "https://proconsortium.org/cgi-bin/entry_pro?id=P25963" }, { "database": "iPTMnet", "id": "P25963", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P25963" }, { "database": "PubMed", "id": "10329681", "url": "https://pubmed.ncbi.nlm.nih.gov/10329681" }, { "database": "PubMed", "id": "10066434", "url": "https://pubmed.ncbi.nlm.nih.gov/10066434" }, { "database": "PubMed", "id": "10336492", "url": "https://pubmed.ncbi.nlm.nih.gov/10336492" }, { "database": "PubMed", "id": "10384135", "url": "https://pubmed.ncbi.nlm.nih.gov/10384135" }, { "database": "PubMed", "id": "10398585", "url": "https://pubmed.ncbi.nlm.nih.gov/10398585" }, { "database": "PubMed", "id": "10409681", "url": "https://pubmed.ncbi.nlm.nih.gov/10409681" }, { "database": "PubMed", "id": "10437795", "url": "https://pubmed.ncbi.nlm.nih.gov/10437795" }, { "database": "PubMed", "id": "10490984", "url": "https://pubmed.ncbi.nlm.nih.gov/10490984" }, { "database": "PubMed", "id": "10527519", "url": "https://pubmed.ncbi.nlm.nih.gov/10527519" }, { "database": "PubMed", "id": "10542212", "url": "https://pubmed.ncbi.nlm.nih.gov/10542212" }, { "database": "PubMed", "id": "10574930", "url": "https://pubmed.ncbi.nlm.nih.gov/10574930" }, { "database": "PubMed", "id": "10593898", "url": "https://pubmed.ncbi.nlm.nih.gov/10593898" }, { "database": "PubMed", "id": "10754328", "url": "https://pubmed.ncbi.nlm.nih.gov/10754328" }, { "database": "PubMed", "id": "10918611", "url": "https://pubmed.ncbi.nlm.nih.gov/10918611" }, { "database": "PubMed", "id": "10930537", "url": "https://pubmed.ncbi.nlm.nih.gov/10930537" }, { "database": "PubMed", "id": "10973957", "url": "https://pubmed.ncbi.nlm.nih.gov/10973957" }, { "database": "PubMed", "id": "10982547", "url": "https://pubmed.ncbi.nlm.nih.gov/10982547" }, { "database": "PubMed", "id": "11254493", "url": "https://pubmed.ncbi.nlm.nih.gov/11254493" }, { "database": "PubMed", "id": "11279241", "url": "https://pubmed.ncbi.nlm.nih.gov/11279241" }, { "database": "PubMed", "id": "11408488", "url": "https://pubmed.ncbi.nlm.nih.gov/11408488" }, { "database": "PubMed", "id": "11815618", "url": "https://pubmed.ncbi.nlm.nih.gov/11815618" }, { "database": "PubMed", "id": "11994255", "url": "https://pubmed.ncbi.nlm.nih.gov/11994255" }, { "database": "PubMed", "id": "12054687", "url": "https://pubmed.ncbi.nlm.nih.gov/12054687" }, { "database": "PubMed", "id": "12138192", "url": "https://pubmed.ncbi.nlm.nih.gov/12138192" }, { "database": "PubMed", "id": "12189195", "url": "https://pubmed.ncbi.nlm.nih.gov/12189195" }, { "database": "PubMed", "id": "12377412", "url": "https://pubmed.ncbi.nlm.nih.gov/12377412" }, { "database": "PubMed", "id": "12909638", "url": "https://pubmed.ncbi.nlm.nih.gov/12909638" }, { "database": "PubMed", "id": "15093615", "url": "https://pubmed.ncbi.nlm.nih.gov/15093615" }, { "database": "PubMed", "id": "15128824", "url": "https://pubmed.ncbi.nlm.nih.gov/15128824" }, { "database": "PubMed", "id": "15308505", "url": "https://pubmed.ncbi.nlm.nih.gov/15308505" }, { "database": "PubMed", "id": "15368357", "url": "https://pubmed.ncbi.nlm.nih.gov/15368357" }, { "database": "PubMed", "id": "15843586", "url": "https://pubmed.ncbi.nlm.nih.gov/15843586" }, { "database": "PubMed", "id": "15880609", "url": "https://pubmed.ncbi.nlm.nih.gov/15880609" }, { "database": "PubMed", "id": "16007147", "url": "https://pubmed.ncbi.nlm.nih.gov/16007147" }, { "database": "PubMed", "id": "16015604", "url": "https://pubmed.ncbi.nlm.nih.gov/16015604" }, { "database": "PubMed", "id": "16271147", "url": "https://pubmed.ncbi.nlm.nih.gov/16271147" }, { "database": "PubMed", "id": "16619039", "url": "https://pubmed.ncbi.nlm.nih.gov/16619039" }, { "database": "PubMed", "id": "18207244", "url": "https://pubmed.ncbi.nlm.nih.gov/18207244" }, { "database": "PubMed", "id": "18436431", "url": "https://pubmed.ncbi.nlm.nih.gov/18436431" }, { "database": "PubMed", "id": "18444250", "url": "https://pubmed.ncbi.nlm.nih.gov/18444250" }, { "database": "PubMed", "id": "18453612", "url": "https://pubmed.ncbi.nlm.nih.gov/18453612" }, { "database": "PubMed", "id": "18455150", "url": "https://pubmed.ncbi.nlm.nih.gov/18455150" }, { "database": "PubMed", "id": "18468507", "url": "https://pubmed.ncbi.nlm.nih.gov/18468507" }, { "database": "PubMed", "id": "18657515", "url": "https://pubmed.ncbi.nlm.nih.gov/18657515" }, { "database": "PubMed", "id": "19796012", "url": "https://pubmed.ncbi.nlm.nih.gov/19796012" }, { "database": "PubMed", "id": "20191354", "url": "https://pubmed.ncbi.nlm.nih.gov/20191354" }, { "database": "PubMed", "id": "20385620", "url": "https://pubmed.ncbi.nlm.nih.gov/20385620" }, { "database": "PubMed", "id": "20811049", "url": "https://pubmed.ncbi.nlm.nih.gov/20811049" }, { "database": "PubMed", "id": "20890592", "url": "https://pubmed.ncbi.nlm.nih.gov/20890592" }, { "database": "PubMed", "id": "21606193", "url": "https://pubmed.ncbi.nlm.nih.gov/21606193" }, { "database": "PubMed", "id": "22896603", "url": "https://pubmed.ncbi.nlm.nih.gov/22896603" }, { "database": "PubMed", "id": "23118497", "url": "https://pubmed.ncbi.nlm.nih.gov/23118497" }, { "database": "PubMed", "id": "23892407", "url": "https://pubmed.ncbi.nlm.nih.gov/23892407" }, { "database": "PubMed", "id": "24083678", "url": "https://pubmed.ncbi.nlm.nih.gov/24083678" }, { "database": "PubMed", "id": "24552816", "url": "https://pubmed.ncbi.nlm.nih.gov/24552816" }, { "database": "PubMed", "id": "25881508", "url": "https://pubmed.ncbi.nlm.nih.gov/25881508" }, { "database": "PubMed", "id": "26721416", "url": "https://pubmed.ncbi.nlm.nih.gov/26721416" }, { "database": "PubMed", "id": "28431901", "url": "https://pubmed.ncbi.nlm.nih.gov/28431901" }, { "database": "PubMed", "id": "28467781", "url": "https://pubmed.ncbi.nlm.nih.gov/28467781" }, { "database": "PubMed", "id": "28629746", "url": "https://pubmed.ncbi.nlm.nih.gov/28629746" }, { "database": "PubMed", "id": "29050234", "url": "https://pubmed.ncbi.nlm.nih.gov/29050234" }, { "database": "PubMed", "id": "30804118", "url": "https://pubmed.ncbi.nlm.nih.gov/30804118" }, { "database": "PubMed", "id": "33184242", "url": "https://pubmed.ncbi.nlm.nih.gov/33184242" }, { "database": "PubMed", "id": "33572115", "url": "https://pubmed.ncbi.nlm.nih.gov/33572115" }, { "database": "PubMed", "id": "35081975", "url": "https://pubmed.ncbi.nlm.nih.gov/35081975" }, { "database": "PubMed", "id": "7479976", "url": "https://pubmed.ncbi.nlm.nih.gov/7479976" }, { "database": "PubMed", "id": "7628694", "url": "https://pubmed.ncbi.nlm.nih.gov/7628694" }, { "database": "PubMed", "id": "7878466", "url": "https://pubmed.ncbi.nlm.nih.gov/7878466" }, { "database": "PubMed", "id": "8601309", "url": "https://pubmed.ncbi.nlm.nih.gov/8601309" }, { "database": "PubMed", "id": "8604224", "url": "https://pubmed.ncbi.nlm.nih.gov/8604224" }, { "database": "PubMed", "id": "8622650", "url": "https://pubmed.ncbi.nlm.nih.gov/8622650" }, { "database": "PubMed", "id": "8655651", "url": "https://pubmed.ncbi.nlm.nih.gov/8655651" }, { "database": "PubMed", "id": "8657102", "url": "https://pubmed.ncbi.nlm.nih.gov/8657102" }, { "database": "PubMed", "id": "8660357", "url": "https://pubmed.ncbi.nlm.nih.gov/8660357" }, { "database": "PubMed", "id": "8887633", "url": "https://pubmed.ncbi.nlm.nih.gov/8887633" }, { "database": "PubMed", "id": "9154800", "url": "https://pubmed.ncbi.nlm.nih.gov/9154800" }, { "database": "PubMed", "id": "9214631", "url": "https://pubmed.ncbi.nlm.nih.gov/9214631" }, { "database": "PubMed", "id": "9244310", "url": "https://pubmed.ncbi.nlm.nih.gov/9244310" }, { "database": "PubMed", "id": "9261139", "url": "https://pubmed.ncbi.nlm.nih.gov/9261139" }, { "database": "PubMed", "id": "9346485", "url": "https://pubmed.ncbi.nlm.nih.gov/9346485" }, { "database": "PubMed", "id": "9573057", "url": "https://pubmed.ncbi.nlm.nih.gov/9573057" }, { "database": "PubMed", "id": "9632633", "url": "https://pubmed.ncbi.nlm.nih.gov/9632633" }, { "database": "PubMed", "id": "9689078", "url": "https://pubmed.ncbi.nlm.nih.gov/9689078" }, { "database": "PubMed", "id": "9707608", "url": "https://pubmed.ncbi.nlm.nih.gov/9707608" }, { "database": "PubMed", "id": "9734360", "url": "https://pubmed.ncbi.nlm.nih.gov/9734360" }, { "database": "PubMed", "id": "9789032", "url": "https://pubmed.ncbi.nlm.nih.gov/9789032" }, { "database": "PubMed", "id": "9792644", "url": "https://pubmed.ncbi.nlm.nih.gov/9792644" }, { "database": "PubMed", "id": "9914500", "url": "https://pubmed.ncbi.nlm.nih.gov/9914500" }, { "database": "PubMed", "id": "10882136", "url": "https://pubmed.ncbi.nlm.nih.gov/10882136" }, { "database": "PubMed", "id": "7796813", "url": "https://pubmed.ncbi.nlm.nih.gov/7796813" }, { "database": "PubMed", "id": "8631829", "url": "https://pubmed.ncbi.nlm.nih.gov/8631829" } ], "site_lbl": "Ser32", "uniprot_canonical_ac": "P25963-1" }, { "start_pos": 36, "end_pos": 36, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by IKKA, IKKB, IKKE and TBK1", "evidence": [ { "database": "UniProtKB", "id": "P25963", "url": "https://www.uniprot.org/uniprotkb/P25963" }, { "database": "PRO", "id": "P25963", "url": "https://proconsortium.org/cgi-bin/entry_pro?id=P25963" }, { "database": "iPTMnet", "id": "P25963", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P25963" }, { "database": "PubMed", "id": "10329681", "url": "https://pubmed.ncbi.nlm.nih.gov/10329681" }, { "database": "PubMed", "id": "10066434", "url": "https://pubmed.ncbi.nlm.nih.gov/10066434" }, { "database": "PubMed", "id": "10398585", "url": "https://pubmed.ncbi.nlm.nih.gov/10398585" }, { "database": "PubMed", "id": "10409681", "url": "https://pubmed.ncbi.nlm.nih.gov/10409681" }, { "database": "PubMed", "id": "10437795", "url": "https://pubmed.ncbi.nlm.nih.gov/10437795" }, { "database": "PubMed", "id": "10490984", "url": "https://pubmed.ncbi.nlm.nih.gov/10490984" }, { "database": "PubMed", "id": "10527519", "url": "https://pubmed.ncbi.nlm.nih.gov/10527519" }, { "database": "PubMed", "id": "10542212", "url": "https://pubmed.ncbi.nlm.nih.gov/10542212" }, { "database": "PubMed", "id": "10574930", "url": "https://pubmed.ncbi.nlm.nih.gov/10574930" }, { "database": "PubMed", "id": "10593898", "url": "https://pubmed.ncbi.nlm.nih.gov/10593898" }, { "database": "PubMed", "id": "10754328", "url": "https://pubmed.ncbi.nlm.nih.gov/10754328" }, { "database": "PubMed", "id": "10882136", "url": "https://pubmed.ncbi.nlm.nih.gov/10882136" }, { "database": "PubMed", "id": "10918611", "url": "https://pubmed.ncbi.nlm.nih.gov/10918611" }, { "database": "PubMed", "id": "11254493", "url": "https://pubmed.ncbi.nlm.nih.gov/11254493" }, { "database": "PubMed", "id": "11279241", "url": "https://pubmed.ncbi.nlm.nih.gov/11279241" }, { "database": "PubMed", "id": "11408488", "url": "https://pubmed.ncbi.nlm.nih.gov/11408488" }, { "database": "PubMed", "id": "11815618", "url": "https://pubmed.ncbi.nlm.nih.gov/11815618" }, { "database": "PubMed", "id": "12054687", "url": "https://pubmed.ncbi.nlm.nih.gov/12054687" }, { "database": "PubMed", "id": "12138192", "url": "https://pubmed.ncbi.nlm.nih.gov/12138192" }, { "database": "PubMed", "id": "12377412", "url": "https://pubmed.ncbi.nlm.nih.gov/12377412" }, { "database": "PubMed", "id": "12909638", "url": "https://pubmed.ncbi.nlm.nih.gov/12909638" }, { "database": "PubMed", "id": "15128824", "url": "https://pubmed.ncbi.nlm.nih.gov/15128824" }, { "database": "PubMed", "id": "15368357", "url": "https://pubmed.ncbi.nlm.nih.gov/15368357" }, { "database": "PubMed", "id": "15843586", "url": "https://pubmed.ncbi.nlm.nih.gov/15843586" }, { "database": "PubMed", "id": "15880609", "url": "https://pubmed.ncbi.nlm.nih.gov/15880609" }, { "database": "PubMed", "id": "16007147", "url": "https://pubmed.ncbi.nlm.nih.gov/16007147" }, { "database": "PubMed", "id": "16015604", "url": "https://pubmed.ncbi.nlm.nih.gov/16015604" }, { "database": "PubMed", "id": "16271147", "url": "https://pubmed.ncbi.nlm.nih.gov/16271147" }, { "database": "PubMed", "id": "16619039", "url": "https://pubmed.ncbi.nlm.nih.gov/16619039" }, { "database": "PubMed", "id": "18207244", "url": "https://pubmed.ncbi.nlm.nih.gov/18207244" }, { "database": "PubMed", "id": "18436431", "url": "https://pubmed.ncbi.nlm.nih.gov/18436431" }, { "database": "PubMed", "id": "18444250", "url": "https://pubmed.ncbi.nlm.nih.gov/18444250" }, { "database": "PubMed", "id": "18455150", "url": "https://pubmed.ncbi.nlm.nih.gov/18455150" }, { "database": "PubMed", "id": "18657515", "url": "https://pubmed.ncbi.nlm.nih.gov/18657515" }, { "database": "PubMed", "id": "19796012", "url": "https://pubmed.ncbi.nlm.nih.gov/19796012" }, { "database": "PubMed", "id": "21606193", "url": "https://pubmed.ncbi.nlm.nih.gov/21606193" }, { "database": "PubMed", "id": "23118497", "url": "https://pubmed.ncbi.nlm.nih.gov/23118497" }, { "database": "PubMed", "id": "23892407", "url": "https://pubmed.ncbi.nlm.nih.gov/23892407" }, { "database": "PubMed", "id": "24552816", "url": "https://pubmed.ncbi.nlm.nih.gov/24552816" }, { "database": "PubMed", "id": "26721416", "url": "https://pubmed.ncbi.nlm.nih.gov/26721416" }, { "database": "PubMed", "id": "28467781", "url": "https://pubmed.ncbi.nlm.nih.gov/28467781" }, { "database": "PubMed", "id": "28629746", "url": "https://pubmed.ncbi.nlm.nih.gov/28629746" }, { "database": "PubMed", "id": "30804118", "url": "https://pubmed.ncbi.nlm.nih.gov/30804118" }, { "database": "PubMed", "id": "7479976", "url": "https://pubmed.ncbi.nlm.nih.gov/7479976" }, { "database": "PubMed", "id": "7628694", "url": "https://pubmed.ncbi.nlm.nih.gov/7628694" }, { "database": "PubMed", "id": "7878466", "url": "https://pubmed.ncbi.nlm.nih.gov/7878466" }, { "database": "PubMed", "id": "8601309", "url": "https://pubmed.ncbi.nlm.nih.gov/8601309" }, { "database": "PubMed", "id": "8622650", "url": "https://pubmed.ncbi.nlm.nih.gov/8622650" }, { "database": "PubMed", "id": "8655651", "url": "https://pubmed.ncbi.nlm.nih.gov/8655651" }, { "database": "PubMed", "id": "8657102", "url": "https://pubmed.ncbi.nlm.nih.gov/8657102" }, { "database": "PubMed", "id": "8660357", "url": "https://pubmed.ncbi.nlm.nih.gov/8660357" }, { "database": "PubMed", "id": "8887633", "url": "https://pubmed.ncbi.nlm.nih.gov/8887633" }, { "database": "PubMed", "id": "9154800", "url": "https://pubmed.ncbi.nlm.nih.gov/9154800" }, { "database": "PubMed", "id": "9244310", "url": "https://pubmed.ncbi.nlm.nih.gov/9244310" }, { "database": "PubMed", "id": "9346485", "url": "https://pubmed.ncbi.nlm.nih.gov/9346485" }, { "database": "PubMed", "id": "9632633", "url": "https://pubmed.ncbi.nlm.nih.gov/9632633" }, { "database": "PubMed", "id": "9632806", "url": "https://pubmed.ncbi.nlm.nih.gov/9632806" }, { "database": "PubMed", "id": "9689078", "url": "https://pubmed.ncbi.nlm.nih.gov/9689078" }, { "database": "PubMed", "id": "9707608", "url": "https://pubmed.ncbi.nlm.nih.gov/9707608" }, { "database": "PubMed", "id": "9734360", "url": "https://pubmed.ncbi.nlm.nih.gov/9734360" }, { "database": "PubMed", "id": "9789032", "url": "https://pubmed.ncbi.nlm.nih.gov/9789032" }, { "database": "PubMed", "id": "9792644", "url": "https://pubmed.ncbi.nlm.nih.gov/9792644" }, { "database": "PubMed", "id": "9914500", "url": "https://pubmed.ncbi.nlm.nih.gov/9914500" }, { "database": "PubMed", "id": "7796813", "url": "https://pubmed.ncbi.nlm.nih.gov/7796813" }, { "database": "PubMed", "id": "8631829", "url": "https://pubmed.ncbi.nlm.nih.gov/8631829" } ], "site_lbl": "Ser36", "uniprot_canonical_ac": "P25963-1" } ], "record_id": "pubmed.10882136", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "TRAF1 is a substrate of caspases activated during tumor necrosis factor receptor-alpha-induced apoptosis.", "journal": "The Journal of biological chemistry", "date": "2001", "authors": "Leo E, Deveraux QL, Buchholtz C, Welsh K, Matsuzawa S, Stennicke HR, Salvesen GS, Reed JC", "reference": { "type": "PubMed", "id": "11098060", "url": "https://pubmed.ncbi.nlm.nih.gov/11098060" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q14164-1", "protein_name": "Inhibitor of nuclear factor kappa-B kinase subunit epsilon", "gene_name": "IKBKE", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UHD2-1", "protein_name": "Serine/threonine-protein kinase TBK1", "gene_name": "TBK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15111-1", "protein_name": "Inhibitor of nuclear factor kappa-B kinase subunit alpha", "gene_name": "CHUK", "tax_name": "Human" }, { "uniprot_canonical_ac": "P98170-1", "protein_name": "E3 ubiquitin-protein ligase XIAP", "gene_name": "XIAP", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13546-1", "protein_name": "Receptor-interacting serine/threonine-protein kinase 1", "gene_name": "RIPK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75385-1", "protein_name": "Serine/threonine-protein kinase ULK1", "gene_name": "ULK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P21580-1", "protein_name": "Tumor necrosis factor alpha-induced protein 3", "gene_name": "TNFAIP3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68036-1", "protein_name": "Ubiquitin-conjugating enzyme E2 L3", "gene_name": "UBE2L3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96DZ5-1", "protein_name": "CAP-Gly domain-containing linker protein 3", "gene_name": "CLIP3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P19438-1", "protein_name": "Tumor necrosis factor receptor superfamily member 1A", "gene_name": "TNFRSF1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UM82-1", "protein_name": "Spermatogenesis-associated protein 2", "gene_name": "SPATA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49137-1", "protein_name": "MAP kinase-activated protein kinase 2", "gene_name": "MAPKAPK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BYM8-1", "protein_name": "RanBP-type and C3HC4-type zinc finger-containing protein 1", "gene_name": "RBCK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96EP0-1", "protein_name": "E3 ubiquitin-protein ligase RNF31", "gene_name": "RNF31", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H0F6-1", "protein_name": "Sharpin", "gene_name": "SHARPIN", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5VV17-1", "protein_name": "OTU domain-containing protein 1", "gene_name": "OTUD1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96AX9-1", "protein_name": "E3 ubiquitin-protein ligase MIB2", "gene_name": "MIB2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TCT8-1", "protein_name": "Signal peptide peptidase-like 2A", "gene_name": "SPPL2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14920-1", "protein_name": "Inhibitor of nuclear factor kappa-B kinase subunit beta", "gene_name": "IKBKB", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61077-1", "protein_name": "Ubiquitin-conjugating enzyme E2 D3", "gene_name": "UBE2D3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51668-1", "protein_name": "Ubiquitin-conjugating enzyme E2 D1", "gene_name": "UBE2D1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86VP1-1", "protein_name": "Tax1-binding protein 1", "gene_name": "TAX1BP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13158-1", "protein_name": "FAS-associated death domain protein", "gene_name": "FADD", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6GQQ9-1", "protein_name": "OTU domain-containing protein 7B", "gene_name": "OTUD7B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NQC7-1", "protein_name": "Ubiquitin carboxyl-terminal hydrolase CYLD", "gene_name": "CYLD", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UK80-1", "protein_name": "Ubiquitin carboxyl-terminal hydrolase 21", "gene_name": "USP21", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TCT7-1", "protein_name": "Signal peptide peptidase-like 2B", "gene_name": "SPPL2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96CV9-1", "protein_name": "Optineurin", "gene_name": "OPTN", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13077-1", "protein_name": "TNF receptor-associated factor 1", "gene_name": "TRAF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14790-1", "protein_name": "Caspase-8", "gene_name": "CASP8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15628-1", "protein_name": "Tumor necrosis factor receptor type 1-associated DEATH domain protein", "gene_name": "TRADD", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13490-1", "protein_name": "Baculoviral IAP repeat-containing protein 2", "gene_name": "BIRC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62979-1", "protein_name": "Ubiquitin-ribosomal protein eS31 fusion protein", "gene_name": "RPS27A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62837-1", "protein_name": "Ubiquitin-conjugating enzyme E2 D2", "gene_name": "UBE2D2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13489-1", "protein_name": "Baculoviral IAP repeat-containing protein 3", "gene_name": "BIRC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01375-1", "protein_name": "Tumor necrosis factor", "gene_name": "TNF", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG47-1", "protein_name": "Polyubiquitin-B", "gene_name": "UBB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96BN8-1", "protein_name": "Ubiquitin thioesterase otulin", "gene_name": "OTULIN", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62987-1", "protein_name": "Ubiquitin-ribosomal protein eL40 fusion protein", "gene_name": "UBA52", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12933-1", "protein_name": "TNF receptor-associated factor 2", "gene_name": "TRAF2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y6K9-1", "protein_name": "NF-kappa-B essential modulator", "gene_name": "IKBKG", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13107-1", "protein_name": "Ubiquitin carboxyl-terminal hydrolase 4", "gene_name": "USP4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P63244-1", "protein_name": "Small ribosomal subunit protein RACK1", "gene_name": "RACK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG48-1", "protein_name": "Polyubiquitin-C", "gene_name": "UBC", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75604-1", "protein_name": "Ubiquitin carboxyl-terminal hydrolase 2", "gene_name": "USP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UNE7-1", "protein_name": "E3 ubiquitin-protein ligase CHIP", "gene_name": "STUB1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q14164", "url": "https://www.uniprot.org/uniprotkb/Q14164" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.11098060", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 46 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Caspase-cleaved TRAF1 negatively regulates the antiapoptotic signals of TRAF2 during TNF-induced cell death.", "journal": "Biochemical and biophysical research communications", "date": "2001", "authors": "Jang HD, Chung YM, Baik JH, Choi YG, Park IS, Jung YK, Lee SY", "reference": { "type": "PubMed", "id": "11181075", "url": "https://pubmed.ncbi.nlm.nih.gov/11181075" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q14164-1", "protein_name": "Inhibitor of nuclear factor kappa-B kinase subunit epsilon", "gene_name": "IKBKE", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UHD2-1", "protein_name": "Serine/threonine-protein kinase TBK1", "gene_name": "TBK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15111-1", "protein_name": "Inhibitor of nuclear factor kappa-B kinase subunit alpha", "gene_name": "CHUK", "tax_name": "Human" }, { "uniprot_canonical_ac": "P98170-1", "protein_name": "E3 ubiquitin-protein ligase XIAP", "gene_name": "XIAP", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13546-1", "protein_name": "Receptor-interacting serine/threonine-protein kinase 1", "gene_name": "RIPK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75385-1", "protein_name": "Serine/threonine-protein kinase ULK1", "gene_name": "ULK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P21580-1", "protein_name": "Tumor necrosis factor alpha-induced protein 3", "gene_name": "TNFAIP3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68036-1", "protein_name": "Ubiquitin-conjugating enzyme E2 L3", "gene_name": "UBE2L3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96DZ5-1", "protein_name": "CAP-Gly domain-containing linker protein 3", "gene_name": "CLIP3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P19438-1", "protein_name": "Tumor necrosis factor receptor superfamily member 1A", "gene_name": "TNFRSF1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UM82-1", "protein_name": "Spermatogenesis-associated protein 2", "gene_name": "SPATA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49137-1", "protein_name": "MAP kinase-activated protein kinase 2", "gene_name": "MAPKAPK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BYM8-1", "protein_name": "RanBP-type and C3HC4-type zinc finger-containing protein 1", "gene_name": "RBCK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96EP0-1", "protein_name": "E3 ubiquitin-protein ligase RNF31", "gene_name": "RNF31", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H0F6-1", "protein_name": "Sharpin", "gene_name": "SHARPIN", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5VV17-1", "protein_name": "OTU domain-containing protein 1", "gene_name": "OTUD1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96AX9-1", "protein_name": "E3 ubiquitin-protein ligase MIB2", "gene_name": "MIB2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TCT8-1", "protein_name": "Signal peptide peptidase-like 2A", "gene_name": "SPPL2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14920-1", "protein_name": "Inhibitor of nuclear factor kappa-B kinase subunit beta", "gene_name": "IKBKB", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61077-1", "protein_name": "Ubiquitin-conjugating enzyme E2 D3", "gene_name": "UBE2D3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51668-1", "protein_name": "Ubiquitin-conjugating enzyme E2 D1", "gene_name": "UBE2D1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86VP1-1", "protein_name": "Tax1-binding protein 1", "gene_name": "TAX1BP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13158-1", "protein_name": "FAS-associated death domain protein", "gene_name": "FADD", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6GQQ9-1", "protein_name": "OTU domain-containing protein 7B", "gene_name": "OTUD7B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NQC7-1", "protein_name": "Ubiquitin carboxyl-terminal hydrolase CYLD", "gene_name": "CYLD", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UK80-1", "protein_name": "Ubiquitin carboxyl-terminal hydrolase 21", "gene_name": "USP21", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TCT7-1", "protein_name": "Signal peptide peptidase-like 2B", "gene_name": "SPPL2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96CV9-1", "protein_name": "Optineurin", "gene_name": "OPTN", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13077-1", "protein_name": "TNF receptor-associated factor 1", "gene_name": "TRAF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14790-1", "protein_name": "Caspase-8", "gene_name": "CASP8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15628-1", "protein_name": "Tumor necrosis factor receptor type 1-associated DEATH domain protein", "gene_name": "TRADD", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13490-1", "protein_name": "Baculoviral IAP repeat-containing protein 2", "gene_name": "BIRC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62979-1", "protein_name": "Ubiquitin-ribosomal protein eS31 fusion protein", "gene_name": "RPS27A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62837-1", "protein_name": "Ubiquitin-conjugating enzyme E2 D2", "gene_name": "UBE2D2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13489-1", "protein_name": "Baculoviral IAP repeat-containing protein 3", "gene_name": "BIRC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01375-1", "protein_name": "Tumor necrosis factor", "gene_name": "TNF", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG47-1", "protein_name": "Polyubiquitin-B", "gene_name": "UBB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96BN8-1", "protein_name": "Ubiquitin thioesterase otulin", "gene_name": "OTULIN", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62987-1", "protein_name": "Ubiquitin-ribosomal protein eL40 fusion protein", "gene_name": "UBA52", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12933-1", "protein_name": "TNF receptor-associated factor 2", "gene_name": "TRAF2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y6K9-1", "protein_name": "NF-kappa-B essential modulator", "gene_name": "IKBKG", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13107-1", "protein_name": "Ubiquitin carboxyl-terminal hydrolase 4", "gene_name": "USP4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P63244-1", "protein_name": "Small ribosomal subunit protein RACK1", "gene_name": "RACK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG48-1", "protein_name": "Polyubiquitin-C", "gene_name": "UBC", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75604-1", "protein_name": "Ubiquitin carboxyl-terminal hydrolase 2", "gene_name": "USP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UNE7-1", "protein_name": "E3 ubiquitin-protein ligase CHIP", "gene_name": "STUB1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q14164", "url": "https://www.uniprot.org/uniprotkb/Q14164" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.11181075", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 46 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "A cytomegalovirus-encoded inhibitor of apoptosis that suppresses caspase-8 activation.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2001", "authors": "Skaletskaya A, Bartle LM, Chittenden T, McCormick AL, Mocarski ES, Goldmacher VS", "reference": { "type": "PubMed", "id": "11427719", "url": "https://pubmed.ncbi.nlm.nih.gov/11427719" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q14164-1", "protein_name": "Inhibitor of nuclear factor kappa-B kinase subunit epsilon", "gene_name": "IKBKE", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UHD2-1", "protein_name": "Serine/threonine-protein kinase TBK1", "gene_name": "TBK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15111-1", "protein_name": "Inhibitor of nuclear factor kappa-B kinase subunit alpha", "gene_name": "CHUK", "tax_name": "Human" }, { "uniprot_canonical_ac": "P98170-1", "protein_name": "E3 ubiquitin-protein ligase XIAP", "gene_name": "XIAP", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13546-1", "protein_name": "Receptor-interacting serine/threonine-protein kinase 1", "gene_name": "RIPK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75385-1", "protein_name": "Serine/threonine-protein kinase ULK1", "gene_name": "ULK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P21580-1", "protein_name": "Tumor necrosis factor alpha-induced protein 3", "gene_name": "TNFAIP3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68036-1", "protein_name": "Ubiquitin-conjugating enzyme E2 L3", "gene_name": "UBE2L3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96DZ5-1", "protein_name": "CAP-Gly domain-containing linker protein 3", "gene_name": "CLIP3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P19438-1", "protein_name": "Tumor necrosis factor receptor superfamily member 1A", "gene_name": "TNFRSF1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UM82-1", "protein_name": "Spermatogenesis-associated protein 2", "gene_name": "SPATA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49137-1", "protein_name": "MAP kinase-activated protein kinase 2", "gene_name": "MAPKAPK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BYM8-1", "protein_name": "RanBP-type and C3HC4-type zinc finger-containing protein 1", "gene_name": "RBCK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96EP0-1", "protein_name": "E3 ubiquitin-protein ligase RNF31", "gene_name": "RNF31", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H0F6-1", "protein_name": "Sharpin", "gene_name": "SHARPIN", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5VV17-1", "protein_name": "OTU domain-containing protein 1", "gene_name": "OTUD1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96AX9-1", "protein_name": "E3 ubiquitin-protein ligase MIB2", "gene_name": "MIB2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TCT8-1", "protein_name": "Signal peptide peptidase-like 2A", "gene_name": "SPPL2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14920-1", "protein_name": "Inhibitor of nuclear factor kappa-B kinase subunit beta", "gene_name": "IKBKB", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61077-1", "protein_name": "Ubiquitin-conjugating enzyme E2 D3", "gene_name": "UBE2D3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51668-1", "protein_name": "Ubiquitin-conjugating enzyme E2 D1", "gene_name": "UBE2D1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86VP1-1", "protein_name": "Tax1-binding protein 1", "gene_name": "TAX1BP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13158-1", "protein_name": "FAS-associated death domain protein", "gene_name": "FADD", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6GQQ9-1", "protein_name": "OTU domain-containing protein 7B", "gene_name": "OTUD7B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NQC7-1", "protein_name": "Ubiquitin carboxyl-terminal hydrolase CYLD", "gene_name": "CYLD", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UK80-1", "protein_name": "Ubiquitin carboxyl-terminal hydrolase 21", "gene_name": "USP21", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TCT7-1", "protein_name": "Signal peptide peptidase-like 2B", "gene_name": "SPPL2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96CV9-1", "protein_name": "Optineurin", "gene_name": "OPTN", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13077-1", "protein_name": "TNF receptor-associated factor 1", "gene_name": "TRAF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14790-1", "protein_name": "Caspase-8", "gene_name": "CASP8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15628-1", "protein_name": "Tumor necrosis factor receptor type 1-associated DEATH domain protein", "gene_name": "TRADD", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13490-1", "protein_name": "Baculoviral IAP repeat-containing protein 2", "gene_name": "BIRC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62979-1", "protein_name": "Ubiquitin-ribosomal protein eS31 fusion protein", "gene_name": "RPS27A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62837-1", "protein_name": "Ubiquitin-conjugating enzyme E2 D2", "gene_name": "UBE2D2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13489-1", "protein_name": "Baculoviral IAP repeat-containing protein 3", "gene_name": "BIRC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01375-1", "protein_name": "Tumor necrosis factor", "gene_name": "TNF", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG47-1", "protein_name": "Polyubiquitin-B", "gene_name": "UBB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96BN8-1", "protein_name": "Ubiquitin thioesterase otulin", "gene_name": "OTULIN", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62987-1", "protein_name": "Ubiquitin-ribosomal protein eL40 fusion protein", "gene_name": "UBA52", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12933-1", "protein_name": "TNF receptor-associated factor 2", "gene_name": "TRAF2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y6K9-1", "protein_name": "NF-kappa-B essential modulator", "gene_name": "IKBKG", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13107-1", "protein_name": "Ubiquitin carboxyl-terminal hydrolase 4", "gene_name": "USP4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P63244-1", "protein_name": "Small ribosomal subunit protein RACK1", "gene_name": "RACK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG48-1", "protein_name": "Polyubiquitin-C", "gene_name": "UBC", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75604-1", "protein_name": "Ubiquitin carboxyl-terminal hydrolase 2", "gene_name": "USP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UNE7-1", "protein_name": "E3 ubiquitin-protein ligase CHIP", "gene_name": "STUB1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q14164", "url": "https://www.uniprot.org/uniprotkb/Q14164" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.11427719", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 46 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Contrasting effects of IG20 and its splice isoforms, MADD and DENN-SV, on tumor necrosis factor alpha-induced apoptosis and activation of caspase-8 and -3.", "journal": "The Journal of biological chemistry", "date": "2001", "authors": "Al-Zoubi AM, Efimova EV, Kaithamana S, Martinez O, El-Idrissi Mel-A, Dogan RE, Prabhakar BS", "reference": { "type": "PubMed", "id": "11577081", "url": "https://pubmed.ncbi.nlm.nih.gov/11577081" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q14164-1", "protein_name": "Inhibitor of nuclear factor kappa-B kinase subunit epsilon", "gene_name": "IKBKE", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UHD2-1", "protein_name": "Serine/threonine-protein kinase TBK1", "gene_name": "TBK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15111-1", "protein_name": "Inhibitor of nuclear factor kappa-B kinase subunit alpha", "gene_name": "CHUK", "tax_name": "Human" }, { "uniprot_canonical_ac": "P98170-1", "protein_name": "E3 ubiquitin-protein ligase XIAP", "gene_name": "XIAP", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13546-1", "protein_name": "Receptor-interacting serine/threonine-protein kinase 1", "gene_name": "RIPK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75385-1", "protein_name": "Serine/threonine-protein kinase ULK1", "gene_name": "ULK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P21580-1", "protein_name": "Tumor necrosis factor alpha-induced protein 3", "gene_name": "TNFAIP3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68036-1", "protein_name": "Ubiquitin-conjugating enzyme E2 L3", "gene_name": "UBE2L3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96DZ5-1", "protein_name": "CAP-Gly domain-containing linker protein 3", "gene_name": "CLIP3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P19438-1", "protein_name": "Tumor necrosis factor receptor superfamily member 1A", "gene_name": "TNFRSF1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UM82-1", "protein_name": "Spermatogenesis-associated protein 2", "gene_name": "SPATA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49137-1", "protein_name": "MAP kinase-activated protein kinase 2", "gene_name": "MAPKAPK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BYM8-1", "protein_name": "RanBP-type and C3HC4-type zinc finger-containing protein 1", "gene_name": "RBCK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96EP0-1", "protein_name": "E3 ubiquitin-protein ligase RNF31", "gene_name": "RNF31", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H0F6-1", "protein_name": "Sharpin", "gene_name": "SHARPIN", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5VV17-1", "protein_name": "OTU domain-containing protein 1", "gene_name": "OTUD1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96AX9-1", "protein_name": "E3 ubiquitin-protein ligase MIB2", "gene_name": "MIB2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TCT8-1", "protein_name": "Signal