[ { "title": "Structure of human immunoglobulin gamma genes: implications for evolution of a gene family.", "journal": "Cell", "date": "1982", "authors": "Takahashi N, Ueda S, Obata M, Nikaido T, Nakai S, Honjo T", "reference": { "type": "PubMed", "id": "6811139", "url": "https://pubmed.ncbi.nlm.nih.gov/6811139" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P01860-2", "protein_name": "Immunoglobulin heavy constant gamma 3", "gene_name": "IGHG3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01876-2", "protein_name": "Immunoglobulin heavy constant alpha 1", "gene_name": "IGHA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01859-2", "protein_name": "Immunoglobulin heavy constant gamma 2", "gene_name": "IGHG2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01857-2", "protein_name": "Immunoglobulin heavy constant gamma 1", "gene_name": "IGHG1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P01860", "url": "https://www.uniprot.org/uniprotkb/P01860" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.6811139", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 4 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Three-dimensional elution mapping of pyridylaminated N-linked neutral and sialyl oligosaccharides.", "journal": "Analytical biochemistry", "date": "1995", "authors": "Takahashi N, Nakagawa H, Fujikawa K, Kawamura Y, Tomiya N", "reference": { "type": "PubMed", "id": "7540366", "url": "https://pubmed.ncbi.nlm.nih.gov/7540366" }, "referenced_glycans": [ { "glytoucan_ac": "G79446WY" }, { "glytoucan_ac": "G14127XU" }, { "glytoucan_ac": "G43694RQ" }, { "glytoucan_ac": "G37491LV" }, { "glytoucan_ac": "G91023GB" }, { "glytoucan_ac": "G91365ZQ" }, { "glytoucan_ac": "G91473PK" }, { "glytoucan_ac": "G06356OH" }, { "glytoucan_ac": "G84452RH" }, { "glytoucan_ac": "G84467IZ" }, { "glytoucan_ac": "G22310AV" }, { "glytoucan_ac": "G22754FQ" }, { "glytoucan_ac": "G14994KB" }, { "glytoucan_ac": "G56749GV" }, { "glytoucan_ac": "G02030ZB" }, { "glytoucan_ac": "G94547KR" }, { "glytoucan_ac": "G09675DY" }, { "glytoucan_ac": "G48414YA" }, { "glytoucan_ac": "G11041DA" }, { "glytoucan_ac": "G46031NV" }, { "glytoucan_ac": "G69159WK" } ], "referenced_proteins": [ { "uniprot_canonical_ac": "P01860-2", "protein_name": "Immunoglobulin heavy constant gamma 3", "gene_name": "IGHG3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01861-2", "protein_name": "Immunoglobulin heavy constant gamma 4", "gene_name": "IGHG4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01859-2", "protein_name": "Immunoglobulin heavy constant gamma 2", "gene_name": "IGHG2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01857-2", "protein_name": "Immunoglobulin heavy constant gamma 1", "gene_name": "IGHG1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P01860", "url": "https://www.uniprot.org/uniprotkb/P01860" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "glycosylation": [ { "glytoucan_ac": "G02030ZB", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "7540366", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/7540366" }, { "id": "233", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/233" }, { "id": "24680513", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24680513" }, { "id": "23382691", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23382691" }, { "id": "25685702", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/25685702" }, { "id": "25004930", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/25004930" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0010000.1110100000.000111000001111101.00100.01000", "uniprot_canonical_ac": "P01860-2" }, { "glytoucan_ac": "G06356OH", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "7540366", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/7540366" }, { "id": "233", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/233" }, { "id": "11500028", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/11500028" }, { "id": "271", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/271" }, { "id": "25685702", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/25685702" }, { "id": "24680513", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24680513" }, { "id": "25004930", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/25004930" }, { "id": "23382691", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23382691" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0100000.1100100000.010111000011111101.00100.01000", "uniprot_canonical_ac": "P01860-2" }, { "glytoucan_ac": "G11041DA", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "1639758", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/1639758" }, { "id": "233", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/233" }, { "id": "7540366", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/7540366" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0010000.1110100000.010100000001011000.10000.01000", "uniprot_canonical_ac": "P01860-2" }, { "glytoucan_ac": "G14127XU", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "7540366", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/7540366" }, { "id": "233", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/233" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0010000.1110100000.000100000001000000.10000.01000", "uniprot_canonical_ac": "P01860-2" }, { "glytoucan_ac": "G14994KB", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "7540366", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/7540366" }, { "id": "233", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/233" }, { "id": "25685702", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/25685702" }, { "id": "23382691", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23382691" }, { "id": "25004930", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/25004930" }, { "id": "24680513", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24680513" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0100000.1110100000.010111000001111100.00100.01000", "uniprot_canonical_ac": "P01860-2" }, { "glytoucan_ac": "G22310AV", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "7540366", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/7540366" }, { "id": "233", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/233" }, { "id": "10574203", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/10574203" }, { "id": "11500028", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/11500028" }, { "id": "271", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/271" }, { "id": "25004930", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/25004930" }, { "id": "23382691", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23382691" }, { "id": "25685702", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/25685702" }, { "id": "24680513", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24680513" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0010000.1110100000.010111000011111101.00100.01000", "uniprot_canonical_ac": "P01860-2" }, { "glytoucan_ac": "G43694RQ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "7540366", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/7540366" }, { "id": "233", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/233" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0100000.1110100000.000000000001010000.10000.01000", "uniprot_canonical_ac": "P01860-2" }, { "glytoucan_ac": "G48414YA", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "7540366", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/7540366" }, { "id": "233", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/233" }, { "id": "11500028", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/11500028" }, { "id": "271", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/271" }, { "id": "23382691", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23382691" }, { "id": "25685702", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/25685702" }, { "id": "24680513", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24680513" }, { "id": "25004930", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/25004930" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0010000.1100100000.010111000011111100.00100.01000", "uniprot_canonical_ac": "P01860-2" }, { "glytoucan_ac": "G56749GV", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "7540366", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/7540366" }, { "id": "233", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/233" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0010000.1110100000.010100000001111000.10000.01000", "uniprot_canonical_ac": "P01860-2" }, { "glytoucan_ac": "G84452RH", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "1639758", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/1639758" }, { "id": "233", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/233" }, { "id": "7540366", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/7540366" }, { "id": "10574203", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/10574203" }, { "id": "11500028", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/11500028" }, { "id": "271", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/271" }, { "id": "23382691", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23382691" }, { "id": "25685702", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/25685702" }, { "id": "24680513", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24680513" }, { "id": "25004930", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/25004930" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0010000.1110100000.010111000011111101.00100.01000", "uniprot_canonical_ac": "P01860-2" }, { "glytoucan_ac": "G84467IZ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "7540366", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/7540366" }, { "id": "233", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/233" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0010000.1100100000.010100000001111000.10000.01000", "uniprot_canonical_ac": "P01860-2" }, { "glytoucan_ac": "G91023GB", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "7540366", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/7540366" }, { "id": "233", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/233" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0010000.1110100000.000100000001000000.10000.01000", "uniprot_canonical_ac": "P01860-2" }, { "glytoucan_ac": "G91365ZQ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "7540366", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/7540366" }, { "id": "233", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/233" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0100000.1100100000.010100000001010000.10000.01000", "uniprot_canonical_ac": "P01860-2" }, { "glytoucan_ac": "G91473PK", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "7540366", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/7540366" }, { "id": "233", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/233" }, { "id": "23382691", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23382691" }, { "id": "25685702", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/25685702" }, { "id": "25004930", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/25004930" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0010000.1110100000.000110000001101100.00100.01000", "uniprot_canonical_ac": "P01860-2" }, { "glytoucan_ac": "G02030ZB", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "7540366", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/7540366" }, { "id": "233", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/233" }, { "id": "24680513", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24680513" }, { "id": "23382691", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23382691" }, { "id": "25685702", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/25685702" }, { "id": "25004930", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/25004930" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0010000.1110100000.000111000001111101.00100.01000", "uniprot_canonical_ac": "P01861-2" }, { "glytoucan_ac": "G06356OH", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "7540366", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/7540366" }, { "id": "233", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/233" }, { "id": "25685702", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/25685702" }, { "id": "24680513", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24680513" }, { "id": "25004930", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/25004930" }, { "id": "23382691", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23382691" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0100000.1100100000.010111000011111101.00100.01000", "uniprot_canonical_ac": "P01861-2" }, { "glytoucan_ac": "G11041DA", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "1639758", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/1639758" }, { "id": "233", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/233" }, { "id": "7540366", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/7540366" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0010000.1110100000.010100000001011000.10000.01000", "uniprot_canonical_ac": "P01861-2" }, { "glytoucan_ac": "G14127XU", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "7540366", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/7540366" }, { "id": "233", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/233" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0010000.1110100000.000100000001000000.10000.01000", "uniprot_canonical_ac": "P01861-2" }, { "glytoucan_ac": "G14994KB", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "7540366", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/7540366" }, { "id": "233", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/233" }, { "id": "25685702", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/25685702" }, { "id": "23382691", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23382691" }, { "id": "25004930", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/25004930" }, { "id": "24680513", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24680513" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0100000.1110100000.010111000001111100.00100.01000", "uniprot_canonical_ac": "P01861-2" }, { "glytoucan_ac": "G22310AV", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "7540366", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/7540366" }, { "id": "233", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/233" }, { "id": "10574203", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/10574203" }, { "id": "25004930", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/25004930" }, { "id": "23382691", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23382691" }, { "id": "25685702", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/25685702" }, { "id": "24680513", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24680513" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0010000.1110100000.010111000011111101.00100.01000", "uniprot_canonical_ac": "P01861-2" }, { "glytoucan_ac": "G43694RQ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "7540366", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/7540366" }, { "id": "233", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/233" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0100000.1110100000.000000000001010000.10000.01000", "uniprot_canonical_ac": "P01861-2" }, { "glytoucan_ac": "G48414YA", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "7540366", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/7540366" }, { "id": "233", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/233" }, { "id": "23382691", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23382691" }, { "id": "25685702", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/25685702" }, { "id": "24680513", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24680513" }, { "id": "25004930", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/25004930" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0010000.1100100000.010111000011111100.00100.01000", "uniprot_canonical_ac": "P01861-2" }, { "glytoucan_ac": "G56749GV", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "7540366", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/7540366" }, { "id": "233", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/233" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0010000.1110100000.010100000001111000.10000.01000", "uniprot_canonical_ac": "P01861-2" }, { "glytoucan_ac": "G84452RH", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "1639758", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/1639758" }, { "id": "233", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/233" }, { "id": "7540366", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/7540366" }, { "id": "10574203", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/10574203" }, { "id": "23382691", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23382691" }, { "id": "25685702", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/25685702" }, { "id": "24680513", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24680513" }, { "id": "25004930", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/25004930" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0010000.1110100000.010111000011111101.00100.01000", "uniprot_canonical_ac": "P01861-2" }, { "glytoucan_ac": "G84467IZ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "7540366", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/7540366" }, { "id": "233", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