peptide peptidase-like 2A", "gene_name": "SPPL2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14920-1", "protein_name": "Inhibitor of nuclear factor kappa-B kinase subunit beta", "gene_name": "IKBKB", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61077-1", "protein_name": "Ubiquitin-conjugating enzyme E2 D3", "gene_name": "UBE2D3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51668-1", "protein_name": "Ubiquitin-conjugating enzyme E2 D1", "gene_name": "UBE2D1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86VP1-1", "protein_name": "Tax1-binding protein 1", "gene_name": "TAX1BP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13158-1", "protein_name": "FAS-associated death domain protein", "gene_name": "FADD", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6GQQ9-1", "protein_name": "OTU domain-containing protein 7B", "gene_name": "OTUD7B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NQC7-1", "protein_name": "Ubiquitin carboxyl-terminal hydrolase CYLD", "gene_name": "CYLD", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UK80-1", "protein_name": "Ubiquitin carboxyl-terminal hydrolase 21", "gene_name": "USP21", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TCT7-1", "protein_name": "Signal peptide peptidase-like 2B", "gene_name": "SPPL2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96CV9-1", "protein_name": "Optineurin", "gene_name": "OPTN", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13077-1", "protein_name": "TNF receptor-associated factor 1", "gene_name": "TRAF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14790-1", "protein_name": "Caspase-8", "gene_name": "CASP8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15628-1", "protein_name": "Tumor necrosis factor receptor type 1-associated DEATH domain protein", "gene_name": "TRADD", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13490-1", "protein_name": "Baculoviral IAP repeat-containing protein 2", "gene_name": "BIRC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62979-1", "protein_name": "Ubiquitin-ribosomal protein eS31 fusion protein", "gene_name": "RPS27A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62837-1", "protein_name": "Ubiquitin-conjugating enzyme E2 D2", "gene_name": "UBE2D2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13489-1", "protein_name": "Baculoviral IAP repeat-containing protein 3", "gene_name": "BIRC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01375-1", "protein_name": "Tumor necrosis factor", "gene_name": "TNF", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG47-1", "protein_name": "Polyubiquitin-B", "gene_name": "UBB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96BN8-1", "protein_name": "Ubiquitin thioesterase otulin", "gene_name": "OTULIN", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62987-1", "protein_name": "Ubiquitin-ribosomal protein eL40 fusion protein", "gene_name": "UBA52", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8WXG6-1", "protein_name": "MAP kinase-activating death domain protein", "gene_name": "MADD", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12933-1", "protein_name": "TNF receptor-associated factor 2", "gene_name": "TRAF2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y6K9-1", "protein_name": "NF-kappa-B essential modulator", "gene_name": "IKBKG", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13107-1", "protein_name": "Ubiquitin carboxyl-terminal hydrolase 4", "gene_name": "USP4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P63244-1", "protein_name": "Small ribosomal subunit protein RACK1", "gene_name": "RACK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG48-1", "protein_name": "Polyubiquitin-C", "gene_name": "UBC", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75604-1", "protein_name": "Ubiquitin carboxyl-terminal hydrolase 2", "gene_name": "USP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UNE7-1", "protein_name": "E3 ubiquitin-protein ligase CHIP", "gene_name": "STUB1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q14164", "url": "https://www.uniprot.org/uniprotkb/Q14164" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.11577081", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 47 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "A20 inhibits tumor necrosis factor (TNF) alpha-induced apoptosis by disrupting recruitment of TRADD and RIP to the TNF receptor 1 complex in Jurkat T cells.", "journal": "Molecular and cellular biology", "date": "2002", "authors": "He KL, Ting AT", "reference": { "type": "PubMed", "id": "12167698", "url": "https://pubmed.ncbi.nlm.nih.gov/12167698" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q14164-1", "protein_name": "Inhibitor of nuclear factor kappa-B kinase subunit epsilon", "gene_name": "IKBKE", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UHD2-1", "protein_name": "Serine/threonine-protein kinase TBK1", "gene_name": "TBK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15111-1", "protein_name": "Inhibitor of nuclear factor kappa-B kinase subunit alpha", "gene_name": "CHUK", "tax_name": "Human" }, { "uniprot_canonical_ac": "P98170-1", "protein_name": "E3 ubiquitin-protein ligase XIAP", "gene_name": "XIAP", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13546-1", "protein_name": "Receptor-interacting serine/threonine-protein kinase 1", "gene_name": "RIPK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75385-1", "protein_name": "Serine/threonine-protein kinase ULK1", "gene_name": "ULK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P21580-1", "protein_name": "Tumor necrosis factor alpha-induced protein 3", "gene_name": "TNFAIP3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68036-1", "protein_name": "Ubiquitin-conjugating enzyme E2 L3", "gene_name": "UBE2L3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96DZ5-1", "protein_name": "CAP-Gly domain-containing linker protein 3", "gene_name": "CLIP3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P19438-1", "protein_name": "Tumor necrosis factor receptor superfamily member 1A", "gene_name": "TNFRSF1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UM82-1", "protein_name": "Spermatogenesis-associated protein 2", "gene_name": "SPATA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49137-1", "protein_name": "MAP kinase-activated protein kinase 2", "gene_name": "MAPKAPK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BYM8-1", "protein_name": "RanBP-type and C3HC4-type zinc finger-containing protein 1", "gene_name": "RBCK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96EP0-1", "protein_name": "E3 ubiquitin-protein ligase RNF31", "gene_name": "RNF31", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H0F6-1", "protein_name": "Sharpin", "gene_name": "SHARPIN", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5VV17-1", "protein_name": "OTU domain-containing protein 1", "gene_name": "OTUD1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96AX9-1", "protein_name": "E3 ubiquitin-protein ligase MIB2", "gene_name": "MIB2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TCT8-1", "protein_name": "Signal peptide peptidase-like 2A", "gene_name": "SPPL2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14920-1", "protein_name": "Inhibitor of nuclear factor kappa-B kinase subunit beta", "gene_name": "IKBKB", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61077-1", "protein_name": "Ubiquitin-conjugating enzyme E2 D3", "gene_name": "UBE2D3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51668-1", "protein_name": "Ubiquitin-conjugating enzyme E2 D1", "gene_name": "UBE2D1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86VP1-1", "protein_name": "Tax1-binding protein 1", "gene_name": "TAX1BP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13158-1", "protein_name": "FAS-associated death domain protein", "gene_name": "FADD", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6GQQ9-1", "protein_name": "OTU domain-containing protein 7B", "gene_name": "OTUD7B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NQC7-1", "protein_name": "Ubiquitin carboxyl-terminal hydrolase CYLD", "gene_name": "CYLD", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UK80-1", "protein_name": "Ubiquitin carboxyl-terminal hydrolase 21", "gene_name": "USP21", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TCT7-1", "protein_name": "Signal peptide peptidase-like 2B", "gene_name": "SPPL2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96CV9-1", "protein_name": "Optineurin", "gene_name": "OPTN", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13077-1", "protein_name": "TNF receptor-associated factor 1", "gene_name": "TRAF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14790-1", "protein_name": "Caspase-8", "gene_name": "CASP8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15628-1", "protein_name": "Tumor necrosis factor receptor type 1-associated DEATH domain protein", "gene_name": "TRADD", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13490-1", "protein_name": "Baculoviral IAP repeat-containing protein 2", "gene_name": "BIRC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62979-1", "protein_name": "Ubiquitin-ribosomal protein eS31 fusion protein", "gene_name": "RPS27A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62837-1", "protein_name": "Ubiquitin-conjugating enzyme E2 D2", "gene_name": "UBE2D2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13489-1", "protein_name": "Baculoviral IAP repeat-containing protein 3", "gene_name": "BIRC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01375-1", "protein_name": "Tumor necrosis factor", "gene_name": "TNF", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG47-1", "protein_name": "Polyubiquitin-B", "gene_name": "UBB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96BN8-1", "protein_name": "Ubiquitin thioesterase otulin", "gene_name": "OTULIN", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62987-1", "protein_name": "Ubiquitin-ribosomal protein eL40 fusion protein", "gene_name": "UBA52", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12933-1", "protein_name": "TNF receptor-associated factor 2", "gene_name": "TRAF2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y6K9-1", "protein_name": "NF-kappa-B essential modulator", "gene_name": "IKBKG", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13107-1", "protein_name": "Ubiquitin carboxyl-terminal hydrolase 4", "gene_name": "USP4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P63244-1", "protein_name": "Small ribosomal subunit protein RACK1", "gene_name": "RACK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG48-1", "protein_name": "Polyubiquitin-C", "gene_name": "UBC", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75604-1", "protein_name": "Ubiquitin carboxyl-terminal hydrolase 2", "gene_name": "USP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UNE7-1", "protein_name": "E3 ubiquitin-protein ligase CHIP", "gene_name": "STUB1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q14164", "url": "https://www.uniprot.org/uniprotkb/Q14164" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.12167698", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 46 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Caspase-mediated cleavage converts the tumor necrosis factor (TNF) receptor-associated factor (TRAF)-1 from a selective modulator of TNF receptor signaling to a general inhibitor of NF-kappaB activation.", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "Henkler F, Baumann B, Fotin-Mleczek M, Weingartner M, Schwenzer R, Peters N, Graness A, Wirth T, Scheurich P, Schmid JA, Wajant H", "reference": { "type": "PubMed", "id": "12709429", "url": "https://pubmed.ncbi.nlm.nih.gov/12709429" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q14164-1", "protein_name": "Inhibitor of nuclear factor kappa-B kinase subunit epsilon", "gene_name": "IKBKE", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UHD2-1", "protein_name": "Serine/threonine-protein kinase TBK1", "gene_name": "TBK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15111-1", "protein_name": "Inhibitor of nuclear factor kappa-B kinase subunit alpha", "gene_name": "CHUK", "tax_name": "Human" }, { "uniprot_canonical_ac": "P98170-1", "protein_name": "E3 ubiquitin-protein ligase XIAP", "gene_name": "XIAP", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13546-1", "protein_name": "Receptor-interacting serine/threonine-protein kinase 1", "gene_name": "RIPK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75385-1", "protein_name": "Serine/threonine-protein kinase ULK1", "gene_name": "ULK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P21580-1", "protein_name": "Tumor necrosis factor alpha-induced protein 3", "gene_name": "TNFAIP3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68036-1", "protein_name": "Ubiquitin-conjugating enzyme E2 L3", "gene_name": "UBE2L3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96DZ5-1", "protein_name": "CAP-Gly domain-containing linker protein 3", "gene_name": "CLIP3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P19438-1", "protein_name": "Tumor necrosis factor receptor superfamily member 1A", "gene_name": "TNFRSF1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UM82-1", "protein_name": "Spermatogenesis-associated protein 2", "gene_name": "SPATA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49137-1", "protein_name": "MAP kinase-activated protein kinase 2", "gene_name": "MAPKAPK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BYM8-1", "protein_name": "RanBP-type and C3HC4-type zinc finger-containing protein 1", "gene_name": "RBCK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96EP0-1", "protein_name": "E3 ubiquitin-protein ligase RNF31", "gene_name": "RNF31", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H0F6-1", "protein_name": "Sharpin", "gene_name": "SHARPIN", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5VV17-1", "protein_name": "OTU domain-containing protein 1", "gene_name": "OTUD1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96AX9-1", "protein_name": "E3 ubiquitin-protein ligase MIB2", "gene_name": "MIB2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TCT8-1", "protein_name": "Signal peptide peptidase-like 2A", "gene_name": "SPPL2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14920-1", "protein_name": "Inhibitor of nuclear factor kappa-B kinase subunit beta", "gene_name": "IKBKB", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61077-1", "protein_name": "Ubiquitin-conjugating enzyme E2 D3", "gene_name": "UBE2D3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51668-1", "protein_name": "Ubiquitin-conjugating enzyme E2 D1", "gene_name": "UBE2D1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86VP1-1", "protein_name": "Tax1-binding protein 1", "gene_name": "TAX1BP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13158-1", "protein_name": "FAS-associated death domain protein", "gene_name": "FADD", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6GQQ9-1", "protein_name": "OTU domain-containing protein 7B", "gene_name": "OTUD7B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NQC7-1", "protein_name": "Ubiquitin carboxyl-terminal hydrolase CYLD", "gene_name": "CYLD", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UK80-1", "protein_name": "Ubiquitin carboxyl-terminal hydrolase 21", "gene_name": "USP21", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TCT7-1", "protein_name": "Signal peptide peptidase-like 2B", "gene_name": "SPPL2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96CV9-1", "protein_name": "Optineurin", "gene_name": "OPTN", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13077-1", "protein_name": "TNF receptor-associated factor 1", "gene_name": "TRAF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14790-1", "protein_name": "Caspase-8", "gene_name": "CASP8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15628-1", "protein_name": "Tumor necrosis factor receptor type 1-associated DEATH domain protein", "gene_name": "TRADD", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13490-1", "protein_name": "Baculoviral IAP repeat-containing protein 2", "gene_name": "BIRC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62979-1", "protein_name": "Ubiquitin-ribosomal protein eS31 fusion protein", "gene_name": "RPS27A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62837-1", "protein_name": "Ubiquitin-conjugating enzyme E2 D2", "gene_name": "UBE2D2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13489-1", "protein_name": "Baculoviral IAP repeat-containing protein 3", "gene_name": "BIRC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01375-1", "protein_name": "Tumor necrosis factor", "gene_name": "TNF", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG47-1", "protein_name": "Polyubiquitin-B", "gene_name": "UBB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96BN8-1", "protein_name": "Ubiquitin thioesterase otulin", "gene_name": "OTULIN", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62987-1", "protein_name": "Ubiquitin-ribosomal protein eL40 fusion protein", "gene_name": "UBA52", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12933-1", "protein_name": "TNF receptor-associated factor 2", "gene_name": "TRAF2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y6K9-1", "protein_name": "NF-kappa-B essential modulator", "gene_name": "IKBKG", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13107-1", "protein_name": "Ubiquitin carboxyl-terminal hydrolase 4", "gene_name": "USP4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P63244-1", "protein_name": "Small ribosomal subunit protein RACK1", "gene_name": "RACK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG48-1", "protein_name": "Polyubiquitin-C", "gene_name": "UBC", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75604-1", "protein_name": "Ubiquitin carboxyl-terminal hydrolase 2", "gene_name": "USP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UNE7-1", "protein_name": "E3 ubiquitin-protein ligase CHIP", "gene_name": "STUB1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q14164", "url": "https://www.uniprot.org/uniprotkb/Q14164" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.12709429", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 46 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Fas-associated death domain protein and caspase-8 are not recruited to the tumor necrosis factor receptor 1 signaling complex during tumor necrosis factor-induced apoptosis.", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "Harper N, Hughes M, MacFarlane M, Cohen GM", "reference": { "type": "PubMed", "id": "12721308", "url": "https://pubmed.ncbi.nlm.nih.gov/12721308" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q14164-1", "protein_name": "Inhibitor of nuclear factor kappa-B kinase subunit epsilon", "gene_name": "IKBKE", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UHD2-1", "protein_name": "Serine/threonine-protein kinase TBK1", "gene_name": "TBK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P98170-1", "protein_name": "E3 ubiquitin-protein ligase XIAP", "gene_name": "XIAP", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13546-1", "protein_name": "Receptor-interacting serine/threonine-protein kinase 1", "gene_name": "RIPK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P21580-1", "protein_name": "Tumor necrosis factor alpha-induced protein 3", "gene_name": "TNFAIP3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P19438-1", "protein_name": "Tumor necrosis factor receptor superfamily member 1A", "gene_name": "TNFRSF1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UM82-1", "protein_name": "Spermatogenesis-associated protein 2", "gene_name": "SPATA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BYM8-1", "protein_name": "RanBP-type and C3HC4-type zinc finger-containing protein 1", "gene_name": "RBCK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96EP0-1", "protein_name": "E3 ubiquitin-protein ligase RNF31", "gene_name": "RNF31", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H0F6-1", "protein_name": "Sharpin", "gene_name": "SHARPIN", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5VV17-1", "protein_name": "OTU domain-containing protein 1", "gene_name": "OTUD1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96AX9-1", "protein_name": "E3 ubiquitin-protein ligase MIB2", "gene_name": "MIB2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13158-1", "protein_name": "FAS-associated death domain protein", "gene_name": "FADD", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6GQQ9-1", "protein_name": "OTU domain-containing protein 7B", "gene_name": "OTUD7B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NQC7-1", "protein_name": "Ubiquitin carboxyl-terminal hydrolase CYLD", "gene_name": "CYLD", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UK80-1", "protein_name": "Ubiquitin carboxyl-terminal hydrolase 21", "gene_name": "USP21", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96CV9-1", "protein_name": "Optineurin", "gene_name": "OPTN", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14790-1", "protein_name": "Caspase-8", "gene_name": "CASP8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15628-1", "protein_name": "Tumor necrosis factor receptor type 1-associated DEATH domain protein", "gene_name": "TRADD", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13490-1", "protein_name": "Baculoviral IAP repeat-containing protein 2", "gene_name": "BIRC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13489-1", "protein_name": "Baculoviral IAP repeat-containing protein 3", "gene_name": "BIRC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01375-1", "protein_name": "Tumor necrosis factor", "gene_name": "TNF", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12933-1", "protein_name": "TNF receptor-associated factor 2", "gene_name": "TRAF2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13107-1", "protein_name": "Ubiquitin carboxyl-terminal hydrolase 4", "gene_name": "USP4", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75604-1", "protein_name": "Ubiquitin carboxyl-terminal hydrolase 2", "gene_name": "USP2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q14164", "url": "https://www.uniprot.org/uniprotkb/Q14164" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.12721308", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 25 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Induction of TNF receptor I-mediated apoptosis via two sequential signaling complexes.", "journal": "Cell", "date": "2003", "authors": "Micheau O, Tschopp J", "reference": { "type": "PubMed", "id": "12887920", "url": "https://pubmed.ncbi.nlm.nih.gov/12887920" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q14164-1", "protein_name": "Inhibitor of nuclear factor kappa-B kinase subunit epsilon", "gene_name": "IKBKE", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UHD2-1", "protein_name": "Serine/threonine-protein kinase TBK1", "gene_name": "TBK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P98170-1", "protein_name": "E3 ubiquitin-protein ligase XIAP", "gene_name": "XIAP", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13546-1", "protein_name": "Receptor-interacting serine/threonine-protein kinase 1", "gene_name": "RIPK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00220-1", "protein_name": "Tumor necrosis factor receptor superfamily member 10A", "gene_name": "TNFRSF10A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P21580-1", "protein_name": "Tumor necrosis factor alpha-induced protein 3", "gene_name": "TNFAIP3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P19438-1", "protein_name": "Tumor necrosis factor receptor superfamily member 1A", "gene_name": "TNFRSF1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UM82-1", "protein_name": "Spermatogenesis-associated protein 2", "gene_name": "SPATA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BYM8-1", "protein_name": "RanBP-type and C3HC4-type zinc finger-containing protein 1", "gene_name": "RBCK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96EP0-1", "protein_name": "E3 ubiquitin-protein ligase RNF31", "gene_name": "RNF31", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H0F6-1", "protein_name": "Sharpin", "gene_name": "SHARPIN", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5VV17-1", "protein_name": "OTU domain-containing protein 1", "gene_name": "OTUD1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96AX9-1", "protein_name": "E3 ubiquitin-protein ligase MIB2", "gene_name": "MIB2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P25445-1", "protein_name": "Tumor necrosis factor receptor superfamily member 6", "gene_name": "FAS", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13158-1", "protein_name": "FAS-associated death domain protein", "gene_name": "FADD", "tax_name": "Human" }, { "uniprot_canonical_ac": "P48023-1", "protein_name": "Tumor necrosis factor ligand superfamily member 6", "gene_name": "FASLG", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6GQQ9-1", "protein_name": "OTU domain-containing protein 7B", "gene_name": "OTUD7B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NQC7-1", "protein_name": "Ubiquitin carboxyl-terminal hydrolase CYLD", "gene_name": "CYLD", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UK80-1", "protein_name": "Ubiquitin carboxyl-terminal hydrolase 21", "gene_name": "USP21", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96CV9-1", "protein_name": "Optineurin", "gene_name": "OPTN", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14790-1", "protein_name": "Caspase-8", "gene_name": "CASP8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P50591-1", "protein_name": "Tumor necrosis factor ligand superfamily member 10", "gene_name": "TNFSF10", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15628-1", "protein_name": "Tumor necrosis factor receptor type 1-associated DEATH domain protein", "gene_name": "TRADD", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13490-1", "protein_name": "Baculoviral IAP repeat-containing protein 2", "gene_name": "BIRC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13489-1", "protein_name": "Baculoviral IAP repeat-containing protein 3", "gene_name": "BIRC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01375-1", "protein_name": "Tumor necrosis factor", "gene_name": "TNF", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14763-1", "protein_name": "Tumor necrosis factor receptor superfamily member 10B", "gene_name": "TNFRSF10B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12933-1", "protein_name": "TNF receptor-associated factor 2", "gene_name": "TRAF2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13107-1", "protein_name": "Ubiquitin carboxyl-terminal hydrolase 4", "gene_name": "USP4", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75604-1", "protein_name": "Ubiquitin carboxyl-terminal hydrolase 2", "gene_name": "USP2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q14164", "url": "https://www.uniprot.org/uniprotkb/Q14164" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.12887920", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 30 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "LPS-TLR4 signaling to IRF-3/7 and NF-kappaB involves the toll adapters TRAM and TRIF.", "journal": "The Journal of experimental medicine", "date": "2003", "authors": "Fitzgerald KA, Rowe DC, Barnes BJ, Caffrey DR, Visintin A, Latz E, Monks B, Pitha PM, Golenbock DT", "reference": { "type": "PubMed", "id": "14517278", "url": "https://pubmed.ncbi.nlm.nih.gov/14517278" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q14164-1", "protein_name": "Inhibitor of nuclear factor kappa-B kinase subunit epsilon", "gene_name": "IKBKE", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UHD2-1", "protein_name": "Serine/threonine-protein kinase TBK1", "gene_name": "TBK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92844-1", "protein_name": "TRAF family member-associated NF-kappa-B activator", "gene_name": "TANK", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14653-1", "protein_name": "Interferon regulatory factor 3", "gene_name": "IRF3", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00206-1", "protein_name": "Toll-like receptor 4", "gene_name": "TLR4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y6Y9-1", "protein_name": "Lymphocyte antigen 96", "gene_name": "LY96", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96CV9-1", "protein_name": "Optineurin", "gene_name": "OPTN", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92985-1", "protein_name": "Interferon regulatory factor 7", "gene_name": "IRF7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q06124-2", "protein_name": "Tyrosine-protein phosphatase non-receptor type 11", "gene_name": "PTPN11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62979-1", "protein_name": "Ubiquitin-ribosomal protein eS31 fusion protein", "gene_name": "RPS27A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15455-1", "protein_name": "Toll-like receptor 3", "gene_name": "TLR3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG47-1", "protein_name": "Polyubiquitin-B", "gene_name": "UBB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13114-1", "protein_name": "TNF receptor-associated factor 3", "gene_name": "TRAF3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P08571-1", "protein_name": "Monocyte differentiation antigen CD14", "gene_name": "CD14", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62987-1", "protein_name": "Ubiquitin-ribosomal protein eL40 fusion protein", "gene_name": "UBA52", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86XR7-1", "protein_name": "TIR domain-containing adapter molecule 2", "gene_name": "TICAM2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8IUC6-1", "protein_name": "TIR domain-containing adapter molecule 1", "gene_name": "TICAM1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG48-1", "protein_name": "Polyubiquitin-C", "gene_name": "UBC", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8BJQ4-1", "protein_name": "TIR domain-containing adapter molecule 2", "gene_name": "Ticam2", "tax_name": "Mouse" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q14164", "url": "https://www.uniprot.org/uniprotkb/Q14164" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 477, "end_pos": 477, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by TBK1 and IKKE", "evidence": [ { "database": "UniProtKB", "id": "Q92985", "url": "https://www.uniprot.org/uniprotkb/Q92985" }, { "database": "PRO", "id": "Q92985", "url": "https://proconsortium.org/cgi-bin/entry_pro?id=Q92985" }, { "database": "iPTMnet", "id": "Q92985", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q92985" }, { "database": "PubMed", "id": "10893229", "url": "https://pubmed.ncbi.nlm.nih.gov/10893229" }, { "database": "PubMed", "id": "14517278", "url": "https://pubmed.ncbi.nlm.nih.gov/14517278" }, { "database": "PubMed", "id": "28367002", "url": "https://pubmed.ncbi.nlm.nih.gov/28367002" }, { "database": "PubMed", "id": "28768858", "url": "https://pubmed.ncbi.nlm.nih.gov/28768858" }, { "database": "PubMed", "id": "15367631", "url": "https://pubmed.ncbi.nlm.nih.gov/15367631" } ], "site_lbl": "Ser477", "uniprot_canonical_ac": "Q92985-1" }, { "start_pos": 479, "end_pos": 479, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by TBK1 and IKKE", "evidence": [ { "database": "UniProtKB", "id": "Q92985", "url": "https://www.uniprot.org/uniprotkb/Q92985" }, { "database": "PRO", "id": "Q92985", "url": "https://proconsortium.org/cgi-bin/entry_pro?id=Q92985" }, { "database": "iPTMnet", "id": "Q92985", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q92985" }, { "database": "PubMed", "id": "10893229", "url": "https://pubmed.ncbi.nlm.nih.gov/10893229" }, { "database": "PubMed", "id": "14517278", "url": "https://pubmed.ncbi.nlm.nih.gov/14517278" }, { "database": "PubMed", "id": "28367002", "url": "https://pubmed.ncbi.nlm.nih.gov/28367002" }, { "database": "PubMed", "id": "15367631", "url": "https://pubmed.ncbi.nlm.nih.gov/15367631" } ], "site_lbl": "Ser479", "uniprot_canonical_ac": "Q92985-1" } ], "mutagenesis": [ { "start_pos": 116, "end_pos": 116, "sequence_org": "P", "sequence_mut": "H", "comment": "Loss of ability to dimerize. Significant loss of RANTES-inducing activity. Loss of ability to induce NF-kappa-B activation.", "evidence": [ { "database": "UniProtKB", "id": "Q86XR7", "url": "https://www.uniprot.org/uniprotkb/Q86XR7" }, { "database": "PubMed", "id": "14517278", "url": "https://pubmed.ncbi.nlm.nih.gov/14517278" }, { "database": "PubMed", "id": "14519765", "url": "https://pubmed.ncbi.nlm.nih.gov/14519765" } ], "uniprot_canonical_ac": "Q86XR7-1" }, { "start_pos": 117, "end_pos": 117, "sequence_org": "C", "sequence_mut": "H", "comment": "Loss of ability to dimerize. Loss of RANTES-inducing activity and ability to induce NF-kappa-B activation. Inhibition of TLR4-dependent activation of IRF3 and IRF7. Loss of interaction with TLR4.", "evidence": [ { "database": "UniProtKB", "id": "Q86XR7", "url": "https://www.uniprot.org/uniprotkb/Q86XR7" }, { "database": "PubMed", "id": "14517278", "url": "https://pubmed.ncbi.nlm.nih.gov/14517278" }, { "database": "PubMed", "id": "14519765", "url": "https://pubmed.ncbi.nlm.nih.gov/14519765" } ], "uniprot_canonical_ac": "Q86XR7-1" } ], "record_id": "pubmed.14517278", "abstract": "", "glycosylation": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 19 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "X-ray crystal structure of IRF-3 and its functional implications.", "journal": "Nature structural biology", "date": "2003", "authors": "Takahasi K, Suzuki NN, Horiuchi M, Mori M, Suhara W, Okabe Y, Fukuhara Y, Terasawa H, Akira S, Fujita T, Inagaki F", "reference": { "type": "PubMed", "id": "14555995", "url": "https://pubmed.ncbi.nlm.nih.gov/14555995" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q14164-1", "protein_name": "Inhibitor of nuclear factor kappa-B kinase subunit epsilon", "gene_name": "IKBKE", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UHD2-1", "protein_name": "Serine/threonine-protein kinase TBK1", "gene_name": "TBK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92844-1", "protein_name": "TRAF family member-associated NF-kappa-B activator", "gene_name": "TANK", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14653-1", "protein_name": "Interferon regulatory factor 3", "gene_name": "IRF3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62985-1", "protein_name": "Ubiquitin-ribosomal protein eL40 fusion protein", "gene_name": "UBA52", "tax_name": "Chicken" }, { "uniprot_canonical_ac": "A0A8V0ZHE2-1", "protein_name": "TRAF family member associated NFKB activator", "gene_name": "TANK", "tax_name": "Chicken" }, { "uniprot_canonical_ac": "Q96CV9-1", "protein_name": "Optineurin", "gene_name": "OPTN", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92985-1", "protein_name": "Interferon regulatory factor 7", "gene_name": "IRF7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG62-1", "protein_name": "Polyubiquitin-B", "gene_name": "UBB", "tax_name": "Chicken" }, { "uniprot_canonical_ac": "P62979-1", "protein_name": "Ubiquitin-ribosomal protein eS31 fusion protein", "gene_name": "RPS27A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15455-1", "protein_name": "Toll-like receptor 3", "gene_name": "TLR3", "tax_name": "Human" }, { "uniprot_canonical_ac": "E1C626-1", "protein_name": "TNF receptor-associated factor", "gene_name": "TRAF6", "tax_name": "Chicken" }, { "uniprot_canonical_ac": "P79781-1", "protein_name": "Ubiquitin-ribosomal protein eS31 fusion protein", "gene_name": "RPS27A", "tax_name": "Chicken" }, { "uniprot_canonical_ac": "Q90643-1", "protein_name": "Interferon regulatory factor 3", "gene_name": "IRF3", "tax_name": "Chicken" }, { "uniprot_canonical_ac": "P0CG47-1", "protein_name": "Polyubiquitin-B", "gene_name": "UBB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13114-1", "protein_name": "TNF receptor-associated factor 3", "gene_name": "TRAF3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62987-1", "protein_name": "Ubiquitin-ribosomal protein eL40 fusion protein", "gene_name": "UBA52", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8IUC6-1", "protein_name": "TIR domain-containing adapter molecule 1", "gene_name": "TICAM1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG48-1", "protein_name": "Polyubiquitin-C", "gene_name": "UBC", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q14164", "url": "https://www.uniprot.org/uniprotkb/Q14164" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.14555995", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 19 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Identification of NAP1, a regulatory subunit of IkappaB kinase-related kinases that potentiates NF-kappaB signaling.", "journal": "Mol. Cell. Biol.", "date": "2003", "authors": "Fujita F, Taniguchi Y, Kato T, Narita Y, Furuya A, Ogawa T, Sakurai H, Joh T, Itoh M, Delhase M, Karin M, Nakanishi M", "reference": { "type": "PubMed", "id": "14560022", "url": "https://pubmed.ncbi.nlm.nih.gov/14560022" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q14164-1", "protein_name": "Inhibitor of nuclear factor kappa-B kinase subunit epsilon", "gene_name": "IKBKE", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UHD2-1", "protein_name": "Serine/threonine-protein kinase TBK1", "gene_name": "TBK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H6S1-1", "protein_name": "5-azacytidine-induced protein 2", "gene_name": "AZI2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q14164", "url": "https://www.uniprot.org/uniprotkb/Q14164" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.14560022", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "IG20, in contrast to DENN-SV, (MADD splice variants) suppresses tumor cell survival, and enhances their susceptibility to apoptosis and cancer drugs.", "journal": "Oncogene", "date": "2004", "authors": "Efimova EV, Al-Zoubi AM, Martinez O, Kaithamana S, Lu S, Arima T, Prabhakar BS", "reference": { "type": "PubMed", "id": "14716293", "url": "https://pubmed.ncbi.nlm.nih.gov/14716293" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q14164-1", "protein_name": "Inhibitor of nuclear factor kappa-B kinase subunit epsilon", "gene_name": "IKBKE", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UHD2-1", "protein_name": "Serine/threonine-protein kinase TBK1", "gene_name": "TBK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15111-1", "protein_name": "Inhibitor of nuclear factor kappa-B kinase subunit alpha", "gene_name": "CHUK", "tax_name": "Human" }, { "uniprot_canonical_ac": "P98170-1", "protein_name": "E3 ubiquitin-protein ligase XIAP", "gene_name": "XIAP", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13546-1", "protein_name": "Receptor-interacting serine/threonine-protein kinase 1", "gene_name": "RIPK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75385-1", "protein_name": "Serine/threonine-protein kinase ULK1", "gene_name": "ULK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P21580-1", "protein_name": "Tumor necrosis factor alpha-induced protein 3", "gene_name": "TNFAIP3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68036-1", "protein_name": "Ubiquitin-conjugating