/233" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0010000.1100100000.010100000001111000.10000.01000", "uniprot_canonical_ac": "P01861-2" }, { "glytoucan_ac": "G91023GB", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "7540366", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/7540366" }, { "id": "233", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/233" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0010000.1110100000.000100000001000000.10000.01000", "uniprot_canonical_ac": "P01861-2" }, { "glytoucan_ac": "G91365ZQ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "7540366", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/7540366" }, { "id": "233", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/233" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0100000.1100100000.010100000001010000.10000.01000", "uniprot_canonical_ac": "P01861-2" }, { "glytoucan_ac": "G91473PK", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "7540366", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/7540366" }, { "id": "233", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/233" }, { "id": "23382691", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23382691" }, { "id": "25685702", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/25685702" }, { "id": "25004930", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/25004930" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0010000.1110100000.000110000001101100.00100.01000", "uniprot_canonical_ac": "P01861-2" }, { "glytoucan_ac": "G02030ZB", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "7540366", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/7540366" }, { "id": "233", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/233" }, { "id": "24680513", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24680513" }, { "id": "23382691", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23382691" }, { "id": "25685702", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/25685702" }, { "id": "25004930", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/25004930" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0010000.1110100000.000111000001111101.00100.01000", "uniprot_canonical_ac": "P01859-2" }, { "glytoucan_ac": "G06356OH", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "7540366", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/7540366" }, { "id": "233", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/233" }, { "id": "25685702", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/25685702" }, { "id": "24680513", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24680513" }, { "id": "25004930", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/25004930" }, { "id": "23382691", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23382691" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0100000.1100100000.010111000011111101.00100.01000", "uniprot_canonical_ac": "P01859-2" }, { "glytoucan_ac": "G11041DA", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "1639758", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/1639758" }, { "id": "233", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/233" }, { "id": "7540366", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/7540366" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0010000.1110100000.010100000001011000.10000.01000", "uniprot_canonical_ac": "P01859-2" }, { "glytoucan_ac": "G14127XU", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "7540366", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/7540366" }, { "id": "233", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/233" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0010000.1110100000.000100000001000000.10000.01000", "uniprot_canonical_ac": "P01859-2" }, { "glytoucan_ac": "G14994KB", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "7540366", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/7540366" }, { "id": "233", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/233" }, { "id": "25685702", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/25685702" }, { "id": "23382691", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23382691" }, { "id": "25004930", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/25004930" }, { "id": "24680513", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24680513" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0100000.1110100000.010111000001111100.00100.01000", "uniprot_canonical_ac": "P01859-2" }, { "glytoucan_ac": "G22310AV", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "7540366", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/7540366" }, { "id": "233", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/233" }, { "id": "10574203", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/10574203" }, { "id": "25004930", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/25004930" }, { "id": "23382691", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23382691" }, { "id": "25685702", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/25685702" }, { "id": "24680513", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24680513" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0010000.1110100000.010111000011111101.00100.01000", "uniprot_canonical_ac": "P01859-2" }, { "glytoucan_ac": "G43694RQ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "7540366", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/7540366" }, { "id": "233", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/233" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0100000.1110100000.000000000001010000.10000.01000", "uniprot_canonical_ac": "P01859-2" }, { "glytoucan_ac": "G48414YA", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "7540366", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/7540366" }, { "id": "233", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/233" }, { "id": "23382691", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23382691" }, { "id": "25685702", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/25685702" }, { "id": "24680513", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24680513" }, { "id": "25004930", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/25004930" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0010000.1100100000.010111000011111100.00100.01000", "uniprot_canonical_ac": "P01859-2" }, { "glytoucan_ac": "G56749GV", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "7540366", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/7540366" }, { "id": "233", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/233" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0010000.1110100000.010100000001111000.10000.01000", "uniprot_canonical_ac": "P01859-2" }, { "glytoucan_ac": "G84452RH", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "1639758", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/1639758" }, { "id": "233", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/233" }, { "id": "7540366", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/7540366" }, { "id": "10574203", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/10574203" }, { "id": "23382691", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23382691" }, { "id": "25685702", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/25685702" }, { "id": "24680513", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24680513" }, { "id": "25004930", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/25004930" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0010000.1110100000.010111000011111101.00100.01000", "uniprot_canonical_ac": "P01859-2" }, { "glytoucan_ac": "G84467IZ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "7540366", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/7540366" }, { "id": "233", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/233" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0010000.1100100000.010100000001111000.10000.01000", "uniprot_canonical_ac": "P01859-2" }, { "glytoucan_ac": "G91023GB", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "7540366", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/7540366" }, { "id": "233", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/233" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0010000.1110100000.000100000001000000.10000.01000", "uniprot_canonical_ac": "P01859-2" }, { "glytoucan_ac": "G91365ZQ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "7540366", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/7540366" }, { "id": "233", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/233" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0100000.1100100000.010100000001010000.10000.01000", "uniprot_canonical_ac": "P01859-2" }, { "glytoucan_ac": "G91473PK", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "7540366", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/7540366" }, { "id": "233", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/233" }, { "id": "23382691", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23382691" }, { "id": "25685702", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/25685702" }, { "id": "25004930", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/25004930" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0010000.1110100000.000110000001101100.00100.01000", "uniprot_canonical_ac": "P01859-2" }, { "glytoucan_ac": "G02030ZB", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "7540366", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/7540366" }, { "id": "233", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/233" }, { "id": "24680513", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24680513" }, { "id": "23382691", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23382691" }, { "id": "25685702", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/25685702" }, { "id": "25004930", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/25004930" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0010000.1110100000.000111000001111101.00100.01000", "uniprot_canonical_ac": "P01857-2" }, { "glytoucan_ac": "G06356OH", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "7540366", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/7540366" }, { "id": "233", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/233" }, { "id": "25685702", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/25685702" }, { "id": "24680513", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24680513" }, { "id": "25004930", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/25004930" }, { "id": "23382691", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23382691" }, { "id": "34834161", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34834161" }, { "id": "2982", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/2982" }, { "id": "2984", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/2984" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0100000.1100100000.010111000011111101.00100.01000", "uniprot_canonical_ac": "P01857-2" }, { "glytoucan_ac": "G11041DA", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "1639758", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/1639758" }, { "id": "233", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/233" }, { "id": "7540366", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/7540366" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0010000.1110100000.010100000001011000.10000.01000", "uniprot_canonical_ac": "P01857-2" }, { "glytoucan_ac": "G14127XU", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "7540366", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/7540366" }, { "id": "233", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/233" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0010000.1110100000.000100000001000000.10000.01000", "uniprot_canonical_ac": "P01857-2" }, { "glytoucan_ac": "G14994KB", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "7540366", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/7540366" }, { "id": "233", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/233" }, { "id": "25685702", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/25685702" }, { "id": "23382691", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23382691" }, { "id": "25004930", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/25004930" }, { "id": "24680513", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24680513" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0100000.1110100000.010111000001111100.00100.01000", "uniprot_canonical_ac": "P01857-2" }, { "glytoucan_ac": "G22310AV", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "7540366", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/7540366" }, { "id": "233", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/233" }, { "id": "10574203", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/10574203" }, { "id": "25004930", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/25004930" }, { "id": "23382691", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23382691" }, { "id": "25685702", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/25685702" }, { "id": "24680513", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24680513" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0010000.1110100000.010111000011111101.00100.01000", "uniprot_canonical_ac": "P01857-2" }, { "glytoucan_ac": "G43694RQ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "7540366", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/7540366" }, { "id": "233", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/233" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0100000.1110100000.000000000001010000.10000.01000", "uniprot_canonical_ac": "P01857-2" }, { "glytoucan_ac": "G48414YA", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "7540366", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/7540366" }, { "id": "233", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/233" }, { "id": "23382691", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23382691" }, { "id": "25685702", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/25685702" }, { "id": "24680513", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24680513" }, { "id": "25004930", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/25004930" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0010000.1100100000.010111000011111100.00100.01000", "uniprot_canonical_ac": "P01857-2" }, { "glytoucan_ac": "G56749GV", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "7540366", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/7540366" }, { "id": "233", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/233" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0010000.1110100000.010100000001111000.10000.01000", "uniprot_canonical_ac": "P01857-2" }, { "glytoucan_ac": "G84452RH", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "1639758", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/1639758" }, { "id": "233", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/233" }, { "id": "7540366", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/7540366" }, { "id": "10574203", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/10574203" }, { "id": "23382691", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23382691" }, { "id": "25685702", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/25685702" }, { "id": "24680513", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24680513" }, { "id": "25004930", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/25004930" }, { "id": "34834161", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34834161" }, { "id": "2982", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/2982" }, { "id": "2984", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/2984" }, { "id": "2983", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/2983" }, { "id": "2980", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/2980" }, { "id": "2981", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/2981" }, { "id": "2985", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/2985" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0010000.1110100000.010111000011111101.00100.01000", "uniprot_canonical_ac": "P01857-2" }, { "glytoucan_ac": "G84467IZ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "7540366", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/7540366" }, { "id": "233", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/233" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0010000.1100100000.010100000001111000.10000.01000", "uniprot_canonical_ac": "P01857-2" }, { "glytoucan_ac": "G91023GB", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "7540366", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/7540366" }, { "id": "233", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/233" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0010000.1110100000.000100000001000000.10000.01000", "uniprot_canonical_ac": "P01857-2" }, { "glytoucan_ac": "G91365ZQ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "7540366", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/7540366" }, { "id": "233", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/233" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0100000.1100100000.010100000001010000.10000.01000", "uniprot_canonical_ac": "P01857-2" }, { "glytoucan_ac": "G91473PK", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "7540366", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/7540366" }, { "id": "233", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/233" }, { "id": "23382691", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23382691" }, { "id": "25685702", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/25685702" }, { "id": "25004930", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/25004930" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0010000.1110100000.000110000001101100.00100.01000", "uniprot_canonical_ac": "P01857-2" } ], "glycan_expression": [ { "glytoucan_ac": "G14127XU", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01859-2" }, { "glytoucan_ac": "G14127XU", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01861-2" }, { "glytoucan_ac": "G14127XU", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01857-2" }, { "glytoucan_ac": "G14127XU", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01860-2" }, { "glytoucan_ac": "G43694RQ", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01859-2" }, { "glytoucan_ac": "G43694RQ", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01861-2" }, { "glytoucan_ac": "G43694RQ", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01857-2" }, { "glytoucan_ac": "G43694RQ", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01860-2" }, { "glytoucan_ac": "G91023GB", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01859-2" }, { "glytoucan_ac": "G91023GB", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01861-2" }, { "glytoucan_ac": "G91023GB", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01857-2" }, { "glytoucan_ac": "G91023GB", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01860-2" }, { "glytoucan_ac": "G91365ZQ", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01859-2" }, { "glytoucan_ac": "G91365ZQ", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01861-2" }, { "glytoucan_ac": "G91365ZQ", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01857-2" }, { "glytoucan_ac": "G91365ZQ", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01860-2" }, { "glytoucan_ac": "G91473PK", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01859-2" }, { "glytoucan_ac": "G91473PK", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01861-2" }, { "glytoucan_ac": "G91473PK", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01857-2" }, { "glytoucan_ac": "G91473PK", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01860-2" }, { "glytoucan_ac": "G06356OH", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01859-2" }, { "glytoucan_ac": "G06356OH", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01861-2" }, { "glytoucan_ac": "G06356OH", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01857-2" }, { "glytoucan_ac": "G06356OH", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01860-2" }, { "glytoucan_ac": "G84452RH", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01859-2" }, { "glytoucan_ac": "G84452RH", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01861-2" }, { "glytoucan_ac": "G84452RH", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01857-2" }, { "glytoucan_ac": "G84452RH", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01860-2" }, { "glytoucan_ac": "G84467IZ", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01859-2" }, { "glytoucan_ac": "G84467IZ", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01861-2" }, { "glytoucan_ac": "G84467IZ", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01857-2" }, { "glytoucan_ac": "G84467IZ", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01860-2" }, { "glytoucan_ac": "G22310AV", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01859-2" }, { "glytoucan_ac": "G22310AV", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01861-2" }, { "glytoucan_ac": "G22310AV", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01857-2" }, { "glytoucan_ac": "G22310AV", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01860-2" }, { "glytoucan_ac": "G14994KB", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01859-2" }, { "glytoucan_ac": "G14994KB", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01861-2" }, { "glytoucan_ac": "G14994KB", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01857-2" }, { "glytoucan_ac": "G14994KB", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01860-2" }, { "glytoucan_ac": "G56749GV", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01859-2" }, { "glytoucan_ac": "G56749GV", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01861-2" }, { "glytoucan_ac": "G56749GV", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01857-2" }, { "glytoucan_ac": "G56749GV", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01860-2" }, { "glytoucan_ac": "G02030ZB", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01859-2" }, { "glytoucan_ac": "G02030ZB", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01861-2" }, { "glytoucan_ac": "G02030ZB", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01857-2" }, { "glytoucan_ac": "G02030ZB", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01860-2" }, { "glytoucan_ac": "G48414YA", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01859-2" }, { "glytoucan_ac": "G48414YA", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01861-2" }, { "glytoucan_ac": "G48414YA", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01857-2" }, { "glytoucan_ac": "G48414YA", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01860-2" }, { "glytoucan_ac": "G11041DA", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01859-2" }, { "glytoucan_ac": "G11041DA", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01861-2" }, { "glytoucan_ac": "G11041DA", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01857-2" }, { "glytoucan_ac": "G11041DA", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01860-2" } ], "record_id": "pubmed.7540366", "abstract": "", "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 4 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 21 } ], "sort_fields": [ "glytoucan_ac" ] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 56 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_sites", "count": 1 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 1 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 14 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "exact_sites", "count": 0 }, { "field": "fuzzy_sites", "count": 1 }, { "field": "fuzzy_n_linked_sites", "count": 1 }, { "field": "fuzzy_n_linked_glycan_sites", "count": 1 }, { "field": "fuzzy_n_linked_glycans", "count": 14 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "filter_code", "uniprot_canonical_ac" ] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 56 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_sites", "count": 1 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 1 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 14 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "exact_sites", "count": 0 }, { "field": "fuzzy_sites", "count": 1 }, { "field": "fuzzy_n_linked_sites", "count": 1 }, { "field": "fuzzy_n_linked_glycan_sites", "count": 1 }, { "field": "fuzzy_n_linked_glycans", "count": 14 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "filter_code", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The amino acid sequence of 'heavy chain disease' protein ZUC. Structure of the Fc fragment of immunoglobulin G3.", "journal": "Biochem. Biophys. Res. Commun.", "date": "1976", "authors": "Wolfenstein-Todel C, Frangione B, Prelli F, Franklin E C", "reference": { "type": "PubMed", "id": "823945", "url": "https://pubmed.ncbi.nlm.nih.gov/823945" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P01860-2", "protein_name": "Immunoglobulin heavy constant gamma 3", "gene_name": "IGHG3", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P01860", "url": "https://www.uniprot.org/uniprotkb/P01860" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.823945", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The resolution of the neutral N-linked oligosaccharides of IgG by high pH anion-exchange chromatography.", "journal": "Carbohydrate research", "date": "1996", "authors": "McGuire JM, Douglas M, Smith KD", "reference": { "type": "PubMed", "id": "8870235", "url": "https://pubmed.ncbi.nlm.nih.gov/8870235" }, "referenced_glycans": [ { "glytoucan_ac": "G89993FE" }, { "glytoucan_ac": "G25520XG" }, { "glytoucan_ac": "G91636VS" }, { "glytoucan_ac": "G81295CK" } ], "referenced_proteins": [ { "uniprot_canonical_ac": "P01860-2", "protein_name": "Immunoglobulin heavy constant gamma 3", "gene_name": "IGHG3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01861-2", "protein_name": "Immunoglobulin heavy constant gamma 4", "gene_name": "IGHG4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01859-2", "protein_name": "Immunoglobulin heavy constant gamma 2", "gene_name": "IGHG2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01857-2", "protein_name": "Immunoglobulin heavy constant gamma 1", "gene_name": "IGHG1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P01860", "url": "https://www.uniprot.org/uniprotkb/P01860" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "glycosylation": [ { "glytoucan_ac": "G25520XG", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "2138613", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/2138613" }, { "id": "233", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/233" }, { "id": "2363690", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/2363690" }, { "id": "1385", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1385" }, { "id": "8870235", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/8870235" }, { "id": "3567160", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/3567160" }, { "id": "12652077", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/12652077" }, { "id": "24680513", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24680513" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0100000.1110000000.010100000001111000.10000.01000", "uniprot_canonical_ac": "P01860-2" }, { "glytoucan_ac": "G81295CK", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "2138613", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/2138613" }, { "id": "233", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/233" }, { "id": "2363690", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/2363690" }, { "id": "1385", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1385" }, { "id": "8870235", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/8870235" }, { "id": "3567160", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/3567160" }, { "id": "11500028", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/11500028" }, { "id": "271", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/271" }, { "id": "12652077", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/12652077" }, { "id": "25685702", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/25685702" }, { "id": "25004930", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/25004930" }, { "id": "23382691", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23382691" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0100000.1100000000.010111100011111101.00010.01000", "uniprot_canonical_ac": "P01860-2" }, { "glytoucan_ac": "G89993FE", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "2138613", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/2138613" }, { "id": "233", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/233" }, { "id": "2363690", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/2363690" }, { "id": "1385", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1385" }, { "id": "8870235", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/8870235" }, { "id": "3567160", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/3567160" }, { "id": "12652077", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/12652077" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0100000.1100000000.010000000001101000.10000.01000", "uniprot_canonical_ac": "P01860-2" }, { "glytoucan_ac": "G91636VS", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "2138613", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/2138613" }, { "id": "233", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/233" }, { "id": "2363690", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/2363690" }, { "id": "1385", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1385" }, { "id": "8870235", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/8870235" }, { "id": "3567160", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/3567160" }, { "id": "12652077", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/12652077" }, { "id": "23382691", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23382691" }, { "id": "25685702", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/25685702" }, { "id": "25004930", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/25004930" }, { "id": "24680513", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24680513" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0100000.1110000000.010111000001111101.00010.01000", "uniprot_canonical_ac": "P01860-2" }, { "glytoucan_ac": "G25520XG", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "2138613", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/2138613" }, { "id": "233", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/233" }, { "id": "2363690", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/2363690" }, { "id": "8870235", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/8870235" }, { "id": "3567160", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/3567160" }, { "id": "12652077", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/12652077" }, { "id": "24680513", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24680513" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0100000.1110000000.010100000001111000.10000.01000", "uniprot_canonical_ac": "P01861-2" }, { "glytoucan_ac": "G81295CK", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "2138613", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/2138613" }, { "id": "233", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/233" }, { "id": "2363690", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/2363690" }, { "id": "8870235", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/8870235" }, { "id": "3567160", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/3567160" }, { "id": "12652077", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/12652077" }, { "id": "25685702", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/25685702" }, { "id": "25004930", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/25004930" }, { "id": "23382691", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23382691" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0100000.1100000000.010111100011111101.00010.01000", "uniprot_canonical_ac": "P01861-2" }, { "glytoucan_ac": "G89993FE", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "2138613", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/2138613" }, { "id": "233", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/233" }, { "id": "2363690", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/2363690" }, { "id": "8870235", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/8870235" }, { "id": "3567160", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/3567160" }, { "id": "12652077", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/12652077" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0100000.1100000000.010000000001101000.10000.01000", "uniprot_canonical_ac": "P01861-2" }, { "glytoucan_ac": "G91636VS", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "2138613", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/2138613" }, { "id": "233", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/233" }, { "id": "2363690", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/2363690" }, { "id": "8870235", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/8870235" }, { "id": "3567160", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/3567160" }, { "id": "12652077", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/12652077" }, { "id": "23382691", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23382691" }, { "id": "25685702", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/25685702" }, { "id": "25004930", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/25004930" }, { "id": "24680513", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24680513" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0100000.1110000000.010111000001111101.00010.01000", "uniprot_canonical_ac": "P01861-2" }, { "glytoucan_ac": "G25520XG", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "2138613", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/2138613" }, { "id": "233", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/233" }, { "id": "2363690", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/2363690" }, { "id": "8870235", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/8870235" }, { "id": "3567160", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/3567160" }, { "id": "12652077", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/12652077" }, { "id": "24680513", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24680513" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0100000.1110000000.010100000001111000.10000.01000", "uniprot_canonical_ac": "P01859-2" }, { "glytoucan_ac": "G81295CK", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "2138613", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/2138613" }, { "id": "233", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/233" }, { "id": "2363690", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/2363690" }, { "id": "8870235", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/8870235" }, { "id": "3567160", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/3567160