enzyme E2 L3", "gene_name": "UBE2L3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96DZ5-1", "protein_name": "CAP-Gly domain-containing linker protein 3", "gene_name": "CLIP3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P19438-1", "protein_name": "Tumor necrosis factor receptor superfamily member 1A", "gene_name": "TNFRSF1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UM82-1", "protein_name": "Spermatogenesis-associated protein 2", "gene_name": "SPATA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49137-1", "protein_name": "MAP kinase-activated protein kinase 2", "gene_name": "MAPKAPK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BYM8-1", "protein_name": "RanBP-type and C3HC4-type zinc finger-containing protein 1", "gene_name": "RBCK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96EP0-1", "protein_name": "E3 ubiquitin-protein ligase RNF31", "gene_name": "RNF31", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H0F6-1", "protein_name": "Sharpin", "gene_name": "SHARPIN", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5VV17-1", "protein_name": "OTU domain-containing protein 1", "gene_name": "OTUD1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96AX9-1", "protein_name": "E3 ubiquitin-protein ligase MIB2", "gene_name": "MIB2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TCT8-1", "protein_name": "Signal peptide peptidase-like 2A", "gene_name": "SPPL2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14920-1", "protein_name": "Inhibitor of nuclear factor kappa-B kinase subunit beta", "gene_name": "IKBKB", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61077-1", "protein_name": "Ubiquitin-conjugating enzyme E2 D3", "gene_name": "UBE2D3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51668-1", "protein_name": "Ubiquitin-conjugating enzyme E2 D1", "gene_name": "UBE2D1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86VP1-1", "protein_name": "Tax1-binding protein 1", "gene_name": "TAX1BP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13158-1", "protein_name": "FAS-associated death domain protein", "gene_name": "FADD", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6GQQ9-1", "protein_name": "OTU domain-containing protein 7B", "gene_name": "OTUD7B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NQC7-1", "protein_name": "Ubiquitin carboxyl-terminal hydrolase CYLD", "gene_name": "CYLD", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UK80-1", "protein_name": "Ubiquitin carboxyl-terminal hydrolase 21", "gene_name": "USP21", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TCT7-1", "protein_name": "Signal peptide peptidase-like 2B", "gene_name": "SPPL2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96CV9-1", "protein_name": "Optineurin", "gene_name": "OPTN", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13077-1", "protein_name": "TNF receptor-associated factor 1", "gene_name": "TRAF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14790-1", "protein_name": "Caspase-8", "gene_name": "CASP8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15628-1", "protein_name": "Tumor necrosis factor receptor type 1-associated DEATH domain protein", "gene_name": "TRADD", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13490-1", "protein_name": "Baculoviral IAP repeat-containing protein 2", "gene_name": "BIRC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62979-1", "protein_name": "Ubiquitin-ribosomal protein eS31 fusion protein", "gene_name": "RPS27A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62837-1", "protein_name": "Ubiquitin-conjugating enzyme E2 D2", "gene_name": "UBE2D2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13489-1", "protein_name": "Baculoviral IAP repeat-containing protein 3", "gene_name": "BIRC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01375-1", "protein_name": "Tumor necrosis factor", "gene_name": "TNF", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG47-1", "protein_name": "Polyubiquitin-B", "gene_name": "UBB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96BN8-1", "protein_name": "Ubiquitin thioesterase otulin", "gene_name": "OTULIN", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62987-1", "protein_name": "Ubiquitin-ribosomal protein eL40 fusion protein", "gene_name": "UBA52", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8WXG6-1", "protein_name": "MAP kinase-activating death domain protein", "gene_name": "MADD", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12933-1", "protein_name": "TNF receptor-associated factor 2", "gene_name": "TRAF2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y6K9-1", "protein_name": "NF-kappa-B essential modulator", "gene_name": "IKBKG", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13107-1", "protein_name": "Ubiquitin carboxyl-terminal hydrolase 4", "gene_name": "USP4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P63244-1", "protein_name": "Small ribosomal subunit protein RACK1", "gene_name": "RACK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG48-1", "protein_name": "Polyubiquitin-C", "gene_name": "UBC", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75604-1", "protein_name": "Ubiquitin carboxyl-terminal hydrolase 2", "gene_name": "USP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UNE7-1", "protein_name": "E3 ubiquitin-protein ligase CHIP", "gene_name": "STUB1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q14164", "url": "https://www.uniprot.org/uniprotkb/Q14164" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.14716293", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 47 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Mechanisms of the TRIF-induced interferon-stimulated response element and NF-kappaB activation and apoptosis pathways.", "journal": "J. Biol. Chem.", "date": "2004", "authors": "Han KJ, Su X, Xu LG, Bin LH, Zhang J, Shu HB", "reference": { "type": "PubMed", "id": "14739303", "url": "https://pubmed.ncbi.nlm.nih.gov/14739303" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q14164-1", "protein_name": "Inhibitor of nuclear factor kappa-B kinase subunit epsilon", "gene_name": "IKBKE", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UHD2-1", "protein_name": "Serine/threonine-protein kinase TBK1", "gene_name": "TBK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13546-1", "protein_name": "Receptor-interacting serine/threonine-protein kinase 1", "gene_name": "RIPK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y4K3-1", "protein_name": "TNF receptor-associated factor 6", "gene_name": "TRAF6", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14920-1", "protein_name": "Inhibitor of nuclear factor kappa-B kinase subunit beta", "gene_name": "IKBKB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14653-1", "protein_name": "Interferon regulatory factor 3", "gene_name": "IRF3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13158-1", "protein_name": "FAS-associated death domain protein", "gene_name": "FADD", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00206-1", "protein_name": "Toll-like receptor 4", "gene_name": "TLR4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y6Y9-1", "protein_name": "Lymphocyte antigen 96", "gene_name": "LY96", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92985-1", "protein_name": "Interferon regulatory factor 7", "gene_name": "IRF7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14790-1", "protein_name": "Caspase-8", "gene_name": "CASP8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y572-1", "protein_name": "Receptor-interacting serine/threonine-protein kinase 3", "gene_name": "RIPK3", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15455-1", "protein_name": "Toll-like receptor 3", "gene_name": "TLR3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P08571-1", "protein_name": "Monocyte differentiation antigen CD14", "gene_name": "CD14", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86XR7-1", "protein_name": "TIR domain-containing adapter molecule 2", "gene_name": "TICAM2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8IUC6-1", "protein_name": "TIR domain-containing adapter molecule 1", "gene_name": "TICAM1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q14164", "url": "https://www.uniprot.org/uniprotkb/Q14164" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 396, "end_pos": 396, "kinase_uniprot_canonical_ac": "Q14164-1", "kinase_gene_name": "IKBKE", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q14653", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q14653" }, { "database": "PubMed", "id": "14739303", "url": "https://pubmed.ncbi.nlm.nih.gov/14739303" }, { "database": "PubMed", "id": "16199137", "url": "https://pubmed.ncbi.nlm.nih.gov/16199137" }, { "database": "PubMed", "id": "21138416", "url": "https://pubmed.ncbi.nlm.nih.gov/21138416" } ], "site_lbl": "Ser396", "uniprot_canonical_ac": "Q14653-1" } ], "record_id": "pubmed.14739303", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 16 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "N-terminal fragment of c-FLIP(L) processed by caspase 8 specifically interacts with TRAF2 and induces activation of the NF-kappaB signaling pathway.", "journal": "Molecular and cellular biology", "date": "2004", "authors": "Kataoka T, Tschopp J", "reference": { "type": "PubMed", "id": "15024054", "url": "https://pubmed.ncbi.nlm.nih.gov/15024054" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q14164-1", "protein_name": "Inhibitor of nuclear factor kappa-B kinase subunit epsilon", "gene_name": "IKBKE", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UHD2-1", "protein_name": "Serine/threonine-protein kinase TBK1", "gene_name": "TBK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15111-1", "protein_name": "Inhibitor of nuclear factor kappa-B kinase subunit alpha", "gene_name": "CHUK", "tax_name": "Human" }, { "uniprot_canonical_ac": "P98170-1", "protein_name": "E3 ubiquitin-protein ligase XIAP", "gene_name": "XIAP", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13546-1", "protein_name": "Receptor-interacting serine/threonine-protein kinase 1", "gene_name": "RIPK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00220-1", "protein_name": "Tumor necrosis factor receptor superfamily member 10A", "gene_name": "TNFRSF10A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75385-1", "protein_name": "Serine/threonine-protein kinase ULK1", "gene_name": "ULK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P21580-1", "protein_name": "Tumor necrosis factor alpha-induced protein 3", "gene_name": "TNFAIP3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68036-1", "protein_name": "Ubiquitin-conjugating enzyme E2 L3", "gene_name": "UBE2L3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96DZ5-1", "protein_name": "CAP-Gly domain-containing linker protein 3", "gene_name": "CLIP3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P19438-1", "protein_name": "Tumor necrosis factor receptor superfamily member 1A", "gene_name": "TNFRSF1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UM82-1", "protein_name": "Spermatogenesis-associated protein 2", "gene_name": "SPATA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49137-1", "protein_name": "MAP kinase-activated protein kinase 2", "gene_name": "MAPKAPK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BYM8-1", "protein_name": "RanBP-type and C3HC4-type zinc finger-containing protein 1", "gene_name": "RBCK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96EP0-1", "protein_name": "E3 ubiquitin-protein ligase RNF31", "gene_name": "RNF31", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H0F6-1", "protein_name": "Sharpin", "gene_name": "SHARPIN", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5VV17-1", "protein_name": "OTU domain-containing protein 1", "gene_name": "OTUD1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96AX9-1", "protein_name": "E3 ubiquitin-protein ligase MIB2", "gene_name": "MIB2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TCT8-1", "protein_name": "Signal peptide peptidase-like 2A", "gene_name": "SPPL2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14920-1", "protein_name": "Inhibitor of nuclear factor kappa-B kinase subunit beta", "gene_name": "IKBKB", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61077-1", "protein_name": "Ubiquitin-conjugating enzyme E2 D3", "gene_name": "UBE2D3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51668-1", "protein_name": "Ubiquitin-conjugating enzyme E2 D1", "gene_name": "UBE2D1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86VP1-1", "protein_name": "Tax1-binding protein 1", "gene_name": "TAX1BP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P25445-1", "protein_name": "Tumor necrosis factor receptor superfamily member 6", "gene_name": "FAS", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13158-1", "protein_name": "FAS-associated death domain protein", "gene_name": "FADD", "tax_name": "Human" }, { "uniprot_canonical_ac": "P48023-1", "protein_name": "Tumor necrosis factor ligand superfamily member 6", "gene_name": "FASLG", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6GQQ9-1", "protein_name": "OTU domain-containing protein 7B", "gene_name": "OTUD7B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NQC7-1", "protein_name": "Ubiquitin carboxyl-terminal hydrolase CYLD", "gene_name": "CYLD", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UK80-1", "protein_name": "Ubiquitin carboxyl-terminal hydrolase 21", "gene_name": "USP21", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TCT7-1", "protein_name": "Signal peptide peptidase-like 2B", "gene_name": "SPPL2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96CV9-1", "protein_name": "Optineurin", "gene_name": "OPTN", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13077-1", "protein_name": "TNF receptor-associated factor 1", "gene_name": "TRAF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14790-1", "protein_name": "Caspase-8", "gene_name": "CASP8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P50591-1", "protein_name": "Tumor necrosis factor ligand superfamily member 10", "gene_name": "TNFSF10", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15628-1", "protein_name": "Tumor necrosis factor receptor type 1-associated DEATH domain protein", "gene_name": "TRADD", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13490-1", "protein_name": "Baculoviral IAP repeat-containing protein 2", "gene_name": "BIRC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62979-1", "protein_name": "Ubiquitin-ribosomal protein eS31 fusion protein", "gene_name": "RPS27A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62837-1", "protein_name": "Ubiquitin-conjugating enzyme E2 D2", "gene_name": "UBE2D2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13489-1", "protein_name": "Baculoviral IAP repeat-containing protein 3", "gene_name": "BIRC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01375-1", "protein_name": "Tumor necrosis factor", "gene_name": "TNF", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG47-1", "protein_name": "Polyubiquitin-B", "gene_name": "UBB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96BN8-1", "protein_name": "Ubiquitin thioesterase otulin", "gene_name": "OTULIN", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62987-1", "protein_name": "Ubiquitin-ribosomal protein eL40 fusion protein", "gene_name": "UBA52", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14763-1", "protein_name": "Tumor necrosis factor receptor superfamily member 10B", "gene_name": "TNFRSF10B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12933-1", "protein_name": "TNF receptor-associated factor 2", "gene_name": "TRAF2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y6K9-1", "protein_name": "NF-kappa-B essential modulator", "gene_name": "IKBKG", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13107-1", "protein_name": "Ubiquitin carboxyl-terminal hydrolase 4", "gene_name": "USP4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P63244-1", "protein_name": "Small ribosomal subunit protein RACK1", "gene_name": "RACK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG48-1", "protein_name": "Polyubiquitin-C", "gene_name": "UBC", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75604-1", "protein_name": "Ubiquitin carboxyl-terminal hydrolase 2", "gene_name": "USP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UNE7-1", "protein_name": "E3 ubiquitin-protein ligase CHIP", "gene_name": "STUB1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q14164", "url": "https://www.uniprot.org/uniprotkb/Q14164" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.15024054", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 51 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Regulation of the deubiquitinating enzyme CYLD by IkappaB kinase gamma-dependent phosphorylation.", "journal": "Molecular and cellular biology", "date": "2005", "authors": "Reiley W, Zhang M, Wu X, Granger E, Sun SC", "reference": { "type": "PubMed", "id": "15870263", "url": "https://pubmed.ncbi.nlm.nih.gov/15870263" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q14164-1", "protein_name": "Inhibitor of nuclear factor kappa-B kinase subunit epsilon", "gene_name": "IKBKE", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UHD2-1", "protein_name": "Serine/threonine-protein kinase TBK1", "gene_name": "TBK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15111-1", "protein_name": "Inhibitor of nuclear factor kappa-B kinase subunit alpha", "gene_name": "CHUK", "tax_name": "Human" }, { "uniprot_canonical_ac": "P98170-1", "protein_name": "E3 ubiquitin-protein ligase XIAP", "gene_name": "XIAP", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13546-1", "protein_name": "Receptor-interacting serine/threonine-protein kinase 1", "gene_name": "RIPK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75385-1", "protein_name": "Serine/threonine-protein kinase ULK1", "gene_name": "ULK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P21580-1", "protein_name": "Tumor necrosis factor alpha-induced protein 3", "gene_name": "TNFAIP3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68036-1", "protein_name": "Ubiquitin-conjugating enzyme E2 L3", "gene_name": "UBE2L3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96DZ5-1", "protein_name": "CAP-Gly domain-containing linker protein 3", "gene_name": "CLIP3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P19438-1", "protein_name": "Tumor necrosis factor receptor superfamily member 1A", "gene_name": "TNFRSF1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UM82-1", "protein_name": "Spermatogenesis-associated protein 2", "gene_name": "SPATA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49137-1", "protein_name": "MAP kinase-activated protein kinase 2", "gene_name": "MAPKAPK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BYM8-1", "protein_name": "RanBP-type and C3HC4-type zinc finger-containing protein 1", "gene_name": "RBCK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96EP0-1", "protein_name": "E3 ubiquitin-protein ligase RNF31", "gene_name": "RNF31", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H0F6-1", "protein_name": "Sharpin", "gene_name": "SHARPIN", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5VV17-1", "protein_name": "OTU domain-containing protein 1", "gene_name": "OTUD1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96AX9-1", "protein_name": "E3 ubiquitin-protein ligase MIB2", "gene_name": "MIB2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TCT8-1", "protein_name": "Signal peptide peptidase-like 2A", "gene_name": "SPPL2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14920-1", "protein_name": "Inhibitor of nuclear factor kappa-B kinase subunit beta", "gene_name": "IKBKB", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61077-1", "protein_name": "Ubiquitin-conjugating enzyme E2 D3", "gene_name": "UBE2D3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51668-1", "protein_name": "Ubiquitin-conjugating enzyme E2 D1", "gene_name": "UBE2D1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86VP1-1", "protein_name": "Tax1-binding protein 1", "gene_name": "TAX1BP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13158-1", "protein_name": "FAS-associated death domain protein", "gene_name": "FADD", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6GQQ9-1", "protein_name": "OTU domain-containing protein 7B", "gene_name": "OTUD7B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NQC7-1", "protein_name": "Ubiquitin carboxyl-terminal hydrolase CYLD", "gene_name": "CYLD", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UK80-1", "protein_name": "Ubiquitin carboxyl-terminal hydrolase 21", "gene_name": "USP21", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TCT7-1", "protein_name": "Signal peptide peptidase-like 2B", "gene_name": "SPPL2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96CV9-1", "protein_name": "Optineurin", "gene_name": "OPTN", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13077-1", "protein_name": "TNF receptor-associated factor 1", "gene_name": "TRAF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14790-1", "protein_name": "Caspase-8", "gene_name": "CASP8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15628-1", "protein_name": "Tumor necrosis factor receptor type 1-associated DEATH domain protein", "gene_name": "TRADD", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13490-1", "protein_name": "Baculoviral IAP repeat-containing protein 2", "gene_name": "BIRC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62979-1", "protein_name": "Ubiquitin-ribosomal protein eS31 fusion protein", "gene_name": "RPS27A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62837-1", "protein_name": "Ubiquitin-conjugating enzyme E2 D2", "gene_name": "UBE2D2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13489-1", "protein_name": "Baculoviral IAP repeat-containing protein 3", "gene_name": "BIRC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01375-1", "protein_name": "Tumor necrosis factor", "gene_name": "TNF", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG47-1", "protein_name": "Polyubiquitin-B", "gene_name": "UBB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96BN8-1", "protein_name": "Ubiquitin thioesterase otulin", "gene_name": "OTULIN", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62987-1", "protein_name": "Ubiquitin-ribosomal protein eL40 fusion protein", "gene_name": "UBA52", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12933-1", "protein_name": "TNF receptor-associated factor 2", "gene_name": "TRAF2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y6K9-1", "protein_name": "NF-kappa-B essential modulator", "gene_name": "IKBKG", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13107-1", "protein_name": "Ubiquitin carboxyl-terminal hydrolase 4", "gene_name": "USP4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P63244-1", "protein_name": "Small ribosomal subunit protein RACK1", "gene_name": "RACK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG48-1", "protein_name": "Polyubiquitin-C", "gene_name": "UBC", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75604-1", "protein_name": "Ubiquitin carboxyl-terminal hydrolase 2", "gene_name": "USP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UNE7-1", "protein_name": "E3 ubiquitin-protein ligase CHIP", "gene_name": "STUB1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q14164", "url": "https://www.uniprot.org/uniprotkb/Q14164" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 418, "end_pos": 418, "sequence_org": "S", "sequence_mut": "A", "comment": "Reduced phosphorylation; when associated with A-422; A-432 and A-436. Loss of phosphorylation; when associated with A-422; A-432; A-436; A-439; A-441 and A-444.", "evidence": [ { "database": "UniProtKB", "id": "Q9NQC7", "url": "https://www.uniprot.org/uniprotkb/Q9NQC7" }, { "database": "PubMed", "id": "15870263", "url": "https://pubmed.ncbi.nlm.nih.gov/15870263" } ], "uniprot_canonical_ac": "Q9NQC7-1" }, { "start_pos": 418, "end_pos": 418, "sequence_org": "S", "sequence_mut": "E", "comment": "Abolishes deubiquitination of TRAF2; when associated with E-422; E-432; E-436; E-439; E-441 and E-444.", "evidence": [ { "database": "UniProtKB", "id": "Q9NQC7", "url": "https://www.uniprot.org/uniprotkb/Q9NQC7" }, { "database": "PubMed", "id": "15870263", "url": "https://pubmed.ncbi.nlm.nih.gov/15870263" } ], "uniprot_canonical_ac": "Q9NQC7-1" }, { "start_pos": 422, "end_pos": 422, "sequence_org": "S", "sequence_mut": "A", "comment": "Reduced phosphorylation; when associated with A-418; A-432 and A-436. Loss of phosphorylation; when associated with A-418; A-432; A-436; A-439; A-441 and A-444.", "evidence": [ { "database": "UniProtKB", "id": "Q9NQC7", "url": "https://www.uniprot.org/uniprotkb/Q9NQC7" }, { "database": "PubMed", "id": "15870263", "url": "https://pubmed.ncbi.nlm.nih.gov/15870263" } ], "uniprot_canonical_ac": "Q9NQC7-1" }, { "start_pos": 422, "end_pos": 422, "sequence_org": "S", "sequence_mut": "E", "comment": "Abolishes deubiquitination of TRAF2; when associated with E-418; E-432; E-436; E-439; E-441 and E-444.", "evidence": [ { "database": "UniProtKB", "id": "Q9NQC7", "url": "https://www.uniprot.org/uniprotkb/Q9NQC7" }, { "database": "PubMed", "id": "15870263", "url": "https://pubmed.ncbi.nlm.nih.gov/15870263" } ], "uniprot_canonical_ac": "Q9NQC7-1" }, { "start_pos": 432, "end_pos": 432, "sequence_org": "S", "sequence_mut": "A", "comment": "Slightly reduced phosphorylation; when associated with A-436. Reduced phosphorylation; when associated with A-418; A-422 and A-436. Loss of phosphorylation; when associated with A-418; A-422; A-436; A-439; A-441 and A-444.", "evidence": [ { "database": "UniProtKB", "id": "Q9NQC7", "url": "https://www.uniprot.org/uniprotkb/Q9NQC7" }, { "database": "PubMed", "id": "15870263", "url": "https://pubmed.ncbi.nlm.nih.gov/15870263" } ], "uniprot_canonical_ac": "Q9NQC7-1" }, { "start_pos": 432, "end_pos": 432, "sequence_org": "S", "sequence_mut": "E", "comment": "Abolishes deubiquitination of TRAF2; when associated with E-418; E-422; E-436; E-439; E-441 and E-444.", "evidence": [ { "database": "UniProtKB", "id": "Q9NQC7", "url": "https://www.uniprot.org/uniprotkb/Q9NQC7" }, { "database": "PubMed", "id": "15870263", "url": "https://pubmed.ncbi.nlm.nih.gov/15870263" } ], "uniprot_canonical_ac": "Q9NQC7-1" }, { "start_pos": 436, "end_pos": 436, "sequence_org": "S", "sequence_mut": "A", "comment": "Slightly reduced phosphorylation; when associated with A-432. Reduced phosphorylation; when associated with A-418; A-422 and A-432. Loss of phosphorylation; when associated with A-418; A-422; A-432; A-439; A-441 and A-444.", "evidence": [ { "database": "UniProtKB", "id": "Q9NQC7", "url": "https://www.uniprot.org/uniprotkb/Q9NQC7" }, { "database": "PubMed", "id": "15870263", "url": "https://pubmed.ncbi.nlm.nih.gov/15870263" } ], "uniprot_canonical_ac": "Q9NQC7-1" }, { "start_pos": 436, "end_pos": 436, "sequence_org": "S", "sequence_mut": "E", "comment": "Abolishes deubiquitination of TRAF2; when associated with E-418; E-422; E-432; E-439; E-441 and E-444.", "evidence": [ { "database": "UniProtKB", "id": "Q9NQC7", "url": "https://www.uniprot.org/uniprotkb/Q9NQC7" }, { "database": "PubMed", "id": "15870263", "url": "https://pubmed.ncbi.nlm.nih.gov/15870263" } ], "uniprot_canonical_ac": "Q9NQC7-1" }, { "start_pos": 439, "end_pos": 439, "sequence_org": "S", "sequence_mut": "A", "comment": "Loss of phosphorylation; when associated with A-418; A-422; A-432; A-436; A-441 and A-444.", "evidence": [ { "database": "UniProtKB", "id": "Q9NQC7", "url": "https://www.uniprot.org/uniprotkb/Q9NQC7" }, { "database": "PubMed", "id": "15870263", "url": "https://pubmed.ncbi.nlm.nih.gov/15870263" } ], "uniprot_canonical_ac": "Q9NQC7-1" }, { "start_pos": 439, "end_pos": 439, "sequence_org": "S", "sequence_mut": "E", "comment": "Abolishes deubiquitination of TRAF2; when associated with E-418; E-422; E-432; E-436; E-441 and E-444.", "evidence": [ { "database": "UniProtKB", "id": "Q9NQC7", "url": "https://www.uniprot.org/uniprotkb/Q9NQC7" }, { "database": "PubMed", "id": "15870263", "url": "https://pubmed.ncbi.nlm.nih.gov/15870263" } ], "uniprot_canonical_ac": "Q9NQC7-1" }, { "start_pos": 441, "end_pos": 441, "sequence_org": "S", "sequence_mut": "A", "comment": "Loss of phosphorylation; when associated with A-418; A-422; A-432; A-436; A-439 and A-444.", "evidence": [ { "database": "UniProtKB", "id": "Q9NQC7", "url": "https://www.uniprot.org/uniprotkb/Q9NQC7" }, { "database": "PubMed", "id": "15870263", "url": "https://pubmed.ncbi.nlm.nih.gov/15870263" } ], "uniprot_canonical_ac": "Q9NQC7-1" }, { "start_pos": 441, "end_pos": 441, "sequence_org": "S", "sequence_mut": "E", "comment": "Abolishes deubiquitination of TRAF2; when associated with E-418; E-422; E-432; E-436; E-439 and E-444.", "evidence": [ { "database": "UniProtKB", "id": "Q9NQC7", "url": "https://www.uniprot.org/uniprotkb/Q9NQC7" }, { "database": "PubMed", "id": "15870263", "url": "https://pubmed.ncbi.nlm.nih.gov/15870263" } ], "uniprot_canonical_ac": "Q9NQC7-1" }, { "start_pos": 444, "end_pos": 444, "sequence_org": "S", "sequence_mut": "A", "comment": "Loss of phosphorylation; when associated with A-418; A-422; A-432; A-436; A-439 and A-441.", "evidence": [ { "database": "UniProtKB", "id": "Q9NQC7", "url": "https://www.uniprot.org/uniprotkb/Q9NQC7" }, { "database": "PubMed", "id": "15870263", "url": "https://pubmed.ncbi.nlm.nih.gov/15870263" } ], "uniprot_canonical_ac": "Q9NQC7-1" }, { "start_pos": 444, "end_pos": 444, "sequence_org": "S", "sequence_mut": "E", "comment": "Abolishes deubiquitination of TRAF2; when associated with E-418; E-422; E-432; E-436; E-439 and E-441.", "evidence": [ { "database": "UniProtKB", "id": "Q9NQC7", "url": "https://www.uniprot.org/uniprotkb/Q9NQC7" }, { "database": "PubMed", "id": "15870263", "url": "https://pubmed.ncbi.nlm.nih.gov/15870263" } ], "uniprot_canonical_ac": "Q9NQC7-1" } ], "phosphorylation": [ { "start_pos": 418, "end_pos": 418, "kinase_uniprot_canonical_ac": "O14920-1", "kinase_gene_name": "IKBKB", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q9NQC7", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9NQC7" }, { "database": "PubMed", "id": "15870263", "url": "https://pubmed.ncbi.nlm.nih.gov/15870263" }, { "database": "PubMed", "id": "24614225", "url": "https://pubmed.ncbi.nlm.nih.gov/24614225" } ], "site_lbl": "Ser418", "uniprot_canonical_ac": "Q9NQC7-1" }, { "start_pos": 418, "end_pos": 418, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "Q9NQC7", "url": "https://www.uniprot.org/uniprotkb/Q9NQC7" }, { "database": "PubMed", "id": "23186163", "url": "https://pubmed.ncbi.nlm.nih.gov/23186163" }, { "database": "PubMed", "id": "15870263", "url": "https://pubmed.ncbi.nlm.nih.gov/15870263" }, { "database": "PRO", "id": "Q9NQC7", "url": "https://proconsortium.org/cgi-bin/entry_pro?id=Q9NQC7" }, { "database": "iPTMnet", "id": "Q9NQC7", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9NQC7" }, { "database": "PubMed", "id": "19481526", "url": "https://pubmed.ncbi.nlm.nih.gov/19481526" }, { "database": "PubMed", "id": "24614225", "url": "https://pubmed.ncbi.nlm.nih.gov/24614225" }, { "database": "PubMed", "id": "24961988", "url": "https://pubmed.ncbi.nlm.nih.gov/24961988" }, { "database": "PubMed", "id": "29755980", "url": "https://pubmed.ncbi.nlm.nih.gov/29755980" }, { "database": "PubMed", "id": "32024820", "url": "https://pubmed.ncbi.nlm.nih.gov/32024820" } ], "site_lbl": "Ser418", "uniprot_canonical_ac": "Q9NQC7-1" } ], "record_id": "pubmed.15870263", "abstract": "", "glycosylation": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 46 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Cardif is an adaptor protein in the RIG-I antiviral pathway and is targeted by hepatitis C virus.", "journal": "Nature", "date": "2005", "authors": "Meylan E, Curran J, Hofmann K, Moradpour D, Binder M, Bartenschlager R, Tschopp J", "reference": { "type": "PubMed", "id": "16177806", "url": "https://pubmed.ncbi.nlm.nih.gov/16177806" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q14164-1", "protein_name": "Inhibitor of nuclear factor kappa-B kinase subunit epsilon", "gene_name": "IKBKE", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15111-1", "protein_name": "Inhibitor of nuclear factor kappa-B kinase subunit alpha", "gene_name": "CHUK", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8VCF0-1", "protein_name": "Mitochondrial antiviral-signaling protein", "gene_name": "Mavs", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "O14920-1", "protein_name": "Inhibitor of nuclear factor kappa-B kinase subunit beta", "gene_name": "IKBKB", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27958-1", "protein_name": "Genome polyprotein", "gene_name": "", "tax_name": "HCV" }, { "uniprot_canonical_ac": "Q7Z434-1", "protein_name": "Mitochondrial antiviral-signaling protein", "gene_name": "MAVS", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BYX4-1", "protein_name": "Interferon-induced helicase C domain-containing protein 1", "gene_name": "IFIH1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q14164", "url": "https://www.uniprot.org/uniprotkb/Q14164" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 508, "end_pos": 508, "sequence_org": "C", "sequence_mut": "A", "comment": "No cleavage by HCV and hepatitis GB virus BNS3/4A protease complex.", "evidence": [ { "database": "UniProtKB", "id": "Q7Z434", "url": "https://www.uniprot.org/uniprotkb/Q7Z434" }, { "database": "PubMed", "id": "16177806", "url": "https://pubmed.ncbi.nlm.nih.gov/16177806" }, { "database": "PubMed", "id": "16301520", "url": "https://pubmed.ncbi.nlm.nih.gov/16301520" }, { "database": "PubMed", "id": "17093192", "url": "https://pubmed.ncbi.nlm.nih.gov/17093192" } ], "uniprot_canonical_ac": "Q7Z434-1" }, { "start_pos": 508, "end_pos": 508, "sequence_org": "C", "sequence_mut": "R", "comment": "No cleavage by HCV and hepatitis GB virus BNS3/4A protease complex.", "evidence": [ { "database": "UniProtKB", "id": "Q7Z434", "url": "https://www.uniprot.org/uniprotkb/Q7Z434" }, { "database": "PubMed", "id": "16177806", "url": "https://pubmed.ncbi.nlm.nih.gov/16177806" }, { "database": "PubMed", "id": "16301520", "url": "https://pubmed.ncbi.nlm.nih.gov/16301520" }, { "database": "PubMed", "id": "17093192", "url": "https://pubmed.ncbi.nlm.nih.gov/17093192" } ], "uniprot_canonical_ac": "Q7Z434-1" } ], "record_id": "pubmed.16177806", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 7 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Specificity in Toll-like receptor signalling through distinct effector functions of TRAF3 and TRAF6.", "journal": "Nature", "date": "2006", "authors": "Hacker H, Redecke V, Blagoev B, Kratchmarova I, Hsu LC, Wang GG, Kamps MP, Raz E, Wagner H, Hacker G, Mann M, Karin M", "reference": { "type": "PubMed", "id": "16306937", "url": "https://pubmed.ncbi.nlm.nih.gov/16306937" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q14164-1", "protein_name": "Inhibitor of nuclear factor kappa-B kinase subunit epsilon", "gene_name": "IKBKE", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UHD2-1", "protein_name": "Serine/threonine-protein kinase TBK1", "gene_name": "TBK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15750-1", "protein_name": "TGF-beta-activated kinase 1 and MAP3K7-binding protein 1", "gene_name": "TAB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92844-1", "protein_name": "TRAF family member-associated NF-kappa-B activator", "gene_name": "TANK", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43187-1", "protein_name": "Interleukin-1 receptor-associated kinase-like 2", "gene_name": "IRAK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y4K3-1", "protein_name": "TNF receptor-associated factor 6", "gene_name": "TRAF6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q90879-1", "protein_name": "Ubiquitin-conjugating enzyme E2 variant 1", "gene_name": "UBE2V1", "tax_name": "Chicken" }, { "uniprot_canonical_ac": "Q60803-1", "protein_name": "TNF receptor-associated factor 3", "gene_name": "Traf3", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "Q14653-1", "protein_name": "Interferon regulatory factor 3", "gene_name": "IRF3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62985-1", "protein_name": "Ubiquitin-ribosomal protein eL40 fusion protein", "gene_name": "UBA52", "tax_name": "Chicken" }, { "uniprot_canonical_ac": "O00206-1", "protein_name": "Toll-like receptor 4", "gene_name": "TLR4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y6Y9-1", "protein_name": "Lymphocyte antigen 96", "gene_name": "LY96", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43318-1", "protein_name": "Mitogen-activated protein kinase kinase kinase 7", "gene_name": "MAP3K7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96CV9-1", "protein_name": "Optineurin", "gene_name": "OPTN", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92985-1", "protein_name": "Interferon regulatory factor 7", "gene_name": "IRF7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q06124-2", "protein_name": "Tyrosine-protein phosphatase non-receptor type 11", "gene_name": "PTPN11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG62-1", "protein_name": "Polyubiquitin-B", "gene_name": "UBB", "tax_name": "Chicken" }, { "uniprot_canonical_ac": "Q8N5C8-1", "protein_name": "TGF-beta-activated kinase 1 and MAP3K7-binding protein 3", "gene_name": "TAB3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NYJ8-1", "protein_name": "TGF-beta-activated kinase 1 and MAP3K7-binding protein 2", "gene_name": "TAB2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62979-1", "protein_name": "Ubiquitin-ribosomal protein eS31 fusion protein", "gene_name": "RPS27A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15455-1", "protein_name": "Toll-like receptor 3", "gene_name": "TLR3", "tax_name": "Human" }, { "uniprot_canonical_ac": "E1C626-1", "protein_name": "TNF receptor-associated factor", "gene_name": "TRAF6", "tax_name": "Chicken" }, { "uniprot_canonical_ac": "P79781-1", "protein_name": "Ubiquitin-ribosomal protein eS31 fusion protein", "gene_name": "RPS27A", "tax_name": "Chicken" }, { "uniprot_canonical_ac": "P0CG47-1", "protein_name": "Polyubiquitin-B", "gene_name": "UBB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13114-1", "protein_name": "TNF receptor-associated factor 3", "gene_name": "TRAF3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P08571-1", "protein_name": "Monocyte differentiation antigen CD14", "gene_name": "CD14", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62987-1", "protein_name": "Ubiquitin-ribosomal protein eL40 fusion protein", "gene_name": "UBA52", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86XR7-1", "protein_name": "TIR domain-containing adapter molecule 2", "gene_name": "TICAM2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8IUC6-1", "protein_name": "TIR domain-containing adapter molecule 1", "gene_name": "TICAM1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG48-1", "protein_name": "Polyubiquitin-C", "gene_name": "UBC", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q14164", "url": "https://www.uniprot.org/uniprotkb/Q14164" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.16306937", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 