" }, { "id": "12652077", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/12652077" }, { "id": "25685702", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/25685702" }, { "id": "25004930", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/25004930" }, { "id": "23382691", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23382691" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0100000.1100000000.010111100011111101.00010.01000", "uniprot_canonical_ac": "P01859-2" }, { "glytoucan_ac": "G89993FE", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "2138613", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/2138613" }, { "id": "233", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/233" }, { "id": "2363690", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/2363690" }, { "id": "8870235", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/8870235" }, { "id": "3567160", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/3567160" }, { "id": "12652077", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/12652077" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0100000.1100000000.010000000001101000.10000.01000", "uniprot_canonical_ac": "P01859-2" }, { "glytoucan_ac": "G91636VS", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "2138613", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/2138613" }, { "id": "233", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/233" }, { "id": "2363690", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/2363690" }, { "id": "8870235", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/8870235" }, { "id": "3567160", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/3567160" }, { "id": "12652077", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/12652077" }, { "id": "23382691", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23382691" }, { "id": "25685702", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/25685702" }, { "id": "25004930", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/25004930" }, { "id": "24680513", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24680513" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0100000.1110000000.010111000001111101.00010.01000", "uniprot_canonical_ac": "P01859-2" }, { "glytoucan_ac": "G25520XG", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "2138613", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/2138613" }, { "id": "233", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/233" }, { "id": "2363690", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/2363690" }, { "id": "8870235", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/8870235" }, { "id": "3567160", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/3567160" }, { "id": "12652077", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/12652077" }, { "id": "24680513", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24680513" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0100000.1110000000.010100000001111000.10000.01000", "uniprot_canonical_ac": "P01857-2" }, { "glytoucan_ac": "G81295CK", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "2138613", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/2138613" }, { "id": "233", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/233" }, { "id": "2363690", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/2363690" }, { "id": "8870235", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/8870235" }, { "id": "3567160", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/3567160" }, { "id": "12652077", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/12652077" }, { "id": "25685702", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/25685702" }, { "id": "25004930", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/25004930" }, { "id": "23382691", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23382691" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0100000.1100000000.010111100011111101.00010.01000", "uniprot_canonical_ac": "P01857-2" }, { "glytoucan_ac": "G89993FE", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "2138613", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/2138613" }, { "id": "233", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/233" }, { "id": "2363690", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/2363690" }, { "id": "8870235", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/8870235" }, { "id": "3567160", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/3567160" }, { "id": "12652077", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/12652077" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0100000.1100000000.010000000001101000.10000.01000", "uniprot_canonical_ac": "P01857-2" }, { "glytoucan_ac": "G91636VS", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "2138613", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/2138613" }, { "id": "233", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/233" }, { "id": "2363690", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/2363690" }, { "id": "8870235", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/8870235" }, { "id": "3567160", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/3567160" }, { "id": "12652077", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/12652077" }, { "id": "23382691", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23382691" }, { "id": "25685702", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/25685702" }, { "id": "25004930", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/25004930" }, { "id": "24680513", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24680513" }, { "id": "34834161", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34834161" }, { "id": "2982", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/2982" }, { "id": "2983", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/2983" }, { "id": "2984", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/2984" }, { "id": "2980", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/2980" }, { "id": "2981", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/2981" }, { "id": "2985", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/2985" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0100000.1110000000.010111000001111101.00010.01000", "uniprot_canonical_ac": "P01857-2" } ], "glycan_expression": [ { "glytoucan_ac": "G89993FE", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01860-2" }, { "glytoucan_ac": "G89993FE", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01859-2" }, { "glytoucan_ac": "G89993FE", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01861-2" }, { "glytoucan_ac": "G89993FE", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01857-2" }, { "glytoucan_ac": "G25520XG", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01860-2" }, { "glytoucan_ac": "G25520XG", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01859-2" }, { "glytoucan_ac": "G25520XG", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01861-2" }, { "glytoucan_ac": "G25520XG", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01857-2" }, { "glytoucan_ac": "G91636VS", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01860-2" }, { "glytoucan_ac": "G91636VS", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01859-2" }, { "glytoucan_ac": "G91636VS", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01861-2" }, { "glytoucan_ac": "G91636VS", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01857-2" }, { "glytoucan_ac": "G81295CK", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01860-2" }, { "glytoucan_ac": "G81295CK", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01859-2" }, { "glytoucan_ac": "G81295CK", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01861-2" }, { "glytoucan_ac": "G81295CK", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01857-2" } ], "record_id": "pubmed.8870235", "abstract": "", "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 4 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 4 } ], "sort_fields": [ "glytoucan_ac" ] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 16 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_sites", "count": 1 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 1 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 4 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "exact_sites", "count": 0 }, { "field": "fuzzy_sites", "count": 1 }, { "field": "fuzzy_n_linked_sites", "count": 1 }, { "field": "fuzzy_n_linked_glycan_sites", "count": 1 }, { "field": "fuzzy_n_linked_glycans", "count": 4 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "filter_code", "uniprot_canonical_ac" ] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 16 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_sites", "count": 1 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 1 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 4 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "exact_sites", "count": 0 }, { "field": "fuzzy_sites", "count": 1 }, { "field": "fuzzy_n_linked_sites", "count": 1 }, { "field": "fuzzy_n_linked_glycan_sites", "count": 1 }, { "field": "fuzzy_n_linked_glycans", "count": 4 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "filter_code", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Multiple interactions of IgG with its core oligosaccharide can modulate recognition by complement and human Fc gamma receptor I and influence the synthesis of its oligosaccharide chains.