30 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "MADD/DENN splice variant of the IG20 gene is necessary and sufficient for cancer cell survival.", "journal": "Oncogene", "date": "2006", "authors": "Mulherkar N, Ramaswamy M, Mordi DC, Prabhakar BS", "reference": { "type": "PubMed", "id": "16682944", "url": "https://pubmed.ncbi.nlm.nih.gov/16682944" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q14164-1", "protein_name": "Inhibitor of nuclear factor kappa-B kinase subunit epsilon", "gene_name": "IKBKE", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UHD2-1", "protein_name": "Serine/threonine-protein kinase TBK1", "gene_name": "TBK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15111-1", "protein_name": "Inhibitor of nuclear factor kappa-B kinase subunit alpha", "gene_name": "CHUK", "tax_name": "Human" }, { "uniprot_canonical_ac": "P98170-1", "protein_name": "E3 ubiquitin-protein ligase XIAP", "gene_name": "XIAP", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13546-1", "protein_name": "Receptor-interacting serine/threonine-protein kinase 1", "gene_name": "RIPK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75385-1", "protein_name": "Serine/threonine-protein kinase ULK1", "gene_name": "ULK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P21580-1", "protein_name": "Tumor necrosis factor alpha-induced protein 3", "gene_name": "TNFAIP3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68036-1", "protein_name": "Ubiquitin-conjugating enzyme E2 L3", "gene_name": "UBE2L3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96DZ5-1", "protein_name": "CAP-Gly domain-containing linker protein 3", "gene_name": "CLIP3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P19438-1", "protein_name": "Tumor necrosis factor receptor superfamily member 1A", "gene_name": "TNFRSF1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UM82-1", "protein_name": "Spermatogenesis-associated protein 2", "gene_name": "SPATA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49137-1", "protein_name": "MAP kinase-activated protein kinase 2", "gene_name": "MAPKAPK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BYM8-1", "protein_name": "RanBP-type and C3HC4-type zinc finger-containing protein 1", "gene_name": "RBCK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96EP0-1", "protein_name": "E3 ubiquitin-protein ligase RNF31", "gene_name": "RNF31", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H0F6-1", "protein_name": "Sharpin", "gene_name": "SHARPIN", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5VV17-1", "protein_name": "OTU domain-containing protein 1", "gene_name": "OTUD1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96AX9-1", "protein_name": "E3 ubiquitin-protein ligase MIB2", "gene_name": "MIB2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TCT8-1", "protein_name": "Signal peptide peptidase-like 2A", "gene_name": "SPPL2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14920-1", "protein_name": "Inhibitor of nuclear factor kappa-B kinase subunit beta", "gene_name": "IKBKB", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61077-1", "protein_name": "Ubiquitin-conjugating enzyme E2 D3", "gene_name": "UBE2D3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51668-1", "protein_name": "Ubiquitin-conjugating enzyme E2 D1", "gene_name": "UBE2D1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86VP1-1", "protein_name": "Tax1-binding protein 1", "gene_name": "TAX1BP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13158-1", "protein_name": "FAS-associated death domain protein", "gene_name": "FADD", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6GQQ9-1", "protein_name": "OTU domain-containing protein 7B", "gene_name": "OTUD7B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NQC7-1", "protein_name": "Ubiquitin carboxyl-terminal hydrolase CYLD", "gene_name": "CYLD", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UK80-1", "protein_name": "Ubiquitin carboxyl-terminal hydrolase 21", "gene_name": "USP21", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TCT7-1", "protein_name": "Signal peptide peptidase-like 2B", "gene_name": "SPPL2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96CV9-1", "protein_name": "Optineurin", "gene_name": "OPTN", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13077-1", "protein_name": "TNF receptor-associated factor 1", "gene_name": "TRAF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14790-1", "protein_name": "Caspase-8", "gene_name": "CASP8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15628-1", "protein_name": "Tumor necrosis factor receptor type 1-associated DEATH domain protein", "gene_name": "TRADD", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13490-1", "protein_name": "Baculoviral IAP repeat-containing protein 2", "gene_name": "BIRC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62979-1", "protein_name": "Ubiquitin-ribosomal protein eS31 fusion protein", "gene_name": "RPS27A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62837-1", "protein_name": "Ubiquitin-conjugating enzyme E2 D2", "gene_name": "UBE2D2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13489-1", "protein_name": "Baculoviral IAP repeat-containing protein 3", "gene_name": "BIRC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01375-1", "protein_name": "Tumor necrosis factor", "gene_name": "TNF", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG47-1", "protein_name": "Polyubiquitin-B", "gene_name": "UBB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96BN8-1", "protein_name": "Ubiquitin thioesterase otulin", "gene_name": "OTULIN", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62987-1", "protein_name": "Ubiquitin-ribosomal protein eL40 fusion protein", "gene_name": "UBA52", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12933-1", "protein_name": "TNF receptor-associated factor 2", "gene_name": "TRAF2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y6K9-1", "protein_name": "NF-kappa-B essential modulator", "gene_name": "IKBKG", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13107-1", "protein_name": "Ubiquitin carboxyl-terminal hydrolase 4", "gene_name": "USP4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P63244-1", "protein_name": "Small ribosomal subunit protein RACK1", "gene_name": "RACK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG48-1", "protein_name": "Polyubiquitin-C", "gene_name": "UBC", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75604-1", "protein_name": "Ubiquitin carboxyl-terminal hydrolase 2", "gene_name": "USP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UNE7-1", "protein_name": "E3 ubiquitin-protein ligase CHIP", "gene_name": "STUB1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q14164", "url": "https://www.uniprot.org/uniprotkb/Q14164" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.16682944", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 46 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "A gamma-secretase-like intramembrane cleavage of TNFalpha by the GxGD aspartyl protease SPPL2b.", "journal": "Nature cell biology", "date": "2006", "authors": "Fluhrer R, Grammer G, Israel L, Condron MM, Haffner C, Friedmann E, Bohland C, Imhof A, Martoglio B, Teplow DB, Haass C", "reference": { "type": "PubMed", "id": "16829951", "url": "https://pubmed.ncbi.nlm.nih.gov/16829951" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q14164-1", "protein_name": "Inhibitor of nuclear factor kappa-B kinase subunit epsilon", "gene_name": "IKBKE", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UHD2-1", "protein_name": "Serine/threonine-protein kinase TBK1", "gene_name": "TBK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15111-1", "protein_name": "Inhibitor of nuclear factor kappa-B kinase subunit alpha", "gene_name": "CHUK", "tax_name": "Human" }, { "uniprot_canonical_ac": "P98170-1", "protein_name": "E3 ubiquitin-protein ligase XIAP", "gene_name": "XIAP", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13546-1", "protein_name": "Receptor-interacting serine/threonine-protein kinase 1", "gene_name": "RIPK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75385-1", "protein_name": "Serine/threonine-protein kinase ULK1", "gene_name": "ULK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P21580-1", "protein_name": "Tumor necrosis factor alpha-induced protein 3", "gene_name": "TNFAIP3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68036-1", "protein_name": "Ubiquitin-conjugating enzyme E2 L3", "gene_name": "UBE2L3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96DZ5-1", "protein_name": "CAP-Gly domain-containing linker protein 3", "gene_name": "CLIP3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P19438-1", "protein_name": "Tumor necrosis factor receptor superfamily member 1A", "gene_name": "TNFRSF1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UM82-1", "protein_name": "Spermatogenesis-associated protein 2", "gene_name": "SPATA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49137-1", "protein_name": "MAP kinase-activated protein kinase 2", "gene_name": "MAPKAPK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BYM8-1", "protein_name": "RanBP-type and C3HC4-type zinc finger-containing protein 1", "gene_name": "RBCK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96EP0-1", "protein_name": "E3 ubiquitin-protein ligase RNF31", "gene_name": "RNF31", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H0F6-1", "protein_name": "Sharpin", "gene_name": "SHARPIN", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5VV17-1", "protein_name": "OTU domain-containing protein 1", "gene_name": "OTUD1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96AX9-1", "protein_name": "E3 ubiquitin-protein ligase MIB2", "gene_name": "MIB2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TCT8-1", "protein_name": "Signal peptide peptidase-like 2A", "gene_name": "SPPL2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14920-1", "protein_name": "Inhibitor of nuclear factor kappa-B kinase subunit beta", "gene_name": "IKBKB", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61077-1", "protein_name": "Ubiquitin-conjugating enzyme E2 D3", "gene_name": "UBE2D3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51668-1", "protein_name": "Ubiquitin-conjugating enzyme E2 D1", "gene_name": "UBE2D1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86VP1-1", "protein_name": "Tax1-binding protein 1", "gene_name": "TAX1BP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13158-1", "protein_name": "FAS-associated death domain protein", "gene_name": "FADD", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6GQQ9-1", "protein_name": "OTU domain-containing protein 7B", "gene_name": "OTUD7B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NQC7-1", "protein_name": "Ubiquitin carboxyl-terminal hydrolase CYLD", "gene_name": "CYLD", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UK80-1", "protein_name": "Ubiquitin carboxyl-terminal hydrolase 21", "gene_name": "USP21", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TCT7-1", "protein_name": "Signal peptide peptidase-like 2B", "gene_name": "SPPL2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96CV9-1", "protein_name": "Optineurin", "gene_name": "OPTN", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13077-1", "protein_name": "TNF receptor-associated factor 1", "gene_name": "TRAF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14790-1", "protein_name": "Caspase-8", "gene_name": "CASP8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15628-1", "protein_name": "Tumor necrosis factor receptor type 1-associated DEATH domain protein", "gene_name": "TRADD", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13490-1", "protein_name": "Baculoviral IAP repeat-containing protein 2", "gene_name": "BIRC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62979-1", "protein_name": "Ubiquitin-ribosomal protein eS31 fusion protein", "gene_name": "RPS27A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62837-1", "protein_name": "Ubiquitin-conjugating enzyme E2 D2", "gene_name": "UBE2D2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13489-1", "protein_name": "Baculoviral IAP repeat-containing protein 3", "gene_name": "BIRC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01375-1", "protein_name": "Tumor necrosis factor", "gene_name": "TNF", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG47-1", "protein_name": "Polyubiquitin-B", "gene_name": "UBB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96BN8-1", "protein_name": "Ubiquitin thioesterase otulin", "gene_name": "OTULIN", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62987-1", "protein_name": "Ubiquitin-ribosomal protein eL40 fusion protein", "gene_name": "UBA52", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12933-1", "protein_name": "TNF receptor-associated factor 2", "gene_name": "TRAF2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y6K9-1", "protein_name": "NF-kappa-B essential modulator", "gene_name": "IKBKG", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13107-1", "protein_name": "Ubiquitin carboxyl-terminal hydrolase 4", "gene_name": "USP4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P63244-1", "protein_name": "Small ribosomal subunit protein RACK1", "gene_name": "RACK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG48-1", "protein_name": "Polyubiquitin-C", "gene_name": "UBC", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75604-1", "protein_name": "Ubiquitin carboxyl-terminal hydrolase 2", "gene_name": "USP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UNE7-1", "protein_name": "E3 ubiquitin-protein ligase CHIP", "gene_name": "STUB1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q14164", "url": "https://www.uniprot.org/uniprotkb/Q14164" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 421, "end_pos": 421, "sequence_org": "D", "sequence_mut": "A", "comment": "Loss of intramembrane-cleaving activity toward ITM2B, TNF and the simian foamy virus envelope glycoprotein gp130.", "evidence": [ { "database": "UniProtKB", "id": "Q8TCT7", "url": "https://www.uniprot.org/uniprotkb/Q8TCT7" }, { "database": "PubMed", "id": "16829951", "url": "https://pubmed.ncbi.nlm.nih.gov/16829951" }, { "database": "PubMed", "id": "17965014", "url": "https://pubmed.ncbi.nlm.nih.gov/17965014" }, { "database": "PubMed", "id": "22194595", "url": "https://pubmed.ncbi.nlm.nih.gov/22194595" }, { "database": "PubMed", "id": "19114711", "url": "https://pubmed.ncbi.nlm.nih.gov/19114711" } ], "uniprot_canonical_ac": "Q8TCT7-1" } ], "record_id": "pubmed.16829951", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 46 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "SPPL2a and SPPL2b promote intramembrane proteolysis of TNFalpha in activated dendritic cells to trigger IL-12 production.", "journal": "Nature cell biology", "date": "2006", "authors": "Friedmann E, Hauben E, Maylandt K, Schleeger S, Vreugde S, Lichtenthaler SF, Kuhn PH, Stauffer D, Rovelli G, Martoglio B", "reference": { "type": "PubMed", "id": "16829952", "url": "https://pubmed.ncbi.nlm.nih.gov/16829952" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q14164-1", "protein_name": "Inhibitor of nuclear factor kappa-B kinase subunit epsilon", "gene_name": "IKBKE", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UHD2-1", "protein_name": "Serine/threonine-protein kinase TBK1", "gene_name": "TBK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15111-1", "protein_name": "Inhibitor of nuclear factor kappa-B kinase subunit alpha", "gene_name": "CHUK", "tax_name": "Human" }, { "uniprot_canonical_ac": "P98170-1", "protein_name": "E3 ubiquitin-protein ligase XIAP", "gene_name": "XIAP", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13546-1", "protein_name": "Receptor-interacting serine/threonine-protein kinase 1", "gene_name": "RIPK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75385-1", "protein_name": "Serine/threonine-protein kinase ULK1", "gene_name": "ULK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P21580-1", "protein_name": "Tumor necrosis factor alpha-induced protein 3", "gene_name": "TNFAIP3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68036-1", "protein_name": "Ubiquitin-conjugating enzyme E2 L3", "gene_name": "UBE2L3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96DZ5-1", "protein_name": "CAP-Gly domain-containing linker protein 3", "gene_name": "CLIP3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P19438-1", "protein_name": "Tumor necrosis factor receptor superfamily member 1A", "gene_name": "TNFRSF1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UM82-1", "protein_name": "Spermatogenesis-associated protein 2", "gene_name": "SPATA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49137-1", "protein_name": "MAP kinase-activated protein kinase 2", "gene_name": "MAPKAPK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BYM8-1", "protein_name": "RanBP-type and C3HC4-type zinc finger-containing protein 1", "gene_name": "RBCK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96EP0-1", "protein_name": "E3 ubiquitin-protein ligase RNF31", "gene_name": "RNF31", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H0F6-1", "protein_name": "Sharpin", "gene_name": "SHARPIN", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5VV17-1", "protein_name": "OTU domain-containing protein 1", "gene_name": "OTUD1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96AX9-1", "protein_name": "E3 ubiquitin-protein ligase MIB2", "gene_name": "MIB2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TCT6-2", "protein_name": "Signal peptide peptidase-like 3", "gene_name": "SPPL3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TCT8-1", "protein_name": "Signal peptide peptidase-like 2A", "gene_name": "SPPL2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14920-1", "protein_name": "Inhibitor of nuclear factor kappa-B kinase subunit beta", "gene_name": "IKBKB", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61077-1", "protein_name": "Ubiquitin-conjugating enzyme E2 D3", "gene_name": "UBE2D3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51668-1", "protein_name": "Ubiquitin-conjugating enzyme E2 D1", "gene_name": "UBE2D1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86VP1-1", "protein_name": "Tax1-binding protein 1", "gene_name": "TAX1BP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13158-1", "protein_name": "FAS-associated death domain protein", "gene_name": "FADD", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6GQQ9-1", "protein_name": "OTU domain-containing protein 7B", "gene_name": "OTUD7B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NQC7-1", "protein_name": "Ubiquitin carboxyl-terminal hydrolase CYLD", "gene_name": "CYLD", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UK80-1", "protein_name": "Ubiquitin carboxyl-terminal hydrolase 21", "gene_name": "USP21", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TCT7-1", "protein_name": "Signal peptide peptidase-like 2B", "gene_name": "SPPL2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96CV9-1", "protein_name": "Optineurin", "gene_name": "OPTN", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13077-1", "protein_name": "TNF receptor-associated factor 1", "gene_name": "TRAF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14790-1", "protein_name": "Caspase-8", "gene_name": "CASP8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15628-1", "protein_name": "Tumor necrosis factor receptor type 1-associated DEATH domain protein", "gene_name": "TRADD", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13490-1", "protein_name": "Baculoviral IAP repeat-containing protein 2", "gene_name": "BIRC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62979-1", "protein_name": "Ubiquitin-ribosomal protein eS31 fusion protein", "gene_name": "RPS27A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62837-1", "protein_name": "Ubiquitin-conjugating enzyme E2 D2", "gene_name": "UBE2D2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13489-1", "protein_name": "Baculoviral IAP repeat-containing protein 3", "gene_name": "BIRC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8IUH8-1", "protein_name": "Signal peptide peptidase-like 2C", "gene_name": "SPPL2C", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01375-1", "protein_name": "Tumor necrosis factor", "gene_name": "TNF", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG47-1", "protein_name": "Polyubiquitin-B", "gene_name": "UBB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96BN8-1", "protein_name": "Ubiquitin thioesterase otulin", "gene_name": "OTULIN", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62987-1", "protein_name": "Ubiquitin-ribosomal protein eL40 fusion protein", "gene_name": "UBA52", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12933-1", "protein_name": "TNF receptor-associated factor 2", "gene_name": "TRAF2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y6K9-1", "protein_name": "NF-kappa-B essential modulator", "gene_name": "IKBKG", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13107-1", "protein_name": "Ubiquitin carboxyl-terminal hydrolase 4", "gene_name": "USP4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P63244-1", "protein_name": "Small ribosomal subunit protein RACK1", "gene_name": "RACK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG48-1", "protein_name": "Polyubiquitin-C", "gene_name": "UBC", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75604-1", "protein_name": "Ubiquitin carboxyl-terminal hydrolase 2", "gene_name": "USP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UNE7-1", "protein_name": "E3 ubiquitin-protein ligase CHIP", "gene_name": "STUB1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q14164", "url": "https://www.uniprot.org/uniprotkb/Q14164" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 412, "end_pos": 412, "sequence_org": "D", "sequence_mut": "A", "comment": "Loss of intramembrane-cleaving activity toward FASLG, ITM2B, TNF and the simian foamy virus envelope glycoprotein gp130.", "evidence": [ { "database": "UniProtKB", "id": "Q8TCT8", "url": "https://www.uniprot.org/uniprotkb/Q8TCT8" }, { "database": "PubMed", "id": "16829952", "url": "https://pubmed.ncbi.nlm.nih.gov/16829952" }, { "database": "PubMed", "id": "17557115", "url": "https://pubmed.ncbi.nlm.nih.gov/17557115" }, { "database": "PubMed", "id": "17965014", "url": "https://pubmed.ncbi.nlm.nih.gov/17965014" }, { "database": "PubMed", "id": "23132852", "url": "https://pubmed.ncbi.nlm.nih.gov/23132852" } ], "uniprot_canonical_ac": "Q8TCT8-1" } ], "record_id": "pubmed.16829952", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 48 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Role for nonstructural protein 1 of severe acute respiratory syndrome coronavirus in chemokine dysregulation.", "journal": "Journal of virology", "date": "2007", "authors": "Law AH, Lee DC, Cheung BK, Yim HC, Lau AS", "reference": { "type": "PubMed", "id": "17035307", "url": "https://pubmed.ncbi.nlm.nih.gov/17035307" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q14164-1", "protein_name": "Inhibitor of nuclear factor kappa-B kinase subunit epsilon", "gene_name": "IKBKE", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UHD2-1", "protein_name": "Serine/threonine-protein kinase TBK1", "gene_name": "TBK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P25963-1", "protein_name": "NF-kappa-B inhibitor alpha", "gene_name": "NFKBIA", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43187-1", "protein_name": "Interleukin-1 receptor-associated kinase-like 2", "gene_name": "IRAK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9ULZ3-1", "protein_name": "Apoptosis-associated speck-like protein containing a CARD", "gene_name": "PYCARD", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y4K3-1", "protein_name": "TNF receptor-associated factor 6", "gene_name": "TRAF6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P29466-1", "protein_name": "Caspase-1", "gene_name": "CASP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86WV6-1", "protein_name": "Stimulator of interferon genes protein", "gene_name": "STING1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P19838-1", "protein_name": "Nuclear factor NF-kappa-B p105 subunit", "gene_name": "NFKB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UKA8-1", "protein_name": "Calcipressin-3", "gene_name": "RCAN3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13427-1", "protein_name": "Peptidyl-prolyl cis-trans isomerase G", "gene_name": "PPIG", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14258-1", "protein_name": "E3 ubiquitin/ISG15 ligase TRIM25", "gene_name": "TRIM25", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96P20-1", "protein_name": "NACHT, LRR and PYD domains-containing protein 3", "gene_name": "NLRP3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96J02-1", "protein_name": "E3 ubiquitin-protein ligase Itchy homolog", "gene_name": "ITCH", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01196-1", "protein_name": "Runt-related transcription factor 1", "gene_name": "RUNX1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14653-1", "protein_name": "Interferon regulatory factor 3", "gene_name": "IRF3", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95786-1", "protein_name": "Antiviral innate immune response receptor RIG-I", "gene_name": "DDX58; RIGI", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BRV8-1", "protein_name": "Suppressor of IKBKE 1", "gene_name": "SIKE1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92617-1", "protein_name": "Nuclear pore complex-interacting protein family member B3", "gene_name": "NPIPB3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35247-1", "protein_name": "Pulmonary surfactant-associated protein D", "gene_name": "SFTPD", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62937-1", "protein_name": "Peptidyl-prolyl cis-trans isomerase A", "gene_name": "PPIA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15366-1", "protein_name": "Poly(rC)-binding protein 2", "gene_name": "PCBP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NYK1-1", "protein_name": "Toll-like receptor 7", "gene_name": "TLR7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q7Z434-1", "protein_name": "Mitochondrial antiviral-signaling protein", "gene_name": "MAVS", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62942-1", "protein_name": "Peptidyl-prolyl cis-trans isomerase FKBP1A", "gene_name": "FKBP1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P52292-1", "protein_name": "Importin subunit alpha-1", "gene_name": "KPNA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P23284-1", "protein_name": "Peptidyl-prolyl cis-trans isomerase B", "gene_name": "PPIB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13287-1", "protein_name": "N-myc-interactor", "gene_name": "NMI", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62979-1", "protein_name": "Ubiquitin-ribosomal protein eS31 fusion protein", "gene_name": "RPS27A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y572-1", "protein_name": "Receptor-interacting serine/threonine-protein kinase 3", "gene_name": "RIPK3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q10589-1", "protein_name": "Bone marrow stromal antigen 2", "gene_name": "BST2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q3LXA3-1", "protein_name": "Triokinase/FMN cyclase", "gene_name": "TKFC", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BYX4-1", "protein_name": "Interferon-induced helicase C domain-containing protein 1", "gene_name": "IFIH1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O94826-1", "protein_name": "Mitochondrial import receptor subunit TOM70", "gene_name": "TOMM70", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG47-1", "protein_name": "Polyubiquitin-B", "gene_name": "UBB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13114-1", "protein_name": "TNF receptor-associated factor 3", "gene_name": "TRAF3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62987-1", "protein_name": "Ubiquitin-ribosomal protein eL40 fusion protein", "gene_name": "UBA52", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43447-1", "protein_name": "Peptidyl-prolyl cis-trans isomerase H", "gene_name": "PPIH", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14974-1", "protein_name": "Importin subunit beta-1", "gene_name": "KPNB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG48-1", "protein_name": "Polyubiquitin-C", "gene_name": "UBC", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q04206-1", "protein_name": "Transcription factor p65", "gene_name": "RELA", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q14164", "url": "https://www.uniprot.org/uniprotkb/Q14164" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.17035307", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 41 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "SHP-2 phosphatase negatively regulates the TRIF adaptor protein-dependent type I interferon and proinflammatory cytokine production.", "journal": "Immunity", "date": "2006", "authors": "An H, Zhao W, Hou J, Zhang Y, Xie Y, Zheng Y, Xu H, Qian C, Zhou J, Yu Y, Liu S, Feng G, Cao X", "reference": { "type": "PubMed", "id": "17157040", "url": "https://pubmed.ncbi.nlm.nih.gov/17157040" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q14164-1", "protein_name": "Inhibitor of nuclear factor kappa-B kinase subunit epsilon", "gene_name": "IKBKE", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UHD2-1", "protein_name": "Serine/threonine-protein kinase TBK1", "gene_name": "TBK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92844-1", "protein_name": "TRAF family member-associated NF-kappa-B activator", "gene_name": "TANK", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14653-1", "protein_name": "Interferon regulatory factor 3", "gene_name": "IRF3", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00206-1", "protein_name": "Toll-like receptor 4", "gene_name": "TLR4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y6Y9-1", "protein_name": "Lymphocyte antigen 96", "gene_name": "LY96", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96CV9-1", "protein_name": "Optineurin", "gene_name": "OPTN", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92985-1", "protein_name": "Interferon regulatory factor 7", "gene_name": "IRF7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q06124-2", "protein_name": "Tyrosine-protein phosphatase non-receptor type 11", "gene_name": "PTPN11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62979-1", "protein_name": "Ubiquitin-ribosomal protein eS31 fusion protein", "gene_name": "RPS27A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15455-1", "protein_name": "Toll-like receptor 3", "gene_name": "TLR3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG47-1", "protein_name": "Polyubiquitin-B", "gene_name": "UBB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13114-1", "protein_name": "TNF receptor-associated factor 3", "gene_name": "TRAF3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P08571-1", "protein_name": "Monocyte differentiation antigen CD14", "gene_name": "CD14", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62987-1", "protein_name": "Ubiquitin-ribosomal protein eL40 fusion protein", "gene_name": "UBA52", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86XR7-1", "protein_name": "TIR domain-containing adapter molecule 2", "gene_name": "TICAM2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8IUC6-1", "protein_name": "TIR domain-containing adapter molecule 1", "gene_name": "TICAM1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG48-1", "protein_name": "Polyubiquitin-C", "gene_name": "UBC", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q14164", "url": "https://www.uniprot.org/uniprotkb/Q14164" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.17157040", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 18 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "RCAN3, a novel calcineurin inhibitor that down-regulates NFAT-dependent cytokine gene expression.", "journal": "Biochimica et biophysica acta", "date": "2007", "authors": "Mulero MC, Aubareda A, Schluter A, Perez-Riba M", "reference": { "type": "PubMed", "id": "17270291", "url": "https://pubmed.ncbi.nlm.nih.gov/17270291" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q14164-1", "protein_name": "Inhibitor of nuclear factor kappa-B kinase subunit epsilon", "gene_name": "IKBKE", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UHD2-1", "protein_name": "Serine/threonine-protein kinase TBK1", "gene_name": "TBK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P25963-1", "protein_name": "NF-kappa-B inhibitor alpha", "gene_name": "NFKBIA", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43187-1", "protein_name": "Interleukin-1 receptor-associated kinase-like 2", "gene_name": "IRAK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9ULZ3-1", "protein_name": "Apoptosis-associated speck-like protein containing a CARD", "gene_name": "PYCARD", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y4K3-1", "protein_name": "TNF receptor-associated factor 6", "gene_name": "TRAF6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P29466-1", "protein_name": "Caspase-1", "gene_name": "CASP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86WV6-1", "protein_name": "Stimulator of interferon genes protein", "gene_name": "STING1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P19838-1", "protein_name": "Nuclear factor NF-kappa-B p105 subunit", "gene_name": "NFKB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UKA8-1", "protein_name": "Calcipressin-3", "gene_name": "RCAN3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13427-1", "protein_name": "Peptidyl-prolyl cis-trans isomerase G", "gene_name": "PPIG", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14258-1", "protein_name": "E3 ubiquitin/ISG15 ligase TRIM25", "gene_name": "TRIM25", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96P20-1", "protein_name": "NACHT, LRR and PYD domains-containing protein 3", "gene_name": "NLRP3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96J02-1", "protein_name": "E3 ubiquitin-protein ligase Itchy homolog", "gene_name": "ITCH", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01196-1", "protein_name": "Runt-related transcription factor 1", "gene_name": "RUNX1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14653-1", "protein_name": "Interferon regulatory factor 3", "gene_name": "IRF3", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95786-1", "protein_name": "Antiviral innate immune response receptor RIG-I", "gene_name": "DDX58; RIGI", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BRV8-1", "protein_name": "Suppressor of IKBKE 1", "gene_name": "SIKE1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92617-1", "protein_name": "Nuclear pore complex-interacting protein family member B3", "gene_name": "NPIPB3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35247-1", "protein_name": "Pulmonary surfactant-associated protein D", "gene_name": "SFTPD", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62937-1", "protein_name": "Peptidyl-prolyl cis-trans isomerase A", "gene_name": "PPIA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15366-1", "protein_name": "Poly(rC)-binding protein 2", "gene_name": "PCBP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NYK1-1", "protein_name": "Toll-like receptor 7", "gene_name": "TLR7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q7Z434-1", "protein_name": "Mitochondrial antiviral-signaling protein", "gene_name": "MAVS", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62942-1", "protein_name": "Peptidyl-prolyl cis-trans isomerase FKBP1A", "gene_name": "FKBP1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P52292-1", "protein_name": "Importin subunit alpha-1", "gene_name": "KPNA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P23284-1", "protein_name": "Peptidyl-prolyl cis-trans isomerase B", "gene_name": "PPIB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13287-1", "protein_name": "N-myc-interactor", "gene_name": "NMI", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62979-1", "protein_name": "Ubiquitin-ribosomal protein eS31 fusion protein", "gene_name": "RPS27A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y572-1", "protein_name": "Receptor-interacting serine/threonine-protein kinase 3", "gene_name": "RIPK3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q10589-1", "protein_name": "Bone marrow stromal antigen 2", "gene_name": "BST2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q3LXA3-1", "protein_name": "Triokinase/FMN cyclase", "gene_name": "TKFC", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BYX4-1", "protein_name": "Interferon-induced helicase C domain-containing protein 1", "gene_name": "IFIH1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O94826-1", "protein_name": "Mitochondrial import receptor subunit TOM70", "gene_name": "TOMM70", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG47-1", "protein_name": "Polyubiquitin-B", "gene_name": "UBB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13114-1", "protein_name": "TNF receptor-associated factor 3", "gene_name": "TRAF3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62987-1", "protein_name": "Ubiquitin-ribosomal protein eL40 fusion protein", "gene_name": "UBA52", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43447-1", "protein_name": "Peptidyl-prolyl cis-trans isomerase H", "gene_name": "PPIH", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14974-1", "protein_name": "Importin subunit beta-1", "gene_name": "KPNB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG48-1", "protein_name": "Polyubiquitin-C", "gene_name": "UBC", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q04206-1", "protein_name": "Transcription factor p65", "gene_name": "RELA", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q14164", "url": "https://www.uniprot.org/uniprotkb/Q14164" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.17270291", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 41 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "MADD/DENN splice variant of the IG20 gene is a negative regulator of caspase-8 activation. Knockdown enhances TRAIL-induced apoptosis of cancer cells.", "journal": "The Journal of biological chemistry", "date": "2007", "authors": "Mulherkar N, Prasad KV, Prabhakar BS", "reference": { "type": "PubMed", "id": "17314102", "url": "https://pubmed.ncbi.nlm.nih.gov/17314102" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q14164-1", "protein_name": "Inhibitor of nuclear factor kappa-B kinase subunit epsilon", "gene_name": "IKBKE", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UHD2-1", "protein_name": "Serine/threonine-protein kinase TBK1", "gene_name": "TBK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15111-1", "protein_name": "Inhibitor of nuclear factor kappa-B kinase subunit alpha", "gene_name": "CHUK", "tax_name": "Human" }, { "uniprot_canonical_ac": "P98170-1", "protein_name": "E3 ubiquitin-protein ligase XIAP", "gene_name": "XIAP", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13546-1", "protein_name": "Receptor-interacting serine/threonine-protein kinase 1", "gene_name": "RIPK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75385-1", "protein_name": "Serine/threonine-protein kinase ULK1", "gene_name": "ULK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P21580-1", "protein_name": "Tumor necrosis factor alpha-induced protein 3", "gene_name": "TNFAIP3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68036-1", "protein_name": "Ubiquitin-conjugating enzyme E2 L3", "gene_name": "UBE2L3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96DZ5-1", "protein_name": "CAP-Gly domain-containing linker protein 3", "gene_name": "CLIP3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P19438-1", "protein_name": "Tumor necrosis factor receptor superfamily member 1A", "gene_name": "TNFRSF1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UM82-1", "protein_name": "Spermatogenesis-associated protein 2", "gene_name": "SPATA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49137-1", "protein_name": "MAP kinase-activated protein kinase 2", "gene_name": "MAPKAPK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BYM8-1", "protein_name": "RanBP-type and C3HC4-type zinc finger-containing protein 1", "gene_name": "RBCK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96EP0-1", "protein_name": "E3 ubiquitin-protein ligase RNF31", "gene_name": "RNF31", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H0F6-1", "protein_name": "Sharpin", "gene_name": "SHARPIN", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5VV17-1", "protein_name": "OTU domain-containing protein 1", "gene_name": "OTUD1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96AX9-1", "protein_name": "E3 ubiquitin-protein ligase MIB2", "gene_name": "MIB2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TCT8-1", "protein_name": "Signal peptide peptidase-like 2A", "gene_name": "SPPL2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14920-1", "protein_name": "Inhibitor of nuclear factor kappa-B kinase subunit beta", "gene_name": "IKBKB", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61077-1", "protein_name": "Ubiquitin-conjugating enzyme E2 D3", "gene_name": "UBE2D3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51668-1", "protein_name": "Ubiquitin-conjugating enzyme E2 D1", "gene_name": "UBE2D1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86VP1-1", "protein_name": "Tax1-binding protein 1", "gene_name": "TAX1BP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13158-1", "protein_name": "FAS-associated death domain protein", "gene_name": "FADD", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6GQQ9-1", "protein_name": "OTU domain-containing protein 7B", "gene_name": "OTUD7B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NQC7-1", "protein_name": "Ubiquitin carboxyl-terminal hydrolase CYLD", "gene_name": "CYLD", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UK80-1", "protein_name": "Ubiquitin carboxyl-terminal hydrolase 21", "gene_name": "USP21", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TCT7-1", "protein_name": "Signal peptide peptidase-like 2B", "gene_name": "SPPL2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96CV9-1", "protein_name": "Optineurin", "gene_name": "OPTN", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13077-1", "protein_name": "TNF receptor-associated factor 1", "gene_name": "TRAF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14790-1", "protein_name": "Caspase-8", "gene_name": "CASP8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15628-1", "protein_name": "Tumor necrosis factor receptor type 1-associated DEATH domain protein", "gene_name": "TRADD", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13490-1", "protein_name": "Baculoviral IAP repeat-containing protein 2", "gene_name": "BIRC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62979-1", "protein_name": "Ubiquitin-ribosomal protein eS31 fusion protein", "gene_name": "RPS27A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62837-1", "protein_name": "Ubiquitin-conjugating enzyme E2 D2", "gene_name": "UBE2D2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13489-1", "protein_name": "Baculoviral IAP repeat-containing protein 3", "gene_name": "BIRC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01375-1", "protein_name": "Tumor necrosis factor", "gene_name": "TNF", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG47-1", "protein_name": "Polyubiquitin-B", "gene_name": "UBB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96BN8-1", "protein_name": "Ubiquitin thioesterase otulin", "gene_name": "OTULIN", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62987-1", "protein_name": "Ubiquitin-ribosomal protein eL40 fusion protein", "gene_name": "UBA52", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12933-1", "protein_name": "TNF receptor-associated factor 2", "gene_name": "TRAF2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y6K9-1", "protein_name": "NF-kappa-B essential modulator", "gene_name": "IKBKG", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13107-1", "protein_name": "Ubiquitin carboxyl-terminal hydrolase 4", "gene_name": "USP4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P63244-1", "protein_name": "Small ribosomal subunit protein RACK1", "gene_name": "RACK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG48-1", "protein_name": "Polyubiquitin-C", "gene_name": "UBC", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75604-1", "protein_name": "Ubiquitin carboxyl-terminal hydrolase 2", "gene_name": "USP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UNE7-1", "protein_name": "E3 ubiquitin-protein ligase CHIP", "gene_name": "STUB1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q14164", "url": "https://www.uniprot.org/uniprotkb/Q14164" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.17314102", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 46 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The SARS coronavirus spike glycoprotein is selectively recognized by lung surfactant protein D and activates macrophages.", "journal": "Immunobiology", "date": "2007", "authors": "Leth-Larsen R, Zhong F, Chow VT, Holmskov U, Lu J", "reference": { "type": "PubMed", "id": "17412287", "url": "https://pubmed.ncbi.nlm.nih.gov/17412287" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q14164-1", "protein_name": "Inhibitor of nuclear factor kappa-B kinase subunit epsilon", "gene_name": "IKBKE", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UHD2-1", "protein_name": "Serine/threonine-protein kinase TBK1", "gene_name": "TBK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P25963-1", "protein_name": "NF-kappa-B inhibitor alpha", "gene_name": "NFKBIA", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43187-1", "protein_name": "Interleukin-1 receptor-associated kinase-like 2", "gene_name": "IRAK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9ULZ3-1", "protein_name": "Apoptosis-associated speck-like protein containing a CARD", "gene_name": "PYCARD", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y4K3-1", "protein_name": "TNF receptor-associated factor 6", "gene_name": "TRAF6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P29466-1", "protein_name": "Caspase-1", "gene_name": "CASP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86WV6-1", "protein_name": "Stimulator of interferon genes protein", "gene_name": "STING1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P19838-1", "protein_name": "Nuclear factor NF-kappa-B p105 subunit", "gene_name": "NFKB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UKA8-1", "protein_name": "Calcipressin-3", "gene_name": "RCAN3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13427-1", "protein_name": "Peptidyl-prolyl cis-trans isomerase G", "gene_name": "PPIG", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14258-1", "protein_name": "E3 ubiquitin/ISG15 ligase TRIM25", "gene_name": "TRIM25", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96P20-1", "protein_name": "NACHT, LRR and PYD domains-containing protein 3", "gene_name": "NLRP3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96J02-1", "protein_name": "E3 ubiquitin-protein ligase Itchy homolog", "gene_name": "ITCH", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01196-1", "protein_name": "Runt-related transcription factor 1", "gene_name": "RUNX1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14653-1", "protein_name": "Interferon regulatory factor 3", "gene_name": "IRF3", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95786-1", "protein_name": "Antiviral innate immune response receptor RIG-I", "gene_name": "DDX58; RIGI", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BRV8-1", "protein_name": "Suppressor of IKBKE 1", "gene_name": "SIKE1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92617-1", "protein_name": "Nuclear pore complex-interacting protein family member B3", "gene_name": "NPIPB3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35247-1", "protein_name": "Pulmonary surfactant-associated protein D", "gene_name": "SFTPD", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62937-1", "protein_name": "Peptidyl-prolyl cis-trans isomerase A", "gene_name": "PPIA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15366-1", "protein_name": "Poly(rC)-binding protein 2", "gene_name": "PCBP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NYK1-1", "protein_name": "Toll-like receptor 7", "gene_name": "TLR7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q7Z434-1", "protein_name": "Mitochondrial antiviral-signaling protein", "gene_name": "MAVS", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62942-1", "protein_name": "Peptidyl-prolyl cis-trans isomerase FKBP1A", "gene_name": "FKBP1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P52292-1", "protein_name": "Importin subunit alpha-1", "gene_name": "KPNA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P23284-1", "protein_name": "Peptidyl-prolyl cis-trans isomerase B", "gene_name": "PPIB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13287-1", "protein_name": "N-myc-interactor", "gene_name": "NMI", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62979-1", "protein_name": "Ubiquitin-ribosomal protein eS31 fusion protein", "gene_name": "RPS27A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y572-1", "protein_name": "Receptor-interacting serine/threonine-protein kinase 3", "gene_name": "RIPK3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q10589-1", "protein_name": "Bone marrow stromal antigen 2", "gene_name": "BST2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q3LXA3-1", "protein_name": "Triokinase/FMN cyclase", "gene_name": "TKFC", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BYX4-1", "protein_name": "Interferon-induced helicase C domain-containing protein 1", "gene_name": "IFIH1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O94826-1", "protein_name": "Mitochondrial import receptor subunit TOM70", "gene_name": "TOMM70", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG47-1", "protein_name": "Polyubiquitin-B", "gene_name": "UBB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13114-1", "protein_name": "TNF receptor-associated factor 3", "gene_name": "TRAF3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62987-1", "protein_name": "Ubiquitin-ribosomal protein eL40 fusion protein", "gene_name": "UBA52", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43447-1", "protein_name": "Peptidyl-prolyl cis-trans isomerase H", "gene_name": "PPIH", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14974-1", "protein_name": "Importin subunit beta-1", "gene_name": "KPNB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG48-1", "protein_name": "Polyubiquitin-C", "gene_name": "UBC", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q04206-1", "protein_name": "Transcription factor p65", "gene_name": "RELA", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q14164", "url": "https://www.uniprot.org/uniprotkb/Q14164" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.17412287", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 41 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Severe acute respiratory syndrome coronavirus ORF6 antagonizes STAT1 function by sequestering nuclear import factors on the rough endoplasmic reticulum/Golgi membrane.", "journal": "Journal of virology", "date": "2007", "authors": "Frieman M, Yount B, Heise M, Kopecky-Bromberg SA, Palese P, Baric RS", "reference": { "type": "PubMed", "id": "17596301", "url": "https://pubmed.ncbi.nlm.nih.gov/17596301" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q14164-1", "protein_name": "Inhibitor of nuclear factor kappa-B kinase subunit epsilon", "gene_name": "IKBKE", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UHD2-1", "protein_name": "Serine/threonine-protein kinase TBK1", "gene_name": "TBK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P25963-1", "protein_name": "NF-kappa-B inhibitor alpha", "gene_name": "NFKBIA", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43187-1", "protein_name": "Interleukin-1 receptor-associated kinase-like 2", "gene_name": "IRAK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9ULZ3-1", "protein_name": "Apoptosis-associated speck-like protein containing a CARD", "gene_name": "PYCARD", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y4K3-1", "protein_name": "TNF receptor-associated factor 6", "gene_name": "TRAF6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P29466-1", "protein_name": "Caspase-1", "gene_name": "CASP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86WV6-1", "protein_name": "Stimulator of interferon genes protein", "gene_name": "STING1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P19838-1", "protein_name": "Nuclear factor NF-kappa-B p105 subunit", "gene_name": "NFKB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UKA8-1", "protein_name": "Calcipressin-3", "gene_name": "RCAN3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13427-1", "protein_name": "Peptidyl-prolyl cis-trans isomerase G", "gene_name": "PPIG", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14258-1", "protein_name": "E3 ubiquitin/ISG15 ligase TRIM25", "gene_name": "TRIM25", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96P20-1", "protein_name": "NACHT, LRR and PYD domains-containing protein 3", "gene_name": "NLRP3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96J02-1", "protein_name": "E3 ubiquitin-protein ligase Itchy homolog", "gene_name": "ITCH", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01196-1", "protein_name": "Runt-related transcription factor 1", "gene_name": "RUNX1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14653-1", "protein_name": "Interferon regulatory factor 3", "gene_name": "IRF3", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95786-1", "protein_name": "Antiviral innate immune response receptor RIG-I", "gene_name": "DDX58; RIGI", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BRV8-1", "protein_name": "Suppressor of IKBKE 1", "gene_name": "SIKE1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92617-1", "protein_name": "Nuclear pore complex-interacting protein family member B3", "gene_name": "NPIPB3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35247-1", "protein_name": "Pulmonary surfactant-associated protein D", "gene_name": "SFTPD", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62937-1", "protein_name": "Peptidyl-prolyl cis-trans isomerase A", "gene_name": "PPIA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15366-1", "protein_name": "Poly(rC)-binding protein 2", "gene_name": "PCBP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NYK1-1", "protein_name": "Toll-like receptor 7", "gene_name": "TLR7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q7Z434-1", "protein_name": "Mitochondrial antiviral-signaling protein", "gene_name": "MAVS", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62942-1", "protein_name": "Peptidyl-prolyl cis-trans isomerase FKBP1A", "gene_name": "FKBP1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P52292-1", "protein_name": "Importin subunit alpha-1", "gene_name": "KPNA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P23284-1", "protein_name": "Peptidyl-prolyl cis-trans isomerase B", "gene_name": "PPIB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13287-1", "protein_name": "N-myc-interactor", "gene_name": "NMI", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62979-1", "protein_name": "Ubiquitin-ribosomal protein eS31 fusion protein", "gene_name": "RPS27A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y572-1", "protein_name": "Receptor-interacting serine/threonine-protein kinase 3", "gene_name": "RIPK3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q10589-1", "protein_name": "Bone marrow stromal antigen 2", "gene_name": "BST2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q3LXA3-1", "protein_name": "Triokinase/FMN cyclase", "gene_name": "TKFC", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BYX4-1", "protein_name": "Interferon-induced helicase C domain-containing protein 1", "gene_name": "IFIH1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O94826-1", "protein_name": "Mitochondrial import receptor subunit TOM70", "gene_name": "TOMM70", "tax_name": "Human" }, { "uniprot_canonical_ac": "P59634-1", "protein_name": "ORF6 protein", "gene_name": "6", "tax_name": "SARS-CoV" }, { "uniprot_canonical_ac": "P0CG47-1", "protein_name": "Polyubiquitin-B", "gene_name": "UBB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13114-1", "protein_name": "TNF receptor-associated factor 3", "gene_name": "TRAF3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62987-1", "protein_name": "Ubiquitin-ribosomal protein eL40 fusion protein", "gene_name": "UBA52", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43447-1", "protein_name": "Peptidyl-prolyl cis-trans isomerase H", "gene_name": "PPIH", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14974-1", "protein_name": "Importin subunit beta-1", "gene_name": "KPNB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG48-1", "protein_name": "Polyubiquitin-C", "gene_name": "UBC", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q04206-1", "protein_name": "Transcription factor p65", "gene_name": "RELA", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q14164", "url": "https://www.uniprot.org/uniprotkb/Q14164" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 2, "end_pos": 80, "sequence_org": "STNENANTPAARLHRFKNKGKDSTEMRRRRIEVNVELRKAKKDDQMLKRRNVSSFPDDATSPLQENRNNQGTVNWSVDD", "sequence_mut": "", "comment": "Complete loss of binding to KPNB1.", "evidence": [ { "database": "UniProtKB", "id": "P52292", "url": "https://www.uniprot.org/uniprotkb/P52292" }, { "database": "PubMed", "id": "17596301", "url": "https://pubmed.ncbi.nlm.nih.gov/17596301" } ], "uniprot_canonical_ac": "P52292-1" } ], "record_id": "pubmed.17596301", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 42 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Involvement of the ubiquitin-like domain of TBK1/IKK-i kinases in regulation of IFN-inducible genes.", "journal": "The EMBO journal", "date": "2007-07-25", "authors": "Ikeda Fumiyo, Hecker Christina Maria, Rozenknop Alexis, Nordmeier Rolf Dietrich, Rogov Vladimir, Hofmann Kay, Akira Shizuo, D\u00f6tsch Volker, Dikic Ivan", "reference": { "type": "PubMed", "id": "17599067", "url": "https://pubmed.ncbi.nlm.nih.gov/17599067" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q14164-1", "protein_name": "Inhibitor of nuclear factor kappa-B kinase subunit epsilon", "gene_name": "IKBKE", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UHD2-1", "protein_name": "Serine/threonine-protein kinase TBK1", "gene_name": "TBK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92844-1", "protein_name": "TRAF family member-associated NF-kappa-B activator", "gene_name": "TANK", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00206-1", "protein_name": "Toll-like receptor 4", "gene_name": "TLR4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y6Y9-1", "protein_name": "Lymphocyte antigen 96", "gene_name": "LY96", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96CV9-1", "protein_name": "Optineurin", "gene_name": "OPTN", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62979-1", "protein_name": "Ubiquitin-ribosomal protein eS31 fusion protein", "gene_name": "RPS27A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15455-1", "protein_name": "Toll-like receptor 3", "gene_name": "TLR3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG47-1", "protein_name": "Polyubiquitin-B", "gene_name": "UBB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13114-1", "protein_name": "TNF receptor-associated factor 3", "gene_name": "TRAF3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P08571-1", "protein_name": "Monocyte differentiation antigen CD14", "gene_name": "CD14", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62987-1", "protein_name": "Ubiquitin-ribosomal protein eL40 fusion protein", "gene_name": "UBA52", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86XR7-1", "protein_name": "TIR domain-containing adapter molecule 2", "gene_name": "TICAM2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8IUC6-1", "protein_name": "TIR domain-containing adapter molecule 1", "gene_name": "TICAM1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG48-1", "protein_name": "Polyubiquitin-C", "gene_name": "UBC", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q14164", "url": "https://www.uniprot.org/uniprotkb/Q14164" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.17599067", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 15 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Optineurin negatively regulates TNFalpha- induced NF-kappaB activation by competing with NEMO for ubiquitinated RIP.", "journal": "Current biology : CB", "date": "2007", "authors": "Zhu G, Wu CJ, Zhao Y, Ashwell JD", "reference": { "type": "PubMed", "id": "17702576", "url": "https://pubmed.ncbi.nlm.nih.gov/17702576" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q14164-1", "protein_name": "Inhibitor of nuclear factor kappa-B kinase subunit epsilon", "gene_name": "IKBKE", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UHD2-1", "protein_name": "Serine/threonine-protein kinase TBK1", "gene_name": "TBK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15111-1", "protein_name": "Inhibitor of nuclear factor kappa-B kinase subunit alpha", "gene_name": "CHUK", "tax_name": "Human" }, { "uniprot_canonical_ac": "P98170-1", "protein_name": "E3 ubiquitin-protein ligase XIAP", "gene_name": "XIAP", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13546-1", "protein_name": "Receptor-interacting serine/threonine-protein kinase 1", "gene_name": "RIPK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75385-1", "protein_name": "Serine/threonine-protein kinase ULK1", "gene_name": "ULK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P21580-1", "protein_name": "Tumor necrosis factor alpha-induced protein 3", "gene_name": "TNFAIP3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68036-1", "protein_name": "Ubiquitin-conjugating enzyme E2 L3", "gene_name": "UBE2L3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96DZ5-1", "protein_name": "CAP-Gly domain-containing linker protein 3", "gene_name": "CLIP3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P19438-1", "protein_name": "Tumor necrosis factor receptor superfamily member 1A", "gene_name": "TNFRSF1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UM82-1", "protein_name": "Spermatogenesis-associated protein 2", "gene_name": "SPATA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49137-1", "protein_name": "MAP kinase-activated protein kinase 2", "gene_name": "MAPKAPK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BYM8-1", "protein_name": "RanBP-type and C3HC4-type zinc finger-containing protein 1", "gene_name": "RBCK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96EP0-1", "protein_name": "E3 ubiquitin-protein ligase RNF31", "gene_name": "RNF31", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H0F6-1", "protein_name": "Sharpin", "gene_name": "SHARPIN", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5VV17-1", "protein_name": "OTU domain-containing protein 1", "gene_name": "OTUD1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96AX9-1", "protein_name": "E3 ubiquitin-protein ligase MIB2", "gene_name": "MIB2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TCT8-1", "protein_name": "Signal peptide peptidase-like 2A", "gene_name": "SPPL2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14920-1", "protein_name": "Inhibitor of nuclear factor kappa-B kinase subunit beta", "gene_name": "IKBKB", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61077-1", "protein_name": "Ubiquitin-conjugating enzyme E2 D3", "gene_name": "UBE2D3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51668-1", "protein_name": "Ubiquitin-conjugating enzyme E2 D1", "gene_name": "UBE2D1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86VP1-1", "protein_name": "Tax1-binding protein 1", "gene_name": "TAX1BP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13158-1", "protein_name": "FAS-associated death domain protein", "gene_name": "FADD", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6GQQ9-1", "protein_name": "OTU domain-containing protein 7B", "gene_name": "OTUD7B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NQC7-1", "protein_name": "Ubiquitin carboxyl-terminal hydrolase CYLD", "gene_name": "CYLD", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UK80-1", "protein_name": "Ubiquitin carboxyl-terminal hydrolase 21", "gene_name": "USP21", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TCT7-1", "protein_name": "Signal peptide peptidase-like 2B", "gene_name": "SPPL2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96CV9-1", "protein_name": "Optineurin", "gene_name": "OPTN", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13077-1", "protein_name": "TNF receptor-associated factor 1", "gene_name": "TRAF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14790-1", "protein_name": "Caspase-8", "gene_name": "CASP8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15628-1", "protein_name": "Tumor necrosis factor receptor type 1-associated DEATH domain protein", "gene_name": "TRADD", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13490-1", "protein_name": "Baculoviral IAP repeat-containing protein 2", "gene_name": "BIRC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62979-1", "protein_name": "Ubiquitin-ribosomal protein eS31 fusion protein", "gene_name": "RPS27A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62837-1", "protein_name": "Ubiquitin-conjugating enzyme E2 D2", "gene_name": "UBE2D2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13489-1", "protein_name": "Baculoviral IAP repeat-containing protein 3", "gene_name": "BIRC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01375-1", "protein_name": "Tumor necrosis factor", "gene_name": "TNF", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG47-1", "protein_name": "Polyubiquitin-B", "gene_name": "UBB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96BN8-1", "protein_name": "Ubiquitin thioesterase otulin", "gene_name": "OTULIN", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62987-1", "protein_name": "Ubiquitin-ribosomal protein eL40 fusion protein", "gene_name": "UBA52", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12933-1", "protein_name": "TNF receptor-associated factor 2", "gene_name": "TRAF2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y6K9-1", "protein_name": "NF-kappa-B essential modulator", "gene_name": "IKBKG", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13107-1", "protein_name": "Ubiquitin carboxyl-terminal hydrolase 4", "gene_name": "USP4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P63244-1", "protein_name": "Small ribosomal subunit protein RACK1", "gene_name": "RACK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG48-1", "protein_name": "Polyubiquitin-C", "gene_name": "UBC", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75604-1", "protein_name": "Ubiquitin carboxyl-terminal hydrolase 2", "gene_name": "USP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UNE7-1", "protein_name": "E3 ubiquitin-protein ligase CHIP", "gene_name": "STUB1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q14164", "url": "https://www.uniprot.org/uniprotkb/Q14164" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.17702576", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 46 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Regulation of IRF-3-dependent innate immunity by the papain-like protease domain of the severe acute respiratory syndrome coronavirus.", "journal": "The Journal of biological chemistry", "date": "2007", "authors": "Devaraj SG, Wang N, Chen Z, Chen Z, Tseng M, Barretto N, Lin R, Peters CJ, Tseng CT, Baker SC, Li K", "reference": { "type": "PubMed", "id": "17761676", "url": "https://pubmed.ncbi.nlm.nih.gov/17761676" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q14164-1", "protein_name": "Inhibitor of nuclear factor kappa-B kinase subunit epsilon", "gene_name": "IKBKE", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UHD2-1", "protein_name": "Serine/threonine-protein kinase TBK1", "gene_name": "TBK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P25963-1", "protein_name": "NF-kappa-B inhibitor alpha", "gene_name": "NFKBIA", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43187-1", "protein_name": "Interleukin-1 receptor-associated kinase-like 2", "gene_name": "IRAK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9ULZ3-1", "protein_name": "Apoptosis-associated speck-like protein containing a CARD", "gene_name": "PYCARD", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y4K3-1", "protein_name": "TNF receptor-associated factor 6", "gene_name": "TRAF6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P29466-1", "protein_name": "Caspase-1", "gene_name": "CASP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86WV6-1", "protein_name": "Stimulator of interferon genes protein", "gene_name": "STING1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P19838-1", "protein_name": "Nuclear factor NF-kappa-B p105 subunit", "gene_name": "NFKB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UKA8-1", "protein_name": "Calcipressin-3", "gene_name": "RCAN3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13427-1", "protein_name": "Peptidyl-prolyl cis-trans isomerase G", "gene_name": "PPIG", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14258-1", "protein_name": "E3 ubiquitin/ISG15 ligase TRIM25", "gene_name": "TRIM25", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96P20-1", "protein_name": "NACHT, LRR and PYD domains-containing protein 3", "gene_name": "NLRP3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96J02-1", "protein_name": "E3 ubiquitin-protein ligase Itchy homolog", "gene_name": "ITCH", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01196-1", "protein_name": "Runt-related transcription factor 1", "gene_name": "RUNX1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14653-1", "protein_name": "Interferon regulatory factor 3", "gene_name": "IRF3", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95786-1", "protein_name": "Antiviral innate immune response receptor RIG-I", "gene_name": "DDX58; RIGI", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BRV8-1", "protein_name": "Suppressor of IKBKE 1", "gene_name": "SIKE1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92617-1", "protein_name": "Nuclear pore complex-interacting protein family member B3", "gene_name": "NPIPB3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35247-1", "protein_name": "Pulmonary surfactant-associated protein D", "gene_name": "SFTPD", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62937-1", "protein_name": "Peptidyl-prolyl cis-trans isomerase A", "gene_name": "PPIA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15366-1", "protein_name": "Poly(rC)-binding protein 2", "gene_name": "PCBP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NYK1-1", "protein_name": "Toll-like receptor 7", "gene_name": "TLR7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q7Z434-1", "protein_name": "Mitochondrial antiviral-signaling protein", "gene_name": "MAVS", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62942-1", "protein_name": "Peptidyl-prolyl cis-trans isomerase FKBP1A", "gene_name": "FKBP1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P52292-1", "protein_name": "Importin subunit alpha-1", "gene_name": "KPNA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P23284-1", "protein_name": "Peptidyl-prolyl cis-trans isomerase B", "gene_name": "PPIB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13287-1", "protein_name": "N-myc-interactor", "gene_name": "NMI", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62979-1", "protein_name": "Ubiquitin-ribosomal protein eS31 fusion protein", "gene_name": "RPS27A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y572-1", "protein_name": "Receptor-interacting serine/threonine-protein kinase 3", "gene_name": "RIPK3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q10589-1", "protein_name": "Bone marrow stromal antigen 2", "gene_name": "BST2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q3LXA3-1", "protein_name": "Triokinase/FMN cyclase", "gene_name": "TKFC", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BYX4-1", "protein_name": "Interferon-induced helicase C domain-containing protein 1", "gene_name": "IFIH1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O94826-1", "protein_name": "Mitochondrial import receptor subunit TOM70", "gene_name": "TOMM70", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG47-1", "protein_name": "Polyubiquitin-B", "gene_name": "UBB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13114-1", "protein_name": "TNF receptor-associated factor 3", "gene_name": "TRAF3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62987-1", "protein_name": "Ubiquitin-ribosomal protein eL40 fusion protein", "gene_name": "UBA52", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43447-1", "protein_name": "Peptidyl-prolyl cis-trans isomerase H", "gene_name": "PPIH", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14974-1", "protein_name": "Importin subunit beta-1", "gene_name": "KPNB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG48-1", "protein_name": "Polyubiquitin-C", "gene_name": "UBC", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q04206-1", "protein_name": "Transcription factor p65", "gene_name": "RELA", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q14164", "url": "https://www.uniprot.org/uniprotkb/Q14164" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 396, "end_pos": 396, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by IKKE and TBK1", "evidence": [ { "database": "UniProtKB", "id": "Q14653", "url": "https://www.uniprot.org/uniprotkb/Q14653" }, { "database": "iPTMnet", "id": "Q14653", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q14653" }, { "database": "PubMed", "id": "12524442", "url": "https://pubmed.ncbi.nlm.nih.gov/12524442" }, { "database": "PRO", "id": "Q14653", "url": "https://proconsortium.org/cgi-bin/entry_pro?id=Q14653" }, { "database": "PubMed", "id": "17761676", "url": "https://pubmed.ncbi.nlm.nih.gov/17761676" }, { "database": "PubMed", "id": "18356163", "url": "https://pubmed.ncbi.nlm.nih.gov/18356163" }, { "database": "PubMed", "id": "19893624", "url": "https://pubmed.ncbi.nlm.nih.gov/19893624" }, { "database": "PubMed", "id": "20161788", "url": "https://pubmed.ncbi.nlm.nih.gov/20161788" }, { "database": "PubMed", "id": "20170763", "url": "https://pubmed.ncbi.nlm.nih.gov/20170763" }, { "database": "PubMed", "id": "20416917", "url": "https://pubmed.ncbi.nlm.nih.gov/20416917" }, { "database": "PubMed", "id": "20511230", "url": "https://pubmed.ncbi.nlm.nih.gov/20511230" }, { "database": "PubMed", "id": "20532218", "url": "https://pubmed.ncbi.nlm.nih.gov/20532218" }, { "database": "PubMed", "id": "20609418", "url": "https://pubmed.ncbi.nlm.nih.gov/20609418" }, { "database": "PubMed", "id": "20694008", "url": "https://pubmed.ncbi.nlm.nih.gov/20694008" }, { "database": "PubMed", "id": "21347389", "url": "https://pubmed.ncbi.nlm.nih.gov/21347389" }, { "database": "PubMed", "id": "23090018", "url": "https://pubmed.ncbi.nlm.nih.gov/23090018" }, { "database": "PubMed", "id": "23633948", "url": "https://pubmed.ncbi.nlm.nih.gov/23633948" }, { "database": "PubMed", "id": "24722368", "url": "https://pubmed.ncbi.nlm.nih.gov/24722368" }, { "database": "PubMed", "id": "24870145", "url": "https://pubmed.ncbi.nlm.nih.gov/24870145" }, { "database": "PubMed", "id": "25444175", "url": "https://pubmed.ncbi.nlm.nih.gov/25444175" }, { "database": "PubMed", "id": "25891802", "url": "https://pubmed.ncbi.nlm.nih.gov/25891802" }, { "database": "PubMed", "id": "25923723", "url": "https://pubmed.ncbi.nlm.nih.gov/25923723" }, { "database": "PubMed", "id": "26811330", "url": "https://pubmed.ncbi.nlm.nih.gov/26811330" }, { "database": "PubMed", "id": "27576490", "url": "https://pubmed.ncbi.nlm.nih.gov/27576490" }, { "database": "PubMed", "id": "27791205", "url": "https://pubmed.ncbi.nlm.nih.gov/27791205" }, { "database": "PubMed", "id": "28150813", "url": "https://pubmed.ncbi.nlm.nih.gov/28150813" }, { "database": "PubMed", "id": "28589097", "url": "https://pubmed.ncbi.nlm.nih.gov/28589097" }, { "database": "PubMed", "id": "28717003", "url": "https://pubmed.ncbi.nlm.nih.gov/28717003" }, { "database": "PubMed", "id": "29677136", "url": "https://pubmed.ncbi.nlm.nih.gov/29677136" }, { "database": "PubMed", "id": "29962372", "url": "https://pubmed.ncbi.nlm.nih.gov/29962372" }, { "database": "PubMed", "id": "30323286", "url": "https://pubmed.ncbi.nlm.nih.gov/30323286" }, { "database": "PubMed", "id": "30867315", "url": "https://pubmed.ncbi.nlm.nih.gov/30867315" }, { "database": "PubMed", "id": "31618847", "url": "https://pubmed.ncbi.nlm.nih.gov/31618847" }, { "database": "PubMed", "id": "31686982", "url": "https://pubmed.ncbi.nlm.nih.gov/31686982" }, { "database": "PubMed", "id": "32179480", "url": "https://pubmed.ncbi.nlm.nih.gov/32179480" }, { "database": "PubMed", "id": "32634441", "url": "https://pubmed.ncbi.nlm.nih.gov/32634441" }, { "database": "PubMed", "id": "32783398", "url": "https://pubmed.ncbi.nlm.nih.gov/32783398" }, { "database": "PubMed", "id": "33253291", "url": "https://pubmed.ncbi.nlm.nih.gov/33253291" }, { "database": "PubMed", "id": "33300875", "url": "https://pubmed.ncbi.nlm.nih.gov/33300875" }, { "database": "PubMed", "id": "33391252", "url": "https://pubmed.ncbi.nlm.nih.gov/33391252" }, { "database": "PubMed", "id": "33603735", "url": "https://pubmed.ncbi.nlm.nih.gov/33603735" }, { "database": "PubMed", "id": "33986734", "url": "https://pubmed.ncbi.nlm.nih.gov/33986734" }, { "database": "PubMed", "id": "23478265", "url": "https://pubmed.ncbi.nlm.nih.gov/23478265" }, { "database": "PubMed", "id": "27302953", "url": "https://pubmed.ncbi.nlm.nih.gov/27302953" }, { "database": "PubMed", "id": "36603579", "url": "https://pubmed.ncbi.nlm.nih.gov/36603579" }, { "database": "PubMed", "id": "22394562", "url": "https://pubmed.ncbi.nlm.nih.gov/22394562" } ], "site_lbl": "Ser396", "uniprot_canonical_ac": "Q14653-1" } ], "record_id": "pubmed.17761676", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 