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "1996", "authors": "Lund J, Takahashi N, Pound JD, Goodall M, Jefferis R", "reference": { "type": "PubMed", "id": "8943402", "url": "https://pubmed.ncbi.nlm.nih.gov/8943402" }, "referenced_glycans": [ { "glytoucan_ac": "G58667NI" }, { "glytoucan_ac": "G89993FE" }, { "glytoucan_ac": "G27919IH" }, { "glytoucan_ac": "G36191CD" }, { "glytoucan_ac": "G66937TJ" }, { "glytoucan_ac": "G80858MF" }, { "glytoucan_ac": "G80966KZ" }, { "glytoucan_ac": "G81295CK" }, { "glytoucan_ac": "G06110VR" }, { "glytoucan_ac": "G78059CC" }, { "glytoucan_ac": "G50045TK" }, { "glytoucan_ac": "G46687AB" }, { "glytoucan_ac": "G55220VL" }, { "glytoucan_ac": "G49874UX" }, { "glytoucan_ac": "G39188ZX" }, { "glytoucan_ac": "G39213VZ" }, { "glytoucan_ac": "G23863VK" } ], "referenced_proteins": [ { "uniprot_canonical_ac": "P01860-2", "protein_name": "Immunoglobulin heavy constant gamma 3", "gene_name": "IGHG3", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P01860", "url": "https://www.uniprot.org/uniprotkb/P01860" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "glycosylation": [ { "glytoucan_ac": "G06110VR", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "8943402", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/8943402" }, { "id": "271", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/271" }, { "id": "25685702", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/25685702" }, { "id": "233", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/233" }, { "id": "23382691", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23382691" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0100000.1100000000.110111100011111111.00010.01000", "uniprot_canonical_ac": "P01860-2" }, { "glytoucan_ac": "G23863VK", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "2138613", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/2138613" }, { "id": "233", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/233" }, { "id": "2363690", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/2363690" }, { "id": "1385", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1385" }, { "id": "1639758", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/1639758" }, { "id": "10574203", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/10574203" }, { "id": "3567160", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/3567160" }, { "id": "11500028", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/11500028" }, { "id": "271", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/271" }, { "id": "8943402", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/8943402" }, { "id": "12652077", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/12652077" }, { "id": "25004930", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/25004930" }, { "id": "23382691", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23382691" }, { "id": "25685702", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/25685702" }, { "id": "24680513", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24680513" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0100000.1110000000.010111100011111101.00010.01000", "uniprot_canonical_ac": "P01860-2" }, { "glytoucan_ac": "G27919IH", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "2138613", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/2138613" }, { "id": "233", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/233" }, { "id": "2363690", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/2363690" }, { "id": "1385", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1385" }, { "id": "1639758", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/1639758" }, { "id": "3567160", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/3567160" }, { "id": "8943402", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/8943402" }, { "id": "271", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/271" }, { "id": "12652077", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/12652077" }, { "id": "24680513", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24680513" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0100000.1110000000.010100000001111000.10000.01000", "uniprot_canonical_ac": "P01860-2" }, { "glytoucan_ac": "G36191CD", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "2138613", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/2138613" }, { "id": "233", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/233" }, { "id": "2363690", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/2363690" }, { "id": "1385", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1385" }, { "id": "3567160", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/3567160" }, { "id": "11500028", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/11500028" }, { "id": "271", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/271" }, { "id": "8943402", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/8943402" }, { "id": "12652077", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/12652077" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0100000.1100000000.010100000001111000.10000.01000", "uniprot_canonical_ac": "P01860-2" }, { "glytoucan_ac": "G39188ZX", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "8943402", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/8943402" }, { "id": "271", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/271" }, { "id": "25685702", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/25685702" }, { "id": "233", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/233" }, { "id": "25004930", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/25004930" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0100000.1100000000.111111100011111110.00010.01000", "uniprot_canonical_ac": "P01860-2" }, { "glytoucan_ac": "G46687AB", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "2138613", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/2138613" }, { "id": "233", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/233" }, { "id": "2363690", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/2363690" }, { "id": "1385", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1385" }, { "id": "1639758", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/1639758" }, { "id": "10574203", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/10574203" }, { "id": "3567160", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/3567160" }, { "id": "11500028", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/11500028" }, { "id": "271", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/271" }, { "id": "8943402", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/8943402" }, { "id": "12652077", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/12652077" }, { "id": "25685702", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/25685702" }, { "id": "23382691", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23382691" }, { "id": "24680513", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24680513" }, { "id": "25004930", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/25004930" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0100000.1110000000.010111100011111101.00010.01000", "uniprot_canonical_ac": "P01860-2" }, { "glytoucan_ac": "G49874UX", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "2138613", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/2138613" }, { "id": "233", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/233" }, { "id": "2363690", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/2363690" }, { "id": "1385", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1385" }, { "id": "1639758", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/1639758" }, { "id": "10574203", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/10574203" }, { "id": "3567160", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/3567160" }, { "id": "11500028", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/11500028" }, { "id": "271", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/271" }, { "id": "8943402", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/8943402" }, { "id": "12652077", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/12652077" }, { "id": "25