41 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Lipopolysaccharide-mediated interferon regulatory factor activation involves TBK1-IKKepsilon-dependent Lys(63)-linked polyubiquitination and phosphorylation of TANK/I-TRAF.", "journal": "The Journal of biological chemistry", "date": "2007", "authors": "Gatot JS, Gioia R, Chau TL, Patrascu F, Warnier M, Close P, Chapelle JP, Muraille E, Brown K, Siebenlist U, Piette J, Dejardin E, Chariot A", "reference": { "type": "PubMed", "id": "17823124", "url": "https://pubmed.ncbi.nlm.nih.gov/17823124" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q14164-1", "protein_name": "Inhibitor of nuclear factor kappa-B kinase subunit epsilon", "gene_name": "IKBKE", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UHD2-1", "protein_name": "Serine/threonine-protein kinase TBK1", "gene_name": "TBK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92844-1", "protein_name": "TRAF family member-associated NF-kappa-B activator", "gene_name": "TANK", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14653-1", "protein_name": "Interferon regulatory factor 3", "gene_name": "IRF3", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00206-1", "protein_name": "Toll-like receptor 4", "gene_name": "TLR4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y6Y9-1", "protein_name": "Lymphocyte antigen 96", "gene_name": "LY96", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96CV9-1", "protein_name": "Optineurin", "gene_name": "OPTN", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92985-1", "protein_name": "Interferon regulatory factor 7", "gene_name": "IRF7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q06124-2", "protein_name": "Tyrosine-protein phosphatase non-receptor type 11", "gene_name": "PTPN11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62979-1", "protein_name": "Ubiquitin-ribosomal protein eS31 fusion protein", "gene_name": "RPS27A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG47-1", "protein_name": "Polyubiquitin-B", "gene_name": "UBB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13114-1", "protein_name": "TNF receptor-associated factor 3", "gene_name": "TRAF3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P08571-1", "protein_name": "Monocyte differentiation antigen CD14", "gene_name": "CD14", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62987-1", "protein_name": "Ubiquitin-ribosomal protein eL40 fusion protein", "gene_name": "UBA52", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86XR7-1", "protein_name": "TIR domain-containing adapter molecule 2", "gene_name": "TICAM2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8IUC6-1", "protein_name": "TIR domain-containing adapter molecule 1", "gene_name": "TICAM1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG48-1", "protein_name": "Polyubiquitin-C", "gene_name": "UBC", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q14164", "url": "https://www.uniprot.org/uniprotkb/Q14164" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.17823124", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 17 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "DUBA: a deubiquitinase that regulates type I interferon production.", "journal": "Science (New York, N.Y.)", "date": "2007", "authors": "Kayagaki N, Phung Q, Chan S, Chaudhari R, Quan C, O'Rourke KM, Eby M, Pietras E, Cheng G, Bazan JF, Zhang Z, Arnott D, Dixit VM", "reference": { "type": "PubMed", "id": "17991829", "url": "https://pubmed.ncbi.nlm.nih.gov/17991829" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q14164-1", "protein_name": "Inhibitor of nuclear factor kappa-B kinase subunit epsilon", "gene_name": "IKBKE", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UHD2-1", "protein_name": "Serine/threonine-protein kinase TBK1", "gene_name": "TBK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P21580-1", "protein_name": "Tumor necrosis factor alpha-induced protein 3", "gene_name": "TNFAIP3", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14933-1", "protein_name": "Ubiquitin/ISG15-conjugating enzyme E2 L6", "gene_name": "UBE2L6", "tax_name": "Human" }, { "uniprot_canonical_ac": "O94817-1", "protein_name": "Ubiquitin-like protein ATG12", "gene_name": "ATG12", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96G74-1", "protein_name": "OTU domain-containing protein 5", "gene_name": "OTUD5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61086-1", "protein_name": "Ubiquitin-conjugating enzyme E2 K", "gene_name": "UBE2K", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96EQ8-1", "protein_name": "E3 ubiquitin-protein ligase RNF125", "gene_name": "RNF125", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61077-1", "protein_name": "Ubiquitin-conjugating enzyme E2 D3", "gene_name": "UBE2D3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14258-1", "protein_name": "E3 ubiquitin/ISG15 ligase TRIM25", "gene_name": "TRIM25", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51668-1", "protein_name": "Ubiquitin-conjugating enzyme E2 D1", "gene_name": "UBE2D1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96J02-1", "protein_name": "E3 ubiquitin-protein ligase Itchy homolog", "gene_name": "ITCH", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86VP1-1", "protein_name": "Tax1-binding protein 1", "gene_name": "TAX1BP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14653-1", "protein_name": "Interferon regulatory factor 3", "gene_name": "IRF3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NQC7-1", "protein_name": "Ubiquitin carboxyl-terminal hydrolase CYLD", "gene_name": "CYLD", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95786-1", "protein_name": "Antiviral innate immune response receptor RIG-I", "gene_name": "DDX58; RIGI", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86WI3-1", "protein_name": "Protein NLRC5", "gene_name": "NLRC5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P41226-1", "protein_name": "Ubiquitin-like modifier-activating enzyme 7", "gene_name": "UBA7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15366-1", "protein_name": "Poly(rC)-binding protein 2", "gene_name": "PCBP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9C037-1", "protein_name": "E3 ubiquitin-protein ligase TRIM4", "gene_name": "TRIM4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q7Z434-1", "protein_name": "Mitochondrial antiviral-signaling protein", "gene_name": "MAVS", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H1Y0-1", "protein_name": "Autophagy protein 5", "gene_name": "ATG5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8IUD6-1", "protein_name": "E3 ubiquitin-protein ligase RNF135", "gene_name": "RNF135", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62979-1", "protein_name": "Ubiquitin-ribosomal protein eS31 fusion protein", "gene_name": "RPS27A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62837-1", "protein_name": "Ubiquitin-conjugating enzyme E2 D2", "gene_name": "UBE2D2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86UT6-1", "protein_name": "NLR family member X1", "gene_name": "NLRX1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UII4-1", "protein_name": "E3 ISG15--protein ligase HERC5", "gene_name": "HERC5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BYX4-1", "protein_name": "Interferon-induced helicase C domain-containing protein 1", "gene_name": "IFIH1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG47-1", "protein_name": "Polyubiquitin-B", "gene_name": "UBB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13114-1", "protein_name": "TNF receptor-associated factor 3", "gene_name": "TRAF3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62987-1", "protein_name": "Ubiquitin-ribosomal protein eL40 fusion protein", "gene_name": "UBA52", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NWF9-2", "protein_name": "E3 ubiquitin-protein ligase RNF216", "gene_name": "RNF216", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05161-1", "protein_name": "Ubiquitin-like protein ISG15", "gene_name": "ISG15", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13526-1", "protein_name": "Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1", "gene_name": "PIN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG48-1", "protein_name": "Polyubiquitin-C", "gene_name": "UBC", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q14164", "url": "https://www.uniprot.org/uniprotkb/Q14164" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 224, "end_pos": 224, "sequence_org": "C", "sequence_mut": "S", "comment": "Loss of deubiquitinase activity. Loss of suppression of IFN production. No effect on nuclear location.", "evidence": [ { "database": "UniProtKB", "id": "Q96G74", "url": "https://www.uniprot.org/uniprotkb/Q96G74" }, { "database": "PubMed", "id": "22245969", "url": "https://pubmed.ncbi.nlm.nih.gov/22245969" }, { "database": "PubMed", "id": "17991829", "url": "https://pubmed.ncbi.nlm.nih.gov/17991829" }, { "database": "PubMed", "id": "33523931", "url": "https://pubmed.ncbi.nlm.nih.gov/33523931" }, { "database": "PubMed", "id": "33110214", "url": "https://pubmed.ncbi.nlm.nih.gov/33110214" } ], "uniprot_canonical_ac": "Q96G74-1" }, { "start_pos": 542, "end_pos": 542, "sequence_org": "L", "sequence_mut": "A", "comment": "Loss of 'K-48'- and 'K-63'-linked polyubiquitin chain binding. Partial loss of TRAF3 deubiquitination; when associated with A-549.", "evidence": [ { "database": "UniProtKB", "id": "Q96G74", "url": "https://www.uniprot.org/uniprotkb/Q96G74" }, { "database": "PubMed", "id": "17991829", "url": "https://pubmed.ncbi.nlm.nih.gov/17991829" } ], "uniprot_canonical_ac": "Q96G74-1" }, { "start_pos": 549, "end_pos": 549, "sequence_org": "S", "sequence_mut": "A", "comment": "Loss of 'K-48'- and 'K-63'-linked polyubiquitin chain binding. Partial loss of TRAF3 deubiquitination; when associated with A-542.", "evidence": [ { "database": "UniProtKB", "id": "Q96G74", "url": "https://www.uniprot.org/uniprotkb/Q96G74" }, { "database": "PubMed", "id": "17991829", "url": "https://pubmed.ncbi.nlm.nih.gov/17991829" } ], "uniprot_canonical_ac": "Q96G74-1" } ], "record_id": "pubmed.17991829", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 35 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "NF-kappaB suppression by the deubiquitinating enzyme Cezanne: a novel negative feedback loop in pro-inflammatory signaling.", "journal": "The Journal of biological chemistry", "date": "2008", "authors": "Enesa K, Zakkar M, Chaudhury H, Luong le A, Rawlinson L, Mason JC, Haskard DO, Dean JL, Evans PC", "reference": { "type": "PubMed", "id": "18178551", "url": "https://pubmed.ncbi.nlm.nih.gov/18178551" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q14164-1", "protein_name": "Inhibitor of nuclear factor kappa-B kinase subunit epsilon", "gene_name": "IKBKE", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UHD2-1", "protein_name": "Serine/threonine-protein kinase TBK1", "gene_name": "TBK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15111-1", "protein_name": "Inhibitor of nuclear factor kappa-B kinase subunit alpha", "gene_name": "CHUK", "tax_name": "Human" }, { "uniprot_canonical_ac": "P98170-1", "protein_name": "E3 ubiquitin-protein ligase XIAP", "gene_name": "XIAP", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13546-1", "protein_name": "Receptor-interacting serine/threonine-protein kinase 1", "gene_name": "RIPK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75385-1", "protein_name": "Serine/threonine-protein kinase ULK1", "gene_name": "ULK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P21580-1", "protein_name": "Tumor necrosis factor alpha-induced protein 3", "gene_name": "TNFAIP3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68036-1", "protein_name": "Ubiquitin-conjugating enzyme E2 L3", "gene_name": "UBE2L3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96DZ5-1", "protein_name": "CAP-Gly domain-containing linker protein 3", "gene_name": "CLIP3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P19438-1", "protein_name": "Tumor necrosis factor receptor superfamily member 1A", "gene_name": "TNFRSF1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UM82-1", "protein_name": "Spermatogenesis-associated protein 2", "gene_name": "SPATA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49137-1", "protein_name": "MAP kinase-activated protein kinase 2", "gene_name": "MAPKAPK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BYM8-1", "protein_name": "RanBP-type and C3HC4-type zinc finger-containing protein 1", "gene_name": "RBCK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96EP0-1", "protein_name": "E3 ubiquitin-protein ligase RNF31", "gene_name": "RNF31", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H0F6-1", "protein_name": "Sharpin", "gene_name": "SHARPIN", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5VV17-1", "protein_name": "OTU domain-containing protein 1", "gene_name": "OTUD1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96AX9-1", "protein_name": "E3 ubiquitin-protein ligase MIB2", "gene_name": "MIB2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TCT8-1", "protein_name": "Signal peptide peptidase-like 2A", "gene_name": "SPPL2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14920-1", "protein_name": "Inhibitor of nuclear factor kappa-B kinase subunit beta", "gene_name": "IKBKB", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61077-1", "protein_name": "Ubiquitin-conjugating enzyme E2 D3", "gene_name": "UBE2D3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51668-1", "protein_name": "Ubiquitin-conjugating enzyme E2 D1", "gene_name": "UBE2D1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86VP1-1", "protein_name": "Tax1-binding protein 1", "gene_name": "TAX1BP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13158-1", "protein_name": "FAS-associated death domain protein", "gene_name": "FADD", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6GQQ9-1", "protein_name": "OTU domain-containing protein 7B", "gene_name": "OTUD7B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NQC7-1", "protein_name": "Ubiquitin carboxyl-terminal hydrolase CYLD", "gene_name": "CYLD", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UK80-1", "protein_name": "Ubiquitin carboxyl-terminal hydrolase 21", "gene_name": "USP21", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TCT7-1", "protein_name": "Signal peptide peptidase-like 2B", "gene_name": "SPPL2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96CV9-1", "protein_name": "Optineurin", "gene_name": "OPTN", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13077-1", "protein_name": "TNF receptor-associated factor 1", "gene_name": "TRAF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14790-1", "protein_name": "Caspase-8", "gene_name": "CASP8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15628-1", "protein_name": "Tumor necrosis factor receptor type 1-associated DEATH domain protein", "gene_name": "TRADD", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13490-1", "protein_name": "Baculoviral IAP repeat-containing protein 2", "gene_name": "BIRC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62979-1", "protein_name": "Ubiquitin-ribosomal protein eS31 fusion protein", "gene_name": "RPS27A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62837-1", "protein_name": "Ubiquitin-conjugating enzyme E2 D2", "gene_name": "UBE2D2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13489-1", "protein_name": "Baculoviral IAP repeat-containing protein 3", "gene_name": "BIRC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01375-1", "protein_name": "Tumor necrosis factor", "gene_name": "TNF", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG47-1", "protein_name": "Polyubiquitin-B", "gene_name": "UBB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96BN8-1", "protein_name": "Ubiquitin thioesterase otulin", "gene_name": "OTULIN", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62987-1", "protein_name": "Ubiquitin-ribosomal protein eL40 fusion protein", "gene_name": "UBA52", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12933-1", "protein_name": "TNF receptor-associated factor 2", "gene_name": "TRAF2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y6K9-1", "protein_name": "NF-kappa-B essential modulator", "gene_name": "IKBKG", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13107-1", "protein_name": "Ubiquitin carboxyl-terminal hydrolase 4", "gene_name": "USP4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P63244-1", "protein_name": "Small ribosomal subunit protein RACK1", "gene_name": "RACK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG48-1", "protein_name": "Polyubiquitin-C", "gene_name": "UBC", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75604-1", "protein_name": "Ubiquitin carboxyl-terminal hydrolase 2", "gene_name": "USP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UNE7-1", "protein_name": "E3 ubiquitin-protein ligase CHIP", "gene_name": "STUB1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q14164", "url": "https://www.uniprot.org/uniprotkb/Q14164" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.18178551", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 46 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "NLRX1 is a regulator of mitochondrial antiviral immunity.", "journal": "Nature", "date": "2008", "authors": "Moore CB, Bergstralh DT, Duncan JA, Lei Y, Morrison TE, Zimmermann AG, Accavitti-Loper MA, Madden VJ, Sun L, Ye Z, Lich JD, Heise MT, Chen Z, Ting JP", "reference": { "type": "PubMed", "id": "18200010", "url": "https://pubmed.ncbi.nlm.nih.gov/18200010" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q14164-1", "protein_name": "Inhibitor of nuclear factor kappa-B kinase subunit epsilon", "gene_name": "IKBKE", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UHD2-1", "protein_name": "Serine/threonine-protein kinase TBK1", "gene_name": "TBK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P21580-1", "protein_name": "Tumor necrosis factor alpha-induced protein 3", "gene_name": "TNFAIP3", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14933-1", "protein_name": "Ubiquitin/ISG15-conjugating enzyme E2 L6", "gene_name": "UBE2L6", "tax_name": "Human" }, { "uniprot_canonical_ac": "O94817-1", "protein_name": "Ubiquitin-like protein ATG12", "gene_name": "ATG12", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A8V0ZYD5-1", "protein_name": "NLR family member X1", "gene_name": "NLRX1", "tax_name": "Chicken" }, { "uniprot_canonical_ac": "Q96G74-1", "protein_name": "OTU domain-containing protein 5", "gene_name": "OTUD5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61086-1", "protein_name": "Ubiquitin-conjugating enzyme E2 K", "gene_name": "UBE2K", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96EQ8-1", "protein_name": "E3 ubiquitin-protein ligase RNF125", "gene_name": "RNF125", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61077-1", "protein_name": "Ubiquitin-conjugating enzyme E2 D3", "gene_name": "UBE2D3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14258-1", "protein_name": "E3 ubiquitin/ISG15 ligase TRIM25", "gene_name": "TRIM25", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51668-1", "protein_name": "Ubiquitin-conjugating enzyme E2 D1", "gene_name": "UBE2D1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96J02-1", "protein_name": "E3 ubiquitin-protein ligase Itchy homolog", "gene_name": "ITCH", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86VP1-1", "protein_name": "Tax1-binding protein 1", "gene_name": "TAX1BP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14653-1", "protein_name": "Interferon regulatory factor 3", "gene_name": "IRF3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62985-1", "protein_name": "Ubiquitin-ribosomal protein eL40 fusion protein", "gene_name": "UBA52", "tax_name": "Chicken" }, { "uniprot_canonical_ac": "Q9NQC7-1", "protein_name": "Ubiquitin carboxyl-terminal hydrolase CYLD", "gene_name": "CYLD", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95786-1", "protein_name": "Antiviral innate immune response receptor RIG-I", "gene_name": "DDX58; RIGI", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86WI3-1", "protein_name": "Protein NLRC5", "gene_name": "NLRC5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P41226-1", "protein_name": "Ubiquitin-like modifier-activating enzyme 7", "gene_name": "UBA7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15366-1", "protein_name": "Poly(rC)-binding protein 2", "gene_name": "PCBP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9C037-1", "protein_name": "E3 ubiquitin-protein ligase TRIM4", "gene_name": "TRIM4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q7Z434-1", "protein_name": "Mitochondrial antiviral-signaling protein", "gene_name": "MAVS", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H1Y0-1", "protein_name": "Autophagy protein 5", "gene_name": "ATG5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8IUD6-1", "protein_name": "E3 ubiquitin-protein ligase RNF135", "gene_name": "RNF135", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A8V0ZZH3-1", "protein_name": "E3 ubiquitin-protein ligase", "gene_name": "ITCH", "tax_name": "Chicken" }, { "uniprot_canonical_ac": "P0CG62-1", "protein_name": "Polyubiquitin-B", "gene_name": "UBB", "tax_name": "Chicken" }, { "uniprot_canonical_ac": "P62979-1", "protein_name": "Ubiquitin-ribosomal protein eS31 fusion protein", "gene_name": "RPS27A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62837-1", "protein_name": "Ubiquitin-conjugating enzyme E2 D2", "gene_name": "UBE2D2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86UT6-1", "protein_name": "NLR family member X1", "gene_name": "NLRX1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UII4-1", "protein_name": "E3 ISG15--protein ligase HERC5", "gene_name": "HERC5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BYX4-1", "protein_name": "Interferon-induced helicase C domain-containing protein 1", "gene_name": "IFIH1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P79781-1", "protein_name": "Ubiquitin-ribosomal protein eS31 fusion protein", "gene_name": "RPS27A", "tax_name": "Chicken" }, { "uniprot_canonical_ac": "P0CG47-1", "protein_name": "Polyubiquitin-B", "gene_name": "UBB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13114-1", "protein_name": "TNF receptor-associated factor 3", "gene_name": "TRAF3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62987-1", "protein_name": "Ubiquitin-ribosomal protein eL40 fusion protein", "gene_name": "UBA52", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NWF9-2", "protein_name": "E3 ubiquitin-protein ligase RNF216", "gene_name": "RNF216", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05161-1", "protein_name": "Ubiquitin-like protein ISG15", "gene_name": "ISG15", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13526-1", "protein_name": "Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1", "gene_name": "PIN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG48-1", "protein_name": "Polyubiquitin-C", "gene_name": "UBC", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q14164", "url": "https://www.uniprot.org/uniprotkb/Q14164" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.18200010", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 40 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "CLEC5A is critical for dengue-virus-induced lethal disease.", "journal": "Nature", "date": "2008", "authors": "Chen ST, Lin YL, Huang MT, Wu MF, Cheng SC, Lei HY, Lee CK, Chiou TW, Wong CH, Hsieh SL", "reference": { "type": "PubMed", "id": "18496526", "url": "https://pubmed.ncbi.nlm.nih.gov/18496526" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q14164-1", "protein_name": "Inhibitor of nuclear factor kappa-B kinase subunit epsilon", "gene_name": "IKBKE", "tax_name": "Human" }, { "uniprot_canonical_ac": "P10909-1", "protein_name": "Clusterin", "gene_name": "CLU", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86WV6-1", "protein_name": "Stimulator of interferon genes protein", "gene_name": "STING1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P11226-1", "protein_name": "Mannose-binding protein C", "gene_name": "MBL2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NY25-1", "protein_name": "C-type lectin domain family 5 member A", "gene_name": "CLEC5A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N7H5-1", "protein_name": "RNA polymerase II-associated factor 1 homolog", "gene_name": "PAF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6PD62-1", "protein_name": "RNA polymerase-associated protein CTR9 homolog", "gene_name": "CTR9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8WVC0-1", "protein_name": "RNA polymerase-associated protein LEO1", "gene_name": "LEO1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92541-1", "protein_name": "RNA polymerase-associated protein RTF1 homolog", "gene_name": "RTF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14258-1", "protein_name": "E3 ubiquitin/ISG15 ligase TRIM25", "gene_name": "TRIM25", "tax_name": "Human" }, { "uniprot_canonical_ac": "P09871-1", "protein_name": "Complement C1s subcomponent", "gene_name": "C1S", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04003-1", "protein_name": "C4b-binding protein alpha chain", "gene_name": "C4BPA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P20851-1", "protein_name": "C4b-binding protein beta chain", "gene_name": "C4BPB", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0C0L5-1", "protein_name": "Complement C4-B", "gene_name": "C4B_2; C4B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0C0L4-1", "protein_name": "Complement C4-A", "gene_name": "C4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P52630-3", "protein_name": "Signal transducer and activator of transcription 2", "gene_name": "STAT2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P08238-1", "protein_name": "Heat shock protein HSP 90-beta", "gene_name": "HSP90AB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q7Z434-1", "protein_name": "Mitochondrial antiviral-signaling protein", "gene_name": "MAVS", "tax_name": "Human" }, { "uniprot_canonical_ac": "P07900-1", "protein_name": "Heat shock protein HSP 90-alpha", "gene_name": "HSP90AA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P98175-1", "protein_name": "RNA-binding protein 10", "gene_name": "RBM10", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00571-1", "protein_name": "ATP-dependent RNA helicase DDX3X", "gene_name": "DDX3X", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9GZS3-1", "protein_name": "Superkiller complex protein 8", "gene_name": "SKIC8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6P1J9-1", "protein_name": "Parafibromin", "gene_name": "CDC73", "tax_name": "Human" }, { "uniprot_canonical_ac": "P02745-1", "protein_name": "Complement C1q subcomponent subunit A", "gene_name": "C1QA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04004-1", "protein_name": "Vitronectin", "gene_name": "VTN", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BYX4-1", "protein_name": "Interferon-induced helicase C domain-containing protein 1", "gene_name": "IFIH1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5T4S7-1", "protein_name": "E3 ubiquitin-protein ligase UBR4", "gene_name": "UBR4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N884-1", "protein_name": "Cyclic GMP-AMP synthase", "gene_name": "CGAS", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NV70-1", "protein_name": "Exocyst complex component 1", "gene_name": "EXOC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P02647-1", "protein_name": "Apolipoprotein A-I", "gene_name": "APOA1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q14164", "url": "https://www.uniprot.org/uniprotkb/Q14164" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.18496526", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 30 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The DEAD-box helicase DDX3X is a critical component of the TANK-binding kinase 1-dependent innate immune response.", "journal": "The EMBO journal", "date": "2008", "authors": "Soulat D, Burckstummer T, Westermayer S, Goncalves A, Bauch A, Stefanovic A, Hantschel O, Bennett KL, Decker T, Superti-Furga G", "reference": { "type": "PubMed", "id": "18583960", "url": "https://pubmed.ncbi.nlm.nih.gov/18583960" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q14164-1", "protein_name": "Inhibitor of nuclear factor kappa-B kinase subunit epsilon", "gene_name": "IKBKE", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UHD2-1", "protein_name": "Serine/threonine-protein kinase TBK1", "gene_name": "TBK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00571-1", "protein_name": "ATP-dependent RNA helicase DDX3X", "gene_name": "DDX3X", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q62167-1", "protein_name": "ATP-dependent RNA helicase DDX3X", "gene_name": "Ddx3x", "tax_name": "Mouse" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q14164", "url": "https://www.uniprot.org/uniprotkb/Q14164" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 181, "end_pos": 181, "sequence_org": "S", "sequence_mut": "A", "comment": "Greatly impairs phosphorylation by TBK1 and fails to synergize with TBK1 in IFNB1 induction; when associated with A-183; A-240 and A-269.", "evidence": [ { "database": "UniProtKB", "id": "O00571", "url": "https://www.uniprot.org/uniprotkb/O00571" }, { "database": "PubMed", "id": "18583960", "url": "https://pubmed.ncbi.nlm.nih.gov/18583960" } ], "uniprot_canonical_ac": "O00571-1" }, { "start_pos": 183, "end_pos": 183, "sequence_org": "S", "sequence_mut": "A", "comment": "Greatly impairs phosphorylation by TBK1 and fails to synergize with TBK1 in IFN-beta induction; when associated with A-181; A-240 and A-269.", "evidence": [ { "database": "UniProtKB", "id": "O00571", "url": "https://www.uniprot.org/uniprotkb/O00571" }, { "database": "PubMed", "id": "18583960", "url": "https://pubmed.ncbi.nlm.nih.gov/18583960" } ], "uniprot_canonical_ac": "O00571-1" }, { "start_pos": 230, "end_pos": 230, "sequence_org": "K", "sequence_mut": "E", "comment": "Complete loss of ATPase and RNA-unwinding activities. Loss of HIV-1 mRNA nuclear export. Does not promote the translation of HIV-1 RNA. No effect on IFNB1 induction. No effect on RNA-binding. Loss of inhibition of NF-kappa-B-mediated transcriptional activity.", "evidence": [ { "database": "UniProtKB", "id": "O00571", "url": "https://www.uniprot.org/uniprotkb/O00571" }, { "database": "PubMed", "id": "21589879", "url": "https://pubmed.ncbi.nlm.nih.gov/21589879" }, { "database": "PubMed", "id": "22872150", "url": "https://pubmed.ncbi.nlm.nih.gov/22872150" }, { "database": "PubMed", "id": "18636090", "url": "https://pubmed.ncbi.nlm.nih.gov/18636090" }, { "database": "PubMed", "id": "15507209", "url": "https://pubmed.ncbi.nlm.nih.gov/15507209" }, { "database": "PubMed", "id": "18583960", "url": "https://pubmed.ncbi.nlm.nih.gov/18583960" }, { "database": "PubMed", "id": "27736973", "url": "https://pubmed.ncbi.nlm.nih.gov/27736973" } ], "uniprot_canonical_ac": "O00571-1" }, { "start_pos": 240, "end_pos": 240, "sequence_org": "S", "sequence_mut": "A", "comment": "Greatly impairs phosphorylation by TBK1 and fails to synergize with TBK1 in IFN-beta induction; when associated with A-181; A-183 and A-269.", "evidence": [ { "database": "UniProtKB", "id": "O00571", "url": "https://www.uniprot.org/uniprotkb/O00571" }, { "database": "PubMed", "id": "18583960", "url": "https://pubmed.ncbi.nlm.nih.gov/18583960" } ], "uniprot_canonical_ac": "O00571-1" }, { "start_pos": 269, "end_pos": 269, "sequence_org": "S", "sequence_mut": "A", "comment": "Greatly impairs phosphorylation by TBK1 and fails to synergize with TBK1 in IFN-beta induction; when associated with A-181; A-183 and A-240.", "evidence": [ { "database": "UniProtKB", "id": "O00571", "url": "https://www.uniprot.org/uniprotkb/O00571" }, { "database": "PubMed", "id": "18583960", "url": "https://pubmed.ncbi.nlm.nih.gov/18583960" } ], "uniprot_canonical_ac": "O00571-1" }, { "start_pos": 429, "end_pos": 429, "sequence_org": "S", "sequence_mut": "A", "comment": "Impairs phosphorylation by TBK1 and fails to synergize with TBK1 in IFN-beta induction; when associated with A-438; A-442; A-456 and A-520.", "evidence": [ { "database": "UniProtKB", "id": "O00571", "url": "https://www.uniprot.org/uniprotkb/O00571" }, { "database": "PubMed", "id": "18583960", "url": "https://pubmed.ncbi.nlm.nih.gov/18583960" } ], "uniprot_canonical_ac": "O00571-1" }, { "start_pos": 438, "end_pos": 438, "sequence_org": "T", "sequence_mut": "A", "comment": "Impairs phosphorylation by TBK1 and fails to synergize with TBK1 in IFN-beta induction; when associated with A-429; A-442; A-456 and A-520.", "evidence": [ { "database": "UniProtKB", "id": "O00571", "url": "https://www.uniprot.org/uniprotkb/O00571" }, { "database": "PubMed", "id": "18583960", "url": "https://pubmed.ncbi.nlm.nih.gov/18583960" } ], "uniprot_canonical_ac": "O00571-1" }, { "start_pos": 442, "end_pos": 442, "sequence_org": "S", "sequence_mut": "A", "comment": "Impairs phosphorylation by TBK1 and fails to synergize with TBK1 in IFN-beta induction; when associated with A-429; A-438; A-456 and A-520.", "evidence": [ { "database": "UniProtKB", "id": "O00571", "url": "https://www.uniprot.org/uniprotkb/O00571" }, { "database": "PubMed", "id": "18583960", "url": "https://pubmed.ncbi.nlm.nih.gov/18583960" } ], "uniprot_canonical_ac": "O00571-1" }, { "start_pos": 456, "end_pos": 456, "sequence_org": "S", "sequence_mut": "A", "comment": "Impairs phosphorylation by TBK1 and fails to synergize with TBK1 in IFN-beta induction; when associated with A-429; A-438; A-442 and A-520.", "evidence": [ { "database": "UniProtKB", "id": "O00571", "url": "https://www.uniprot.org/uniprotkb/O00571" }, { "database": "PubMed", "id": "18583960", "url": "https://pubmed.ncbi.nlm.nih.gov/18583960" } ], "uniprot_canonical_ac": "O00571-1" }, { "start_pos": 520, "end_pos": 520, "sequence_org": "S", "sequence_mut": "A", "comment": "Impairs phosphorylation by TBK1 and fails to synergize with TBK1 in IFN-beta induction; when associated with A-429; A-438; A-442 and A-456.", "evidence": [ { "database": "UniProtKB", "id": "O00571", "url": "https://www.uniprot.org/uniprotkb/O00571" }, { "database": "PubMed", "id": "18583960", "url": "https://pubmed.ncbi.nlm.nih.gov/18583960" } ], "uniprot_canonical_ac": "O00571-1" } ], "phosphorylation": [ { "start_pos": 181, "end_pos": 181, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by TBK1; in vitro", "evidence": [ { "database": "UniProtKB", "id": "O00571", "url": "https://www.uniprot.org/uniprotkb/O00571" }, { "database": "iPTMnet", "id": "O00571", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O00571" }, { "database": "PubMed", "id": "18583960", "url": "https://pubmed.ncbi.nlm.nih.gov/18583960" } ], "site_lbl": "Ser181", "uniprot_canonical_ac": "O00571-1" }, { "start_pos": 183, "end_pos": 183, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by TBK1", "evidence": [ { "database": "UniProtKB", "id": "O00571", "url": "https://www.uniprot.org/uniprotkb/O00571" }, { "database": "iPTMnet", "id": "O00571", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O00571" }, { "database": "PubMed", "id": "24275569", "url": "https://pubmed.ncbi.nlm.nih.gov/24275569" }, { "database": "PubMed", "id": "18583960", "url": "https://pubmed.ncbi.nlm.nih.gov/18583960" } ], "site_lbl": "Ser183", "uniprot_canonical_ac": "O00571-1" }, { "start_pos": 240, "end_pos": 240, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by TBK1; in vitro", "evidence": [ { "database": "UniProtKB", "id": "O00571", "url": "https://www.uniprot.org/uniprotkb/O00571" }, { "database": "iPTMnet", "id": "O00571", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O00571" }, { "database": "PubMed", "id": "18583960", "url": "https://pubmed.ncbi.nlm.nih.gov/18583960" } ], "site_lbl": "Ser240", "uniprot_canonical_ac": "O00571-1" }, { "start_pos": 269, "end_pos": 269, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by TBK1; in vitro", "evidence": [ { "database": "UniProtKB", "id": "O00571", "url": "https://www.uniprot.org/uniprotkb/O00571" }, { "database": "iPTMnet", "id": "O00571", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O00571" }, { "database": "PubMed", "id": "18583960", "url": "https://pubmed.ncbi.nlm.nih.gov/18583960" } ], "site_lbl": "Ser269", "uniprot_canonical_ac": "O00571-1" }, { "start_pos": 429, "end_pos": 429, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by CSNK1E and TBK1; in vitro", "evidence": [ { "database": "UniProtKB", "id": "O00571", "url": "https://www.uniprot.org/uniprotkb/O00571" }, { "database": "iPTMnet", "id": "O00571", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O00571" }, { "database": "PubMed", "id": "29222110", "url": "https://pubmed.ncbi.nlm.nih.gov/29222110" }, { "database": "PubMed", "id": "18583960", "url": "https://pubmed.ncbi.nlm.nih.gov/18583960" } ], "site_lbl": "Ser429", "uniprot_canonical_ac": "O00571-1" }, { "start_pos": 438, "end_pos": 438, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine; by TBK1; in vitro", "evidence": [ { "database": "UniProtKB", "id": "O00571", "url": "https://www.uniprot.org/uniprotkb/O00571" }, { "database": "iPTMnet", "id": "O00571", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O00571" }, { "database": "PubMed", "id": "18583960", "url": "https://pubmed.ncbi.nlm.nih.gov/18583960" } ], "site_lbl": "Thr438", "uniprot_canonical_ac": "O00571-1" }, { "start_pos": 442, "end_pos": 442, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by TBK1; in vitro", "evidence": [ { "database": "UniProtKB", "id": "O00571", "url": "https://www.uniprot.org/uniprotkb/O00571" }, { "database": "iPTMnet", "id": "O00571", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O00571" }, { "database": "PubMed", "id": "18583960", "url": "https://pubmed.ncbi.nlm.nih.gov/18583960" } ], "site_lbl": "Ser442", "uniprot_canonical_ac": "O00571-1" }, { "start_pos": 456, "end_pos": 456, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by TBK1; in vitro", "evidence": [ { "database": "UniProtKB", "id": "O00571", "url": "https://www.uniprot.org/uniprotkb/O00571" }, { "database": "iPTMnet", "id": "O00571", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O00571" }, { "database": "PubMed", "id": "18583960", "url": "https://pubmed.ncbi.nlm.nih.gov/18583960" } ], "site_lbl": "Ser456", "uniprot_canonical_ac": "O00571-1" }, { "start_pos": 520, "end_pos": 520, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by TBK1; in vitro", "evidence": [ { "database": "UniProtKB", "id": "O00571", "url": "https://www.uniprot.org/uniprotkb/O00571" }, { "database": "iPTMnet", "id": "O00571", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O00571" }, { "database": "PubMed", "id": "18583960", "url": "https://pubmed.ncbi.nlm.nih.gov/18583960" } ], "site_lbl": "Ser520", "uniprot_canonical_ac": "O00571-1" }, { "start_pos": 542, "end_pos": 542, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine; by TBK1; in vitro", "evidence": [ { "database": "UniProtKB", "id": "O00571", "url": "https://www.uniprot.org/uniprotkb/O00571" }, { "database": "iPTMnet", "id": "O00571", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O00571" }, { "database": "PubMed", "id": "18583960", "url": "https://pubmed.ncbi.nlm.nih.gov/18583960" } ], "site_lbl": "Thr542", "uniprot_canonical_ac": "O00571-1" }, { "start_pos": 543, "end_pos": 543, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by CSNK1E and TBK1; in vitro", "evidence": [ { "database": "UniProtKB", "id": "O00571", "url": "https://www.uniprot.org/uniprotkb/O00571" }, { "database": "iPTMnet", "id": "O00571", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O00571" }, { "database": "PubMed", "id": "29222110", "url": "https://pubmed.ncbi.nlm.nih.gov/29222110" }, { "database": "PubMed", "id": "18583960", "url": "https://pubmed.ncbi.nlm.nih.gov/18583960" } ], "site_lbl": "Ser543", "uniprot_canonical_ac": "O00571-1" }, { "start_pos": 240, "end_pos": 240, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "IntAct", "id": "Q62167", "url": "https://www.ebi.ac.uk/intact/interactors/id:Q62167*" }, { "database": "iPTMnet", "id": "Q62167", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q62167" }, { "database": "PubMed", "id": "18583960", "url": "https://pubmed.ncbi.nlm.nih.gov/18583960" } ], "site_lbl": "Ser240", "uniprot_canonical_ac": "Q62167-1" }, { "start_pos": 269, "end_pos": 269, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "IntAct", "id": "Q62167", "url": "https://www.ebi.ac.uk/intact/interactors/id:Q62167*" }, { "database": "iPTMnet", "id": "Q62167", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q62167" }, { "database": "PubMed", "id": "18583960", "url": "https://pubmed.ncbi.nlm.nih.gov/18583960" } ], "site_lbl": "Ser269", "uniprot_canonical_ac": "Q62167-1" }, { "start_pos": 429, "end_pos": 429, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "IntAct", "id": "Q62167", "url": "https://www.ebi.ac.uk/intact/interactors/id:Q62167*" }, { "database": "iPTMnet", "id": "Q62167", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q62167" }, { "database": "PubMed", "id": "18583960", "url": "https://pubmed.ncbi.nlm.nih.gov/18583960" } ], "site_lbl": "Ser429", "uniprot_canonical_ac": "Q62167-1" }, { "start_pos": 456, "end_pos": 456, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "Q62167", "url": "https://www.uniprot.org/uniprotkb/Q62167" }, { "database": "IntAct", "id": "Q62167", "url": "https://www.ebi.ac.uk/intact/interactors/id:Q62167*" }, { "database": "iPTMnet", "id": "Q62167", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q62167" }, { "database": "PubMed", "id": "18583960", "url": "https://pubmed.ncbi.nlm.nih.gov/18583960" } ], "site_lbl": "Ser456", "uniprot_canonical_ac": "Q62167-1" }, { "start_pos": 520, "end_pos": 520, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "IntAct", "id": "Q62167", "url": "https://www.ebi.ac.uk/intact/interactors/id:Q62167*" }, { "database": "iPTMnet", "id": "Q62167", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q62167" }, { "database": "PubMed", "id": "18583960", "url": "https://pubmed.ncbi.nlm.nih.gov/18583960" } ], "site_lbl": "Ser520", "uniprot_canonical_ac": "Q62167-1" } ], "record_id": "pubmed.18583960", "abstract": "", "glycosylation": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 4 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 16 }, { "field": "total_sites", "count": 11 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Viral targeting of DEAD box protein 3 reveals its role in TBK1/IKKepsilon-mediated IRF activation.", "journal": "EMBO J.", "date": "2008", "authors": "Schroder M, Baran M, Bowie AG", "reference": { "type": "PubMed", "id": "18636090", "url": "https://pubmed.ncbi.nlm.nih.gov/18636090" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q14164-1", "protein_name": "Inhibitor of nuclear factor kappa-B kinase subunit epsilon", "gene_name": "IKBKE", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00571-1", "protein_name": "ATP-dependent RNA helicase DDX3X", "gene_name": "DDX3X", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q14164", "url": "https://www.uniprot.org/uniprotkb/Q14164" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 230, "end_pos": 230, "sequence_org": "K", "sequence_mut": "E", "comment": "Complete loss of ATPase and RNA-unwinding activities. Loss of HIV-1 mRNA nuclear export. Does not promote the translation of HIV-1 RNA. No effect on IFNB1 induction. No effect on RNA-binding. Loss of inhibition of NF-kappa-B-mediated transcriptional activity.", "evidence": [ { "database": "UniProtKB", "id": "O00571", "url": "https://www.uniprot.org/uniprotkb/O00571" }, { "database": "PubMed", "id": "21589879", "url": "https://pubmed.ncbi.nlm.nih.gov/21589879" }, { "database": "PubMed", "id": "22872150", "url": "https://pubmed.ncbi.nlm.nih.gov/22872150" }, { "database": "PubMed", "id": "18636090", "url": "https://pubmed.ncbi.nlm.nih.gov/18636090" }, { "database": "PubMed", "id": "15507209", "url": "https://pubmed.ncbi.nlm.nih.gov/15507209" }, { "database": "PubMed", "id": "18583960", "url": "https://pubmed.ncbi.nlm.nih.gov/18583960" }, { "database": "PubMed", "id": "27736973", "url": "https://pubmed.ncbi.nlm.nih.gov/27736973" } ], "uniprot_canonical_ac": "O00571-1" } ], "record_id": "pubmed.18636090", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Ebola virus protein VP35 impairs the function of interferon regulatory factor-activating kinases IKKepsilon and TBK-1.", "journal": "Journal of virology", "date": "2009-04", "authors": "Prins Kathleen C, C\u00e1rdenas Washington B, Basler Christopher F", "reference": { "type": "PubMed", "id": "19153231", "url": "https://pubmed.ncbi.nlm.nih.gov/19153231" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q14164-1", "protein_name": "Inhibitor of nuclear factor kappa-B kinase subunit epsilon", "gene_name": "IKBKE", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UHD2-1", "protein_name": "Serine/threonine-protein kinase TBK1", "gene_name": "TBK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q05127-1", "protein_name": "Polymerase cofactor VP35", "gene_name": "VP35", "tax_name": "Zaire ebolavirus" }, { "uniprot_canonical_ac": "Q14653-1", "protein_name": "Interferon regulatory factor 3", "gene_name": "IRF3", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q14164", "url": "https://www.uniprot.org/uniprotkb/Q14164" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.19153231", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 4 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Structural and biochemical studies on procaspase-8: new insights on initiator caspase activation.", "journal": "Structure (London, England : 1993)", "date": "2009", "authors": "Keller N, Mares J, Zerbe O, Grutter MG", "reference": { "type": "PubMed", "id": "19278658", "url": "https://pubmed.ncbi.nlm.nih.gov/19278658" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q14164-1", "protein_name": "Inhibitor of nuclear factor kappa-B kinase subunit epsilon", "gene_name": "IKBKE", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UHD2-1", "protein_name": "Serine/threonine-protein kinase TBK1", "gene_name": "TBK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15111-1", "protein_name": "Inhibitor of nuclear factor kappa-B kinase subunit alpha", "gene_name": "CHUK", "tax_name": "Human" }, { "uniprot_canonical_ac": "P98170-1", "protein_name": "E3 ubiquitin-protein ligase XIAP", "gene_name": "XIAP", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13546-1", "protein_name": "Receptor-interacting serine/threonine-protein kinase 1", "gene_name": "RIPK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00220-1", "protein_name": "Tumor necrosis factor receptor superfamily member 10A", "gene_name": "TNFRSF10A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75385-1", "protein_name": "Serine/threonine-protein kinase ULK1", "gene_name": "ULK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P21580-1", "protein_name": "Tumor necrosis factor alpha-induced protein 3", "gene_name": "TNFAIP3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68036-1", "protein_name": "Ubiquitin-conjugating enzyme E2 L3", "gene_name": "UBE2L3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96DZ5-1", "protein_name": "CAP-Gly domain-containing linker protein 3", "gene_name": "CLIP3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P19438-1", "protein_name": "Tumor necrosis factor receptor superfamily member 1A", "gene_name": "TNFRSF1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UM82-1", "protein_name": "Spermatogenesis-associated protein 2", "gene_name": "SPATA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49137-1", "protein_name": "MAP kinase-activated protein kinase 2", "gene_name": "MAPKAPK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BYM8-1", "protein_name": "RanBP-type and C3HC4-type zinc finger-containing protein 1", "gene_name": "RBCK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96EP0-1", "protein_name": "E3 ubiquitin-protein ligase RNF31", "gene_name": "RNF31", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H0F6-1", "protein_name": "Sharpin", "gene_name": "SHARPIN", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5VV17-1", "protein_name": "OTU domain-containing protein 1", "gene_name": "OTUD1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96AX9-1", "protein_name": "E3 ubiquitin-protein ligase MIB2", "gene_name": "MIB2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TCT8-1", "protein_name": "Signal peptide peptidase-like 2A", "gene_name": "SPPL2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14920-1", "protein_name": "Inhibitor of nuclear factor kappa-B kinase subunit beta", "gene_name": "IKBKB", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61077-1", "protein_name": "Ubiquitin-conjugating enzyme E2 D3", "gene_name": "UBE2D3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51668-1", "protein_name": "Ubiquitin-conjugating enzyme E2 D1", "gene_name": "UBE2D1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86VP1-1", "protein_name": "Tax1-binding protein 1", "gene_name": "TAX1BP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P25445-1", "protein_name": "Tumor necrosis factor receptor superfamily member 6", "gene_name": "FAS", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13158-1", "protein_name": "FAS-associated death domain protein", "gene_name": "FADD", "tax_name": "Human" }, { "uniprot_canonical_ac": "P48023-1", "protein_name": "Tumor necrosis factor ligand superfamily member 6", "gene_name": "FASLG", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6GQQ9-1", "protein_name": "OTU domain-containing protein 7B", "gene_name": "OTUD7B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NQC7-1", "protein_name": "Ubiquitin carboxyl-terminal hydrolase CYLD", "gene_name": "CYLD", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UK80-1", "protein_name": "Ubiquitin carboxyl-terminal hydrolase 21", "gene_name": "USP21", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00206-1", "protein_name": "Toll-like receptor 4", "gene_name": "TLR4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y6Y9-1", "protein_name": "Lymphocyte antigen 96", "gene_name": "LY96", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TCT7-1", "protein_name": "Signal peptide peptidase-like 2B", "gene_name": "SPPL2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96CV9-1", "protein_name": "Optineurin", "gene_name": "OPTN", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13077-1", "protein_name": "TNF receptor-associated factor 1", "gene_name": "TRAF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14790-1", "protein_name": "Caspase-8", "gene_name": "CASP8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P50591-1", "protein_name": "Tumor necrosis factor ligand superfamily member 10", "gene_name": "TNFSF10", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15628-1", "protein_name": "Tumor necrosis factor receptor type 1-associated DEATH domain protein", "gene_name": "TRADD", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13490-1", "protein_name": "Baculoviral IAP repeat-containing protein 2", "gene_name": "BIRC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62979-1", "protein_name": "Ubiquitin-ribosomal protein eS31 fusion protein", "gene_name": "RPS27A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y572-1", "protein_name": "Receptor-interacting serine/threonine-protein kinase 3", "gene_name": "RIPK3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62837-1", "protein_name": "Ubiquitin-conjugating enzyme E2 D2", "gene_name": "UBE2D2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13489-1", "protein_name": "Baculoviral IAP repeat-containing protein 3", "gene_name": "BIRC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15455-1", "protein_name": "Toll-like receptor 3", "gene_name": "TLR3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01375-1", "protein_name": "Tumor necrosis factor", "gene_name": "TNF", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG47-1", "protein_name": "Polyubiquitin-B", "gene_name": "UBB", "tax_name": "Human" }, { "uniprot_canonical_ac": "P08571-1", "protein_name": "Monocyte differentiation antigen CD14", "gene_name": "CD14", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96BN8-1", "protein_name": "Ubiquitin thioesterase otulin", "gene_name": "OTULIN", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62987-1", "protein_name": "Ubiquitin-ribosomal protein eL40 fusion protein", "gene_name": "UBA52", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86XR7-1", "protein_name": "TIR domain-containing adapter molecule 2", "gene_name": "TICAM2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8IUC6-1", "protein_name": "TIR domain-containing adapter molecule 1", "gene_name": "TICAM1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14763-1", "protein_name": "Tumor necrosis factor receptor superfamily member 10B", "gene_name": "TNFRSF10B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12933-1", "protein_name": "TNF receptor-associated factor 2", "gene_name": "TRAF2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y6K9-1", "protein_name": "NF-kappa-B essential modulator", "gene_name": "IKBKG", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13107-1", "protein_name": "Ubiquitin carboxyl-terminal hydrolase 4", "gene_name": "USP4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P63244-1", "protein_name": "Small ribosomal subunit protein RACK1", "gene_name": "RACK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG48-1", "protein_name": "Polyubiquitin-C", "gene_name": "UBC", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75604-1", "protein_name": "Ubiquitin carboxyl-terminal hydrolase 2", "gene_name": "USP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UNE7-1", "protein_name": "E3 ubiquitin-protein ligase CHIP", "gene_name": "STUB1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q14164", "url": "https://www.uniprot.org/uniprotkb/Q14164" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.19278658", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 58 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "MADD, a splice variant of IG20, is indispensable for MAPK activation and protection against apoptosis upon tumor necrosis factor-alpha treatment.", "journal": "The Journal of biological chemistry", "date": "2009", "authors": "Kurada BR, Li LC, Mulherkar N, Subramanian M, Prasad KV, Prabhakar BS", "reference": { "type": "PubMed", "id": "19289468", "url": "https://pubmed.ncbi.nlm.nih.gov/19289468" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q14164-1", "protein_name": "Inhibitor of nuclear factor kappa-B kinase subunit epsilon", "gene_name": "IKBKE", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UHD2-1", "protein_name": "Serine/threonine-protein kinase TBK1", "gene_name": "TBK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15111-1", "protein_name": "Inhibitor of nuclear factor kappa-B kinase subunit alpha", "gene_name": "CHUK", "tax_name": "Human" }, { "uniprot_canonical_ac": "P98170-1", "protein_name": "E3 ubiquitin-protein ligase XIAP", "gene_name": "XIAP", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13546-1", "protein_name": "Receptor-interacting serine/threonine-protein kinase 1", "gene_name": "RIPK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75385-1", "protein_name": "Serine/threonine-protein kinase ULK1", "gene_name": "ULK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P21580-1", "protein_name": "Tumor necrosis factor alpha-induced protein 3", "gene_name": "TNFAIP3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68036-1", "protein_name": "Ubiquitin-conjugating enzyme E2 L3", "gene_name": "UBE2L3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96DZ5-1", "protein_name": "CAP-Gly domain-containing linker protein 3", "gene_name": "CLIP3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P19438-1", "protein_name": "Tumor necrosis factor receptor superfamily member 1A", "gene_name": "TNFRSF1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UM82-1", "protein_name": "Spermatogenesis-associated protein 2", "gene_name": "SPATA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49137-1", "protein_name": "MAP kinase-activated protein kinase 2", "gene_name": "MAPKAPK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BYM8-1", "protein_name": "RanBP-type and C3HC4-type zinc finger-containing protein 1", "gene_name": "RBCK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96EP0-1", "protein_name": "E3 ubiquitin-protein ligase RNF31", "gene_name": "RNF31", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H0F6-1", "protein_name": "Sharpin", "gene_name": "SHARPIN", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5VV17-1", "protein_name": "OTU domain-containing protein 1", "gene_name": "OTUD1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96AX9-1", "protein_name": "E3 ubiquitin-protein ligase MIB2", "gene_name": "MIB2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TCT8-1", "protein_name": "Signal peptide peptidase-like 2A", "gene_name": "SPPL2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14920-1", "protein_name": "Inhibitor of nuclear factor kappa-B kinase subunit beta", "gene_name": "IKBKB", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61077-1", "protein_name": "Ubiquitin-conjugating enzyme E2 D3", "gene_name": "UBE2D3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51668-1", "protein_name": "Ubiquitin-conjugating enzyme E2 D1", "gene_name": "UBE2D1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86VP1-1", "protein_name": "Tax1-binding protein 1", "gene_name": "TAX1BP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13158-1", "protein_name": "FAS-associated death domain protein", "gene_name": "FADD", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6GQQ9-1", "protein_name": "OTU domain-containing protein 7B", "gene_name": "OTUD7B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NQC7-1", "protein_name": "Ubiquitin carboxyl-terminal hydrolase CYLD", "gene_name": "CYLD", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UK80-1", "protein_name": "Ubiquitin carboxyl-terminal hydrolase 21", "gene_name": "USP21", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TCT7-1", "protein_name": "Signal peptide peptidase-like 2B", "gene_name": "SPPL2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96CV9-1", "protein_name": "Optineurin", "gene_name": "OPTN", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13077-1", "protein_name": "TNF receptor-associated factor 1", "gene_name": "TRAF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14790-1", "protein_name": "Caspase-8", "gene_name": "CASP8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15628-1", "protein_name": "Tumor necrosis factor receptor type 1-associated DEATH domain protein", "gene_name": "TRADD", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13490-1", "protein_name": "Baculoviral IAP repeat-containing protein 2", "gene_name": "BIRC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62979-1", "protein_name": "Ubiquitin-ribosomal protein eS31 fusion protein", "gene_name": "RPS27A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62837-1", "protein_name": "Ubiquitin-conjugating enzyme E2 D2", "gene_name": "UBE2D2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13489-1", "protein_name": "Baculoviral IAP repeat-containing protein 3", "gene_name": "BIRC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01375-1", "protein_name": "Tumor necrosis factor", "gene_name": "TNF", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG47-1", "protein_name": "Polyubiquitin-B", "gene_name": "UBB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96BN8-1", "protein_name": "Ubiquitin thioesterase otulin", "gene_name": "OTULIN", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62987-1", "protein_name": "Ubiquitin-ribosomal protein eL40 fusion protein", "gene_name": "UBA52", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12933-1", "protein_name": "TNF receptor-associated factor 2", "gene_name": "TRAF2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y6K9-1", "protein_name": "NF-kappa-B essential modulator", "gene_name": "IKBKG", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13107-1", "protein_name": "Ubiquitin carboxyl-terminal hydrolase 4", "gene_name": "USP4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P63244-1", "protein_name": "Small ribosomal subunit protein RACK1", "gene_name": "RACK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG48-1", "protein_name": "Polyubiquitin-C", "gene_name": "UBC", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75604-1", "protein_name": "Ubiquitin carboxyl-terminal hydrolase 2", "gene_name": "USP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UNE7-1", "protein_name": "E3 ubiquitin-protein ligase CHIP", "gene_name": "STUB1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q14164", "url": "https://www.uniprot.org/uniprotkb/Q14164" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.19289468", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 46 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Severe acute respiratory syndrome coronavirus M protein inhibits type I interferon production by impeding the formation of TRAF3.TANK.TBK1/IKKepsilon complex.", "journal": "The Journal of biological chemistry", "date": "2009", "authors": "Siu KL, Kok KH, Ng MJ, Poon VKM, Yuen KY, Zheng BJ, Jin DY", "reference": { "type": "PubMed", "id": "19380580", "url": "https://pubmed.ncbi.nlm.nih.gov/19380580" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q14164-1", "protein_name": "Inhibitor of nuclear factor kappa-B kinase subunit epsilon", "gene_name": "IKBKE", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UHD2-1", "protein_name": "Serine/threonine-protein kinase TBK1", "gene_name": "TBK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P25963-1", "protein_name": "NF-kappa-B inhibitor alpha", "gene_name": "NFKBIA", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43187-1", "protein_name": "Interleukin-1 receptor-associated kinase-like 2", "gene_name": "IRAK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9ULZ3-1", "protein_name": "Apoptosis-associated speck-like protein containing a CARD", "gene_name": "PYCARD", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y4K3-1", "protein_name": "TNF receptor-associated factor 6", "gene_name": "TRAF6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P29466-1", "protein_name": "Caspase-1", "gene_name": "CASP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86WV6-1", "protein_name": "Stimulator of interferon genes protein", "gene_name": "STING1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P19838-1", "protein_name": "Nuclear factor NF-kappa-B p105 subunit", "gene_name": "NFKB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UKA8-1", "protein_name": "Calcipressin-3", "gene_name": "RCAN3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13427-1", "protein_name": "Peptidyl-prolyl cis-trans isomerase G", "gene_name": "PPIG", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14258-1", "protein_name": "E3 ubiquitin/ISG15 ligase TRIM25", "gene_name": "TRIM25", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96P20-1", "protein_name": "NACHT, LRR and PYD domains-containing protein 3", "gene_name": "NLRP3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96J02-1", "protein_name": "E3 ubiquitin-protein ligase Itchy homolog", "gene_name": "ITCH", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01196-1", "protein_name": "Runt-related transcription factor 1", "gene_name": "RUNX1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14653-1", "protein_name": "Interferon regulatory factor 3", "gene_name": "IRF3", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95786-1", "protein_name": "Antiviral innate immune response receptor RIG-I", "gene_name": "DDX58; RIGI", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BRV8-1", "protein_name": "Suppressor of IKBKE 1", "gene_name": "SIKE1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92617-1", "protein_name": "Nuclear pore complex-interacting protein family member B3", "gene_name": "NPIPB3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35247-1", "protein_name": "Pulmonary surfactant-associated protein D", "gene_name": "SFTPD", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62937-1", "protein_name": "Peptidyl-prolyl cis-trans isomerase A", "gene_name": "PPIA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15366-1", "protein_name": "Poly(rC)-binding protein 2", "gene_name": "PCBP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NYK1-1", "protein_name": "Toll-like receptor 7", "gene_name": "TLR7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q7Z434-1", "protein_name": "Mitochondrial antiviral-signaling protein", "gene_name": "MAVS", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62942-1", "protein_name": "Peptidyl-prolyl cis-trans isomerase FKBP1A", "gene_name": "FKBP1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P52292-1", "protein_name": "Importin subunit alpha-1", "gene_name": "KPNA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P23284-1", "protein_name": "Peptidyl-prolyl cis-trans isomerase B", "gene_name": "PPIB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13287-1", "protein_name": "N-myc-interactor", "gene_name": "NMI", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62979-1", "protein_name": "Ubiquitin-ribosomal protein eS31 fusion protein", "gene_name": "RPS27A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y572-1", "protein_name": "Receptor-interacting serine/threonine-protein kinase 3", "gene_name": "RIPK3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q10589-1", "protein_name": "Bone marrow stromal antigen 2", "gene_name": "BST2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q3LXA3-1", "protein_name": "Triokinase/FMN cyclase", "gene_name": "TKFC", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BYX4-1", "protein_name": "Interferon-induced helicase C domain-containing protein 1", "gene_name": "IFIH1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O94826-1", "protein_name": "Mitochondrial import receptor subunit TOM70", "gene_name": "TOMM70", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG47-1", "protein_name": "Polyubiquitin-B", "gene_name": "UBB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13114-1", "protein_name": "TNF receptor-associated factor 3", "gene_name": "TRAF3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62987-1", "protein_name": "Ubiquitin-ribosomal protein eL40 fusion protein", "gene_name": "UBA52", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43447-1", "protein_name": "Peptidyl-prolyl cis-trans isomerase H", "gene_name": "PPIH", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14974-1", "protein_name": "Importin subunit beta-1", "gene_name": "KPNB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG48-1", "protein_name": "Polyubiquitin-C", "gene_name": "UBC", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q04206-1", "protein_name": "Transcription factor p65", "gene_name": "RELA", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q14164", "url": "https://www.uniprot.org/uniprotkb/Q14164" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.19380580", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 41 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The ion channel activity of the SARS-coronavirus 3a protein is linked to its pro-apoptotic function.", "journal": "The international journal of biochemistry & cell biology", "date": "2009", "authors": "Chan CM, Tsoi H, Chan WM, Zhai S, Wong CO, Yao X, Chan WY, Tsui SK, Chan HY", "reference": { "type": "PubMed", "id": "19398035", "url": "https://pubmed.ncbi.nlm.nih.gov/19398035" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q14164-1", "protein_name": "Inhibitor of nuclear factor kappa-B kinase subunit epsilon", "gene_name": "IKBKE", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UHD2-1", "protein_name": "Serine/threonine-protein kinase TBK1", "gene_name": "TBK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P25963-1", "protein_name": "NF-kappa-B inhibitor alpha", "gene_name": "NFKBIA", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43187-1", "protein_name": "Interleukin-1 receptor-associated kinase-like 2", "gene_name": "IRAK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9ULZ3-1", "protein_name": "Apoptosis-associated speck-like protein containing a CARD", "gene_name": "PYCARD", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y4K3-1", "protein_name": "TNF receptor-associated factor 6", "gene_name": "TRAF6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P29466-1", "protein_name": "Caspase-1", "gene_name": "CASP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86WV6-1", "protein_name": "Stimulator of interferon genes protein", "gene_name": "STING1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P19838-1", "protein_name": "Nuclear factor NF-kappa-B p105 subunit", "gene_name": "NFKB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UKA8-1", "protein_name": "Calcipressin-3", "gene_name": "RCAN3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13427-1", "protein_name": "Peptidyl-prolyl cis-trans isomerase G", "gene_name": "PPIG", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14258-1", "protein_name": "E3 ubiquitin/ISG15 ligase TRIM25", "gene_name": "TRIM25", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96P20-1", "protein_name": "NACHT, LRR and PYD domains-containing protein 3", "gene_name": "NLRP3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96J02-1", "protein_name": "E3 ubiquitin-protein ligase Itchy homolog", "gene_name": "ITCH", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01196-1", "protein_name": "Runt-related transcription factor 1", "gene_name": "RUNX1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14653-1", "protein_name": "Interferon regulatory factor 3", "gene_name": "IRF3", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95786-1", "protein_name": "Antiviral innate immune response receptor RIG-I", "gene_name": "DDX58; RIGI", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BRV8-1", "protein_name": "Suppressor of IKBKE 1", "gene_name": "SIKE1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92617-1", "protein_name": "Nuclear pore complex-interacting protein family member B3", "gene_name": "NPIPB3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35247-1", "protein_name": "Pulmonary surfactant-associated protein D", "gene_name": "SFTPD", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62937-1", "protein_name": "Peptidyl-prolyl cis-trans isomerase A", "gene_name": "PPIA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15366-1", "protein_name": "Poly(rC)-binding protein 2", "gene_name": "PCBP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NYK1-1", "protein_name": "Toll-like receptor 7", "gene_name": "TLR7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q7Z434-1", "protein_name": "Mitochondrial antiviral-signaling protein", "gene_name": "MAVS", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62942-1", "protein_name": "Peptidyl-prolyl cis-trans isomerase FKBP1A", "gene_name": "FKBP1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P52292-1", "protein_name": "Importin subunit alpha-1", "gene_name": "KPNA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P23284-1", "protein_name": "Peptidyl-prolyl cis-trans isomerase B", "gene_name": "PPIB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13287-1", "protein_name": "N-myc-interactor", "gene_name": "NMI", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62979-1", "protein_name": "Ubiquitin-ribosomal protein eS31 fusion protein", "gene_name": "RPS27A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y572-1", "protein_name": "Receptor-interacting serine/threonine-protein kinase 3", "gene_name": "RIPK3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q10589-1", "protein_name": "Bone marrow stromal antigen 2", "gene_name": "BST2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q3LXA3-1", "protein_name": "Triokinase/FMN cyclase", "gene_name": "TKFC", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BYX4-1", "protein_name": "Interferon-induced helicase C domain-containing protein 1", "gene_name": "IFIH1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O94826-1", "protein_name": "Mitochondrial import receptor subunit TOM70", "gene_name": "TOMM70", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG47-1", "protein_name": "Polyubiquitin-B", "gene_name": "UBB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13114-1", "protein_name": "TNF receptor-associated factor 3", "gene_name": "TRAF3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62987-1", "protein_name": "Ubiquitin-ribosomal protein eL40 fusion protein", "gene_name": "UBA52", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43447-1", "protein_name": "Peptidyl-prolyl cis-trans isomerase H", "gene_name": "PPIH", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14974-1", "protein_name": "Importin subunit beta-1", "gene_name": "KPNB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG48-1", "protein_name": "Polyubiquitin-C", "gene_name": "UBC", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q04206-1", "protein_name": "Transcription factor p65", "gene_name": "RELA", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q14164", "url": "https://www.uniprot.org/uniprotkb/Q14164" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.19398035", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 41 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Mechanism of procaspase-8 activation by c-FLIPL.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2009", "authors": "Yu JW, Jeffrey PD, Shi Y", "reference": { "type": "PubMed", "id": "19416807", "url": "https://pubmed.ncbi.nlm.nih.gov/19416807" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q14164-1", "protein_name": "Inhibitor of nuclear factor kappa-B kinase subunit epsilon", "gene_name": "IKBKE", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UHD2-1", "protein_name": "Serine/threonine-protein kinase TBK1", "gene_name": "TBK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15111-1", "protein_name": "Inhibitor of nuclear factor kappa-B kinase subunit alpha", "gene_name": "CHUK", "tax_name": "Human" }, { "uniprot_canonical_ac": "P98170-1", "protein_name": "E3 ubiquitin-protein ligase XIAP", "gene_name": "XIAP", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13546-1", "protein_name": "Receptor-interacting serine/threonine-protein kinase 1", "gene_name": "RIPK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00220-1", "protein_name": "Tumor necrosis factor receptor superfamily member 10A", "gene_name": "TNFRSF10A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75385-1", "protein_name": "Serine/threonine-protein kinase ULK1", "gene_name": "ULK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P21580-1", "protein_name": "Tumor necrosis factor alpha-induced protein 3", "gene_name": "TNFAIP3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68036-1", "protein_name": "Ubiquitin-conjugating enzyme E2 L3", "gene_name": "UBE2L3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96DZ5-1", "protein_name": "CAP-Gly domain-containing linker protein 3", "gene_name": "CLIP3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P19438-1", "protein_name": "Tumor necrosis factor receptor superfamily member 1A", "gene_name": "TNFRSF1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UM82-1", "protein_name": "Spermatogenesis-associated protein 2", "gene_name": "SPATA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49137-1", "protein_name": "MAP kinase-activated protein kinase 2", "gene_name": "MAPKAPK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BYM8-1", "protein_name": "RanBP-type and C3HC4-type zinc finger-containing protein 1", "gene_name": "RBCK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96EP0-1", "protein_name": "E3 ubiquitin-protein ligase RNF31", "gene_name": "RNF31", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H0F6-1", "protein_name": "Sharpin", "gene_name": "SHARPIN", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5VV17-1", "protein_name": "OTU domain-containing protein 1", "gene_name": "OTUD1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96AX9-1", "protein_name": "E3 ubiquitin-protein ligase MIB2", "gene_name": "MIB2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TCT8-1", "protein_name": "Signal peptide peptidase-like 2A", "gene_name": "SPPL2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14920-1", "protein_name": "Inhibitor of nuclear factor kappa-B kinase subunit beta", "gene_name": "IKBKB", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61077-1", "protein_name": "Ubiquitin-conjugating enzyme E2 D3", "gene_name": "UBE2D3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51668-1", "protein_name": "Ubiquitin-conjugating enzyme E2 D1", "gene_name": "UBE2D1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86VP1-1", "protein_name": "Tax1-binding protein 1", "gene_name": "TAX1BP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P25445-1", "protein_name": "Tumor necrosis factor receptor superfamily member 6", "gene_name": "FAS", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13158-1", "protein_name": "FAS-associated death domain protein", "gene_name": "FADD", "tax_name": "Human" }, { "uniprot_canonical_ac": "P48023-1", "protein_name": "Tumor necrosis factor ligand superfamily member 6", "gene_name": "FASLG", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6GQQ9-1", "protein_name": "OTU domain-containing protein 7B", "gene_name": "OTUD7B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NQC7-1", "protein_name": "Ubiquitin carboxyl-terminal hydrolase CYLD", "gene_name": "CYLD", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UK80-1", "protein_name": "Ubiquitin carboxyl-terminal hydrolase 21", "gene_name": "USP21", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TCT7-1", "protein_name": "Signal peptide peptidase-like 2B", "gene_name": "SPPL2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96CV9-1", "protein_name": "Optineurin", "gene_name": "OPTN", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13077-1", "protein_name": "TNF receptor-associated factor 1", "gene_name": "TRAF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14790-1", "protein_name": "Caspase-8", "gene_name": "CASP8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P50591-1", "protein_name": "Tumor necrosis factor ligand superfamily member 10", "gene_name": "TNFSF10", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15628-1", "protein_name": "Tumor necrosis factor receptor type 1-associated DEATH domain protein", "gene_name": "TRADD", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13490-1", "protein_name": "Baculoviral IAP repeat-containing protein 2", "gene_name": "BIRC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62979-1", "protein_name": "Ubiquitin-ribosomal protein eS31 fusion protein", "gene_name": "RPS27A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62837-1", "protein_name": "Ubiquitin-conjugating enzyme E2 D2", "gene_name": "UBE2D2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13489-1", "protein_name": "Baculoviral IAP repeat-containing protein 3", "gene_name": "BIRC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01375-1", "protein_name": "Tumor necrosis factor", "gene_name": "TNF", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG47-1", "protein_name": "Polyubiquitin-B", "gene_name": "UBB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96BN8-1", "protein_name": "Ubiquitin thioesterase otulin", "gene_name": "OTULIN", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62987-1", "protein_name": "Ubiquitin-ribosomal protein eL40 fusion protein", "gene_name": "UBA52", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14763-1", "protein_name": "Tumor necrosis factor receptor superfamily member 10B", "gene_name": "TNFRSF10B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12933-1", "protein_name": "TNF receptor-associated factor 2", "gene_name": "TRAF2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y6K9-1", "protein_name": "NF-kappa-B essential modulator", "gene_name": "IKBKG", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13107-1", "protein_name": "Ubiquitin carboxyl-terminal hydrolase 4", "gene_name": "USP4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P63244-1", "protein_name": "Small ribosomal subunit protein RACK1", "gene_name": "RACK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG48-1", "protein_name": "Polyubiquitin-C", "gene_name": "UBC", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75604-1", "protein_name": "Ubiquitin carboxyl-terminal hydrolase 2", "gene_name": "USP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UNE7-1", "protein_name": "E3 ubiquitin-protein ligase CHIP", "gene_name": "STUB1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q14164", "url": "https://www.uniprot.org/uniprotkb/Q14164" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.19416807", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 51 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Dengue virus NS5 inhibits interferon-alpha signaling by blocking signal transducer and activator of transcription 2 phosphorylation.", "journal": "The Journal of infectious diseases", "date": "2009-10-15", "authors": "Mazzon Michela, Jones Meleri, Davidson Andrew, Chain Benjamin, Jacobs Michael", "reference": { "type": "PubMed", "id": "19754307", "url": "https://pubmed.ncbi.nlm.nih.gov/19754307" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q14164-1", "protein_name": "Inhibitor of nuclear factor kappa-B kinase subunit epsilon", "gene_name": "IKBKE", "tax_name": "Human" }, { "uniprot_canonical_ac": "P10909-1", "protein_name": "Clusterin", "gene_name": "CLU", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86WV6-1", "protein_name": "Stimulator of interferon genes protein", "gene_name": "STING1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P11226-1", "protein_name": "Mannose-binding protein C", "gene_name": "MBL2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NY25-1", "protein_name": "C-type lectin domain family 5 member A", "gene_name": "CLEC5A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N7H5-1", "protein_name": "RNA polymerase II-associated factor 1 homolog", "gene_name": "PAF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6PD62-1", "protein_name": "RNA polymerase-associated protein CTR9 homolog", "gene_name": "CTR9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8WVC0-1", "protein_name": "RNA polymerase-associated protein LEO1", "gene_name": "LEO1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92541-1", "protein_name": "RNA polymerase-associated protein RTF1 homolog", "gene_name": "RTF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14258-1", "protein_name": "E3 ubiquitin/ISG15 ligase TRIM25", "gene_name": "TRIM25", "tax_name": "Human" }, { "uniprot_canonical_ac": "P09871-1", "protein_name": "Complement C1s subcomponent", "gene_name": "C1S", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04003-1", "protein_name": "C4b-binding protein alpha chain", "gene_name": "C4BPA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P20851-1", "protein_name": "C4b-binding protein beta chain", "gene_name": "C4BPB", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0C0L5-1", "protein_name": "Complement C4-B", "gene_name": "C4B_2; C4B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0C0L4-1", "protein_name": "Complement C4-A", "gene_name": "C4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P52630-3", "protein_name": "Signal transducer and activator of transcription 2", "gene_name": "STAT2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P08238-1", "protein_name": "Heat shock protein HSP 90-beta", "gene_name": "HSP90AB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q7Z434-1", "protein_name": "Mitochondrial antiviral-signaling protein", "gene_name": "MAVS", "tax_name": "Human" }, { "uniprot_canonical_ac": "P07900-1", "protein_name": "Heat shock protein HSP 90-alpha", "gene_name": "HSP90AA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P98175-1", "protein_name": "RNA-binding protein 10", "gene_name": "RBM10", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00571-1", "protein_name": "ATP-dependent RNA helicase DDX3X", "gene_name": "DDX3X", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9GZS3-1", "protein_name": "Superkiller complex protein 8", "gene_name": "SKIC8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6P1J9-1", "protein_name": "Parafibromin", "gene_name": "CDC73", "tax_name": "Human" }, { "uniprot_canonical_ac": "P02745-1", "protein_name": "Complement C1q subcomponent subunit A", "gene_name": "C1QA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04004-1", "protein_name": "Vitronectin", "gene_name": "VTN", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BYX4-1", "protein_name": "Interferon-induced helicase C domain-containing protein 1", "gene_name": "IFIH1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5T4S7-1", "protein_name": "E3 ubiquitin-protein ligase UBR4", "gene_name": "UBR4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N884-1", "protein_name": "Cyclic GMP-AMP synthase", "gene_name": "CGAS", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NV70-1", "protein_name": "Exocyst complex component 1", "gene_name": "EXOC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P02647-1", "protein_name": "Apolipoprotein A-I", "gene_name": "APOA1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q14164", "url": "https://www.uniprot.org/uniprotkb/Q14164" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.19754307", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 30 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "PCBP2 mediates degradation of the adaptor MAVS via the HECT ubiquitin ligase AIP4.", "journal": "Nature immunology", "date": "2009", "authors": "You F, Sun H, Zhou X, Sun W, Liang S, Zhai Z, Jiang Z", "reference": { "type": "PubMed", "id": "19881509", "url": "https://pubmed.ncbi.nlm.nih.gov/19881509" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q14164-1", "protein_name": "Inhibitor of nuclear factor kappa-B kinase subunit epsilon", "gene_name": "IKBKE", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UHD2-1", "protein_name": "Serine/threonine-protein kinase TBK1", "gene_name": "TBK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P21580-1", "protein_name": "Tumor necrosis factor alpha-induced protein 3", "gene_name": "TNFAIP3", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14933-1", "protein_name": "Ubiquitin/ISG15-conjugating enzyme E2 L6", "gene_name": "UBE2L6", "tax_name": "Human" }, { "uniprot_canonical_ac": "O94817-1", "protein_name": "Ubiquitin-like protein ATG12", "gene_name": "ATG12", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A8V0ZYD5-1", "protein_name": "NLR family member X1", "gene_name": "NLRX1", "tax_name": "Chicken" }, { "uniprot_canonical_ac": "Q96G74-1", "protein_name": "OTU domain-containing protein 5", "gene_name": "OTUD5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61086-1", "protein_name": "Ubiquitin-conjugating enzyme E2 K", "gene_name": "UBE2K", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96EQ8-1", "protein_name": "E3 ubiquitin-protein ligase RNF125", "gene_name": "RNF125", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61077-1", "protein_name": "Ubiquitin-conjugating enzyme E2 D3", "gene_name": "UBE2D3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14258-1", "protein_name": "E3 ubiquitin/ISG15 ligase TRIM25", "gene_name": "TRIM25", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51668-1", "protein_name": "Ubiquitin-conjugating enzyme E2 D1", "gene_name": "UBE2D1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96J02-1", "protein_name": "E3 ubiquitin-protein ligase Itchy homolog", "gene_name": "ITCH", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86VP1-1", "protein_name": "Tax1-binding protein 1", "gene_name": "TAX1BP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14653-1", "protein_name": "Interferon regulatory factor 3", "gene_name": "IRF3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62985-1", "protein_name": "Ubiquitin-ribosomal protein eL40 fusion protein", "gene_name": "UBA52", "tax_name": "Chicken" }, { "uniprot_canonical_ac": "Q9NQC7-1", "protein_name": "Ubiquitin carboxyl-terminal hydrolase CYLD", "gene_name": "CYLD", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95786-1", "protein_name": "Antiviral innate immune response receptor RIG-I", "gene_name": "DDX58; RIGI", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86WI3-1", "protein_name": "Protein NLRC5", "gene_name": "NLRC5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P41226-1", "protein_name": "Ubiquitin-like modifier-activating enzyme 7", "gene_name": "UBA7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15366-1", "protein_name": "Poly(rC)-binding protein 2", "gene_name": "PCBP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9C037-1", "protein_name": "E3 ubiquitin-protein ligase TRIM4", "gene_name": "TRIM4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q7Z434-1", "protein_name": "Mitochondrial antiviral-signaling protein", "gene_name": "MAVS", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H1Y0-1", "protein_name": "Autophagy protein 5", "gene_name": "ATG5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8IUD6-1", "protein_name": "E3 ubiquitin-protein ligase RNF135", "gene_name": "RNF135", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A8V0ZZH3-1", "protein_name": "E3 ubiquitin-protein ligase", "gene_name": "ITCH", "tax_name": "Chicken" }, { "uniprot_canonical_ac": "P0CG62-1", "protein_name": "Polyubiquitin-B", "gene_name": "UBB", "tax_name": "Chicken" }, { "uniprot_canonical_ac": "P62979-1", "protein_name": "Ubiquitin-ribosomal protein eS31 fusion protein", "gene_name": "RPS27A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62837-1", "protein_name": "Ubiquitin-conjugating enzyme E2 D2", "gene_name": "UBE2D2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86UT6-1", "protein_name": "NLR family member X1", "gene_name": "NLRX1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UII4-1", "protein_name": "E3 ISG15--protein ligase HERC5", "gene_name": "HERC5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BYX4-1", "protein_name": "Interferon-induced helicase C domain-containing protein 1", "gene_name": "IFIH1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P79781-1", "protein_name": "Ubiquitin-ribosomal protein eS31 fusion protein", "gene_name": "RPS27A", "tax_name": "Chicken" }, { "uniprot_canonical_ac": "P0CG47-1", "protein_name": "Polyubiquitin-B", "gene_name": "UBB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13114-1", "protein_name": "TNF receptor-associated factor 3", "gene_name": "TRAF3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62987-1", "protein_name": "Ubiquitin-ribosomal protein eL40 fusion protein", "gene_name": "UBA52", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NWF9-2", "protein_name": "E3 ubiquitin-protein ligase RNF216", "gene_name": "RNF216", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05161-1", "protein_name": "Ubiquitin-like protein ISG15", "gene_name": "ISG15", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13526-1", "protein_name": "Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1", "gene_name": "PIN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG48-1", "protein_name": "Polyubiquitin-C", "gene_name": "UBC", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q14164", "url": "https://www.uniprot.org/uniprotkb/Q14164" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 871, "end_pos": 871, "sequence_org": "C", "sequence_mut": "A", "comment": "Loss of ubiquitin protein ligase activity. Results in altered endosomal sorting and reduced degradation of CXCR4. Unable to inhibit MAVS-induced activation of INFB.", "evidence": [ { "database": "UniProtKB", "id": "Q96J02", "url": "https://www.uniprot.org/uniprotkb/Q96J02" }, { "database": "PubMed", "id": "19881509", "url": "https://pubmed.ncbi.nlm.nih.gov/19881509" }, { "database": "PubMed", "id": "23146885", "url": "https://pubmed.ncbi.nlm.nih.gov/23146885" }, { "database": "PubMed", "id": "14602072", "url": "https://pubmed.ncbi.nlm.nih.gov/14602072" }, { "database": "PubMed", "id": "11046148", "url": "https://pubmed.ncbi.nlm.nih.gov/11046148" }, { "database": "PubMed", "id": "24790097", "url": "https://pubmed.ncbi.nlm.nih.gov/24790097" } ], "uniprot_canonical_ac": "Q96J02-1" } ], "record_id": "pubmed.19881509", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 40 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The E3 ubiquitin ligase Triad3A negatively regulates the RIG-I/MAVS signaling pathway by targeting TRAF3 for degradation.", "journal": "PLoS pathogens", "date": "2009", "authors": "Nakhaei P, Mesplede T, Solis M, Sun Q, Zhao T, Yang L, Chuang TH, Ware CF, Lin R, Hiscott J", "reference": { "type": "PubMed", "id": "19893624", "url": "https://pubmed.ncbi.nlm.nih.gov/19893624" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q14164-1", "protein_name": "Inhibitor of nuclear factor kappa-B kinase subunit epsilon", "gene_name": "IKBKE", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UHD2-1", "protein_name": "Serine/threonine-protein kinase TBK1", "gene_name": "TBK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P21580-1", "protein_name": "Tumor necrosis factor alpha-induced protein 3", "gene_name": "TNFAIP3", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14933-1", "protein_name": "Ubiquitin/ISG15-conjugating enzyme E2 L6", "gene_name": "UBE2L6", "tax_name": "Human" }, { "uniprot_canonical_ac": "O94817-1", "protein_name": "Ubiquitin-like protein ATG12", "gene_name": "ATG12", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96G74-1", "protein_name": "OTU domain-containing protein 5", "gene_name": "OTUD5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61086-1", "protein_name": "Ubiquitin-conjugating enzyme E2 K", "gene_name": "UBE2K", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96EQ8-1", "protein_name": "E3 ubiquitin-protein ligase RNF125", "gene_name": "RNF125", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61077-1", "protein_name": "Ubiquitin-conjugating enzyme E2 D3", "gene_name": "UBE2D3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14258-1", "protein_name": "E3 ubiquitin/ISG15 ligase TRIM25", "gene_name": "TRIM25", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51668-1", "protein_name": "Ubiquitin-conjugating enzyme E2 D1", "gene_name": "UBE2D1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96J02-1", "protein_name": "E3 ubiquitin-protein ligase Itchy homolog", "gene_name": "ITCH", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86VP1-1", "protein_name": "Tax1-binding protein 1", "gene_name": "TAX1BP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14653-1", "protein_name": "Interferon regulatory factor 3", "gene_name": "IRF3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NQC7-1", "protein_name": "Ubiquitin carboxyl-terminal hydrolase CYLD", "gene_name": "CYLD", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95786-1", "protein_name": "Antiviral innate immune response receptor RIG-I", "gene_name": "DDX58; RIGI", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86WI3-1", "protein_name": "Protein NLRC5", "gene_name": "NLRC5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P41226-1", "protein_name": "Ubiquitin-like modifier-activating enzyme 7", "gene_name": "UBA7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15366-1", "protein_name": "Poly(rC)-binding protein 2", "gene_name": "PCBP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9C037-1", "protein_name": "E3 ubiquitin-protein ligase TRIM4", "gene_name": "TRIM4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q7Z434-1", "protein_name": "Mitochondrial antiviral-signaling protein", "gene_name": "MAVS", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H1Y0-1", "protein_name": "Autophagy protein 5", "gene_name": "ATG5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8IUD6-1", "protein_name": "E3 ubiquitin-protein ligase RNF135", "gene_name": "RNF135", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62979-1", "protein_name": "Ubiquitin-ribosomal protein eS31 fusion protein", "gene_name": "RPS27A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62837-1", "protein_name": "Ubiquitin-conjugating enzyme E2 D2", "gene_name": "UBE2D2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86UT6-1", "protein_name": "NLR family member X1", "gene_name": "NLRX1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UII4-1", "protein_name": "E3 ISG15--protein ligase HERC5", "gene_name": "HERC5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BYX4-1", "protein_name": "Interferon-induced helicase C domain-containing protein 1", "gene_name": "IFIH1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG47-1", "protein_name": "Polyubiquitin-B", "gene_name": "UBB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13114-1", "protein_name": "TNF receptor-associated factor 3", "gene_name": "TRAF3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62987-1", "protein_name": "Ubiquitin-ribosomal protein eL40 fusion protein", "gene_name": "UBA52", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NWF9-2", "protein_name": "E3 ubiquitin-protein ligase RNF216", "gene_name": "RNF216", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05161-1", "protein_name": "Ubiquitin-like protein ISG15", "gene_name": "ISG15", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13526-1", "protein_name": "Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1", "gene_name": "PIN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG48-1", "protein_name": "Polyubiquitin-C", "gene_name": "UBC", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q14164", "url": "https://www.uniprot.org/uniprotkb/Q14164" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 396, "end_pos": 396, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by IKKE and TBK1", "evidence": [ { "database": "UniProtKB", "id": "Q14653", "url": "https://www.uniprot.org/uniprotkb/Q14653" }, { "database": "iPTMnet", "id": "Q14653", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q14653" }, { "database": "PubMed", "id": "12524442", "url": "https://pubmed.ncbi.nlm.nih.gov/12524442" }, { "database": "PRO", "id": "Q14653", "url": "https://proconsortium.org/cgi-bin/entry_pro?id=Q14653" }, { "database": "PubMed", "id": "17761676", "url": "https://pubmed.ncbi.nlm.nih.gov/17761676" }, { "database": "PubMed", "id": "18356163", "url": "https://pubmed.ncbi.nlm.nih.gov/18356163" }, { "database": "PubMed", "id": "19893624", "url": "https://pubmed.ncbi.nlm.nih.gov/19893624" }, { "database": "PubMed", "id": "20161788", "url": "https://pubmed.ncbi.nlm.nih.gov/20161788" }, { "database": "PubMed", "id": "20170763", "url": "https://pubmed.ncbi.nlm.nih.gov/20170763" }, { "database": "PubMed", "id": "20416917", "url": "https://pubmed.ncbi.nlm.nih.gov/20416917" }, { "database": "PubMed", "id": "20511230", "url": "https://pubmed.ncbi.nlm.nih.gov/20511230" }, { "database": "PubMed", "id": "20532218", "url": "https://pubmed.ncbi.nlm.nih.gov/20532218" }, { "database": "PubMed", "id": "20609418", "url": "https://pubmed.ncbi.nlm.nih.gov/20609418" }, { "database": "PubMed", "id": "20694008", "url": "https://pubmed.ncbi.nlm.nih.gov/20694008" }, { "database": "PubMed", "id": "21347389", "url": "https://pubmed.ncbi.nlm.nih.gov/21347389" }, { "database": "PubMed", "id": "23090018", "url": "https://pubmed.ncbi.nlm.nih.gov/23090018" }, { "database": "PubMed", "id": "23633948", "url": "https://pubmed.ncbi.nlm.nih.gov/23633948" }, { "database": "PubMed", "id": "24722368", "url": "https://pubmed.ncbi.nlm.nih.gov/24722368" }, { "database": "PubMed", "id": "24870145", "url": "https://pubmed.ncbi.nlm.nih.gov/24870145" }, { "database": "PubMed", "id": "25444175", "url": "https://pubmed.ncbi.nlm.nih.gov/25444175" }, { "database": "PubMed", "id": "25891802", "url": "https://pubmed.ncbi.nlm.nih.gov/25891802" }, { "database": "PubMed", "id": "25923723", "url": "https://pubmed.ncbi.nlm.nih.gov/25923723" }, { "database": "PubMed", "id": "26811330", "url": "https://pubmed.ncbi.nlm.nih.gov/26811330" }, { "database": "PubMed", "id": "27576490", "url": "https://pubmed.ncbi.nlm.nih.gov/27576490" }, { "database": "PubMed", "id": "27791205", "url": "https://pubmed.ncbi.nlm.nih.gov/27791205" }, { "database": "PubMed", "id": "28150813", "url": "https://pubmed.ncbi.nlm.nih.gov/28150813" }, { "database": "PubMed", "id": "28589097", "url": "https://pubmed.ncbi.nlm.nih.gov/28589097" }, { "database": "PubMed", "id": "28717003", "url": "https://pubmed.ncbi.nlm.nih.gov/28717003" }, { "database": "PubMed", "id": "29677136", "url": "https://pubmed.ncbi.nlm.nih.gov/29677136" }, { "database": "PubMed", "id": "29962372", "url": "https://pubmed.ncbi.nlm.nih.gov/29962372" }, { "database": "PubMed", "id": "30323286", "url": "https://pubmed.ncbi.nlm.nih.gov/30323286" }, { "database": "PubMed", "id": "30867315", "url": "https://pubmed.ncbi.nlm.nih.gov/30867315" }, { "database": "PubMed", "id": "31618847", "url": "https://pubmed.ncbi.nlm.nih.gov/31618847" }, { "database": "PubMed", "id": "31686982", "url": "https://pubmed.ncbi.nlm.nih.gov/31686982" }, { "database": "PubMed", "id": "32179480", "url": "https://pubmed.ncbi.nlm.nih.gov/32179480" }, { "database": "PubMed", "id": "32634441", "url": "https://pubmed.ncbi.nlm.nih.gov/32634441" }, { "database": "PubMed", "id": "32783398", "url": "https://pubmed.ncbi.nlm.nih.gov/32783398" }, { "database": "PubMed", "id": "33253291", "url": "https://pubmed.ncbi.nlm.nih.gov/33253291" }, { "database": "PubMed", "id": "33300875", "url": "https://pubmed.ncbi.nlm.nih.gov/33300875" }, { "database": "PubMed", "id": "33391252", "url": "https://pubmed.ncbi.nlm.nih.gov/33391252" }, { "database": "PubMed", "id": "33603735", "url": "https://pubmed.ncbi.nlm.nih.gov/33603735" }, { "database": "PubMed", "id": "33986734", "url": "https://pubmed.ncbi.nlm.nih.gov/33986734" }, { "database": "PubMed", "id": "23478265", "url": "https://pubmed.ncbi.nlm.nih.gov/23478265" }, { "database": "PubMed", "id": "27302953", "url": "https://pubmed.ncbi.nlm.nih.gov/27302953" }, { "database": "PubMed", "id": "36603579", "url": "https://pubmed.ncbi.nlm.nih.gov/36603579" }, { "database": "PubMed", "id": "22394562", "url": "https://pubmed.ncbi.nlm.nih.gov/22394562" } ], "site_lbl": "Ser396", "uniprot_canonical_ac": "Q14653-1" } ], "mutagenesis": [ { "start_pos": 441, "end_pos": 441, "sequence_org": "Y", "sequence_mut": "A", "comment": "Abolishes interaction with RNF216; when associated with A-443.", "evidence": [ { "database": "UniProtKB", "id": "Q13114", "url": "https://www.uniprot.org/uniprotkb/Q13114" }, { "database": "PubMed", "id": "19893624", "url": "https://pubmed.ncbi.nlm.nih.gov/19893624" } ], "uniprot_canonical_ac": "Q13114-1" }, { "start_pos": 443, "end_pos": 443, "sequence_org": "Q", "sequence_mut": "A", "comment": "Abolishes interaction with RNF216; when associated with A-441.", "evidence": [ { "database": "UniProtKB", "id": "Q13114", "url": "https://www.uniprot.org/uniprotkb/Q13114" }, { "database": "PubMed", "id": "19893624", "url": "https://pubmed.ncbi.nlm.nih.gov/19893624" } ], "uniprot_canonical_ac": "Q13114-1" } ], "record_id": "pubmed.19893624", "abstract": "", "glycosylation": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 35 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Different modes of ubiquitination of the adaptor TRAF3 selectively activate the expression of type I interferons and proinflammatory cytokines.", "journal": "Nature immunology", "date": "2010", "authors": "Tseng PH, Matsuzawa A, Zhang W, Mino T, Vignali DA, Karin M", "reference": { "type": "PubMed", "id": "19898473", "url": "https://pubmed.ncbi.nlm.nih.gov/19898473" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q14164-1", "protein_name": "Inhibitor of nuclear factor kappa-B kinase subunit epsilon", "gene_name": "IKBKE", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UHD2-1", "protein_name": "Serine/threonine-protein kinase TBK1", "gene_name": "TBK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92844-1", "protein_name": "TRAF family member-associated NF-kappa-B activator", "gene_name": "TANK", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q60803-1", "protein_name": "TNF receptor-associated factor 3", "gene_name": "Traf3", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "Q14653-1", "protein_name": "Interferon regulatory factor 3", "gene_name": "IRF3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62985-1", "protein_name": "Ubiquitin-ribosomal protein eL40 fusion protein", "gene_name": "UBA52", "tax_name": "Chicken" }, { "uniprot_canonical_ac": "O00206-1", "protein_name": "Toll-like receptor 4", "gene_name": "TLR4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y6Y9-1", "protein_name": "Lymphocyte antigen 96", "gene_name": "LY96", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96CV9-1", "protein_name": "Optineurin", "gene_name": "OPTN", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92985-1", "protein_name": "Interferon regulatory factor 7", "gene_name": "IRF7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q06124-2", "protein_name": "Tyrosine-protein phosphatase non-receptor type 11", "gene_name": "PTPN11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG62-1", "protein_name": "Polyubiquitin-B", "gene_name": "UBB", "tax_name": "Chicken" }, { "uniprot_canonical_ac": "P62979-1", "protein_name": "Ubiquitin-ribosomal protein eS31 fusion protein", "gene_name": "RPS27A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15455-1", "protein_name": "Toll-like receptor 3", "gene_name": "TLR3", "tax_name": "Human" }, { "uniprot_canonical_ac": "A5HNF6-1", "protein_name": "Myeloid differentiation primary response protein MyD88", "gene_name": "MYD88", "tax_name": "Chicken" }, { "uniprot_canonical_ac": "E1C626-1", "protein_name": "TNF receptor-associated factor", "gene_name": "TRAF6", "tax_name": "Chicken" }, { "uniprot_canonical_ac": "P79781-1", "protein_name": "Ubiquitin-ribosomal protein eS31 fusion protein", "gene_name": "RPS27A", "tax_name": "Chicken" }, { "uniprot_canonical_ac": "P0CG47-1", "protein_name": "Polyubiquitin-B", "gene_name": "UBB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13114-1", "protein_name": "TNF receptor-associated factor 3", "gene_name": "TRAF3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P08571-1", "protein_name": "Monocyte differentiation antigen CD14", "gene_name": "CD14", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62987-1", "protein_name": "Ubiquitin-ribosomal protein eL40 fusion protein", "gene_name": "UBA52", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86XR7-1", "protein_name": "TIR domain-containing adapter molecule 2", "gene_name": "TICAM2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8IUC6-1", "protein_name": "TIR domain-containing adapter molecule 1", "gene_name": "TICAM1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG48-1", "protein_name": "Polyubiquitin-C", "gene_name": "UBC", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q14164", "url": "https://www.uniprot.org/uniprotkb/Q14164" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 106, "end_pos": 106, "sequence_org": "K", "sequence_mut": "R", "comment": "Reduces 'Lys-48'-linked polyubiquitination; when associated with R-155.", "evidence": [ { "database": "UniProtKB", "id": "Q60803", "url": "https://www.uniprot.org/uniprotkb/Q60803" }, { "database": "PubMed", "id": "19898473", "url": "https://pubmed.ncbi.nlm.nih.gov/19898473" } ], "uniprot_canonical_ac": "Q60803-1" }, { "start_pos": 155, "end_pos": 155, "sequence_org": "K", "sequence_mut": "R", "comment": "Reduces 'Lys-48'-linked polyubiquitination; when associated with R-106.", "evidence": [ { "database": "UniProtKB", "id": "Q60803", "url": "https://www.uniprot.org/uniprotkb/Q60803" }, { "database": "PubMed", "id": "19898473", "url": "https://pubmed.ncbi.nlm.nih.gov/19898473" } ], "uniprot_canonical_ac": "Q60803-1" }, { "start_pos": 67, "end_pos": 67, "sequence_org": "C", "sequence_mut": "A", "comment": "Strongly reduces 'Lys-63'-linked ubiquitination; when associated with A-69. Abolishes inhibition of NFKB2 processing; when associated with A-69.", "evidence": [ { "database": "UniProtKB", "id": "Q60803", "url": "https://www.uniprot.org/uniprotkb/Q60803" }, { "database": "PubMed", "id": "19898473", "url": "https://pubmed.ncbi.nlm.nih.gov/19898473" }, { "database": "PubMed", "id": "17158868", "url": "https://pubmed.ncbi.nlm.nih.gov/17158868" } ], "uniprot_canonical_ac": "Q60803-1" }, { "start_pos": 69, "end_pos": 69, "sequence_org": "H", "sequence_mut": "A", "comment": "Strongly reduces 'Lys-63'-linked ubiquitination; when associated with A-69. Abolishes inhibition of NFKB2 processing; when associated with A-67.", "evidence": [ { "database": "UniProtKB", "id": "Q60803", "url": "https://www.uniprot.org/uniprotkb/Q60803" }, { "database": "PubMed", "id": "19898473", "url": "https://pubmed.ncbi.nlm.nih.gov/19898473" }, { "database": "PubMed", "id": "17158868", "url": "https://pubmed.ncbi.nlm.nih.gov/17158868" } ], "uniprot_canonical_ac": "Q60803-1" } ], "record_id": "pubmed.19898473", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 24 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Inhibition of NF-kappaB signaling by A20 through disruption of ubiquitin enzyme complexes.", "journal": "Science (New York, N.Y.)", "date": "2010", "authors": "Shembade N, Ma A, Harhaj EW", "reference": { "type": "PubMed", "id": "20185725", "url": "https://pubmed.ncbi.nlm.nih.gov/20185725" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q14164-1", "protein_name": "Inhibitor of nuclear factor kappa-B kinase subunit epsilon", "gene_name": "IKBKE", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UHD2-1", "protein_name": "Serine/threonine-protein kinase TBK1", "gene_name": "TBK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15111-1", "protein_name": "Inhibitor of nuclear factor kappa-B kinase subunit alpha", "gene_name": "CHUK", "tax_name": "Human" }, { "uniprot_canonical_ac": "P98170-1", "protein_name": "E3 ubiquitin-protein ligase XIAP", "gene_name": "XIAP", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13546-1", "protein_name": "Receptor-interacting serine/threonine-protein kinase 1", "gene_name": "RIPK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75385-1", "protein_name": "Serine/threonine-protein kinase ULK1", "gene_name": "ULK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P21580-1", "protein_name": "Tumor necrosis factor alpha-induced protein 3", "gene_name": "TNFAIP3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68036-1", "protein_name": "Ubiquitin-conjugating enzyme E2 L3", "gene_name": "UBE2L3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96DZ5-1", "protein_name": "CAP-Gly domain-containing linker protein 3", "gene_name": "CLIP3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P19438-1", "protein_name": "Tumor necrosis factor receptor superfamily member 1A", "gene_name": "TNFRSF1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UM82-1", "protein_name": "Spermatogenesis-associated protein 2", "gene_name": "SPATA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49137-1", "protein_name": "MAP kinase-activated protein kinase 2", "gene_name": "MAPKAPK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BYM8-1", "protein_name": "RanBP-type and C3HC4-type zinc finger-containing protein 1", "gene_name": "RBCK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96EP0-1", "protein_name": "E3 ubiquitin-protein ligase RNF31", "gene_name": "RNF31", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H0F6-1", "protein_name": "Sharpin", "gene_name": "SHARPIN", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5VV17-1", "protein_name": "OTU domain-containing protein 1", "gene_name": "OTUD1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96AX9-1", "protein_name": "E3 ubiquitin-protein ligase MIB2", "gene_name": "MIB2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TCT8-1", "protein_name": "Signal peptide peptidase-like 2A", "gene_name": "SPPL2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14920-1", "protein_name": "Inhibitor of nuclear factor kappa-B kinase subunit beta", "gene_name": "IKBKB", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61077-1", "protein_name": "Ubiquitin-conjugating enzyme E2 D3", "gene_name": "UBE2D3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51668-1", "protein_name": "Ubiquitin-conjugating enzyme E2 D1", "gene_name": "UBE2D1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86VP1-1", "protein_name": "Tax1-binding protein 1", "gene_name": "TAX1BP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13158-1", "protein_name": "FAS-associated death domain protein", "gene_name": "FADD", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6GQQ9-1", "protein_name": "OTU domain-containing protein 7B", "gene_name": "OTUD7B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NQC7-1", "protein_name": "Ubiquitin carboxyl-terminal hydrolase CYLD", "gene_name": "CYLD", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UK80-1", "protein_name": "Ubiquitin carboxyl-terminal hydrolase 21", "gene_name": "USP21", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TCT7-1", "protein_name": "Signal peptide peptidase-like 2B", "gene_name": "SPPL2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96CV9-1", "protein_name": "Optineurin", "gene_name": "OPTN", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13077-1", "protein_name": "TNF receptor-associated factor 1", "gene_name": "TRAF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14790-1", "protein_name": "Caspase-8", "gene_name": "CASP8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P39429-1", "protein_name": "TNF receptor-associated factor 2", "gene_name": "Traf2", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "Q60769-1", "protein_name": "Tumor necrosis factor alpha-induced protein 3", "gene_name": "Tnfaip3", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "Q15628-1", "protein_name": "Tumor necrosis factor receptor type 1-associated DEATH domain protein", "gene_name": "TRADD", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13490-1", "protein_name": "Baculoviral IAP repeat-containing protein 2", "gene_name": "BIRC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62979-1", "protein_name": "Ubiquitin-ribosomal protein eS31 fusion protein", "gene_name": "RPS27A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62837-1", "protein_name": "Ubiquitin-conjugating enzyme E2 D2", "gene_name": "UBE2D2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13489-1", "protein_name": "Baculoviral IAP repeat-containing protein 3", "gene_name": "BIRC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01375-1", "protein_name": "Tumor necrosis factor", "gene_name": "TNF", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG47-1", "protein_name": "Polyubiquitin-B", "gene_name": "UBB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96BN8-1", "protein_name": "Ubiquitin thioesterase otulin", "gene_name": "OTULIN", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62987-1", "protein_name": "Ubiquitin-ribosomal protein eL40 fusion protein", "gene_name": "UBA52", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12933-1", "protein_name": "TNF receptor-associated factor 2", "gene_name": "TRAF2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y6K9-1", "protein_name": "NF-kappa-B essential modulator", "gene_name": "IKBKG", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13107-1", "protein_name": "Ubiquitin carboxyl-terminal hydrolase 4", "gene_name": "USP4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P63244-1", "protein_name": "Small ribosomal subunit protein RACK1", "gene_name": "RACK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG48-1", "protein_name": "Polyubiquitin-C", "gene_name": "UBC", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75604-1", "protein_name": "Ubiquitin carboxyl-terminal hydrolase 2", "gene_name": "USP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UNE7-1", "protein_name": "E3 ubiquitin-protein ligase CHIP", "gene_name": "STUB1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q14164", "url": "https://www.uniprot.org/uniprotkb/Q14164" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 103, "end_pos": 103, "sequence_org": "C", "sequence_mut": "A", "comment": "Loss of deubiquitinating activity, does not disassemble TRAF6:UBE2N ubiquitin ligase complex, abolioshes TAX1BP1 interaction with UBE2N.", "evidence": [ { "database": "UniProtKB", "id": "Q60769", "url": "https://www.uniprot.org/uniprotkb/Q60769" }, { "database": "PubMed", "id": "20185725", "url": "https://pubmed.ncbi.nlm.nih.gov/20185725" }, { "database": "PubMed", "id": "15334086", "url": "https://pubmed.ncbi.nlm.nih.gov/15334086" } ], "uniprot_canonical_ac": "Q60769-1" } ], "record_id": "pubmed.20185725", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 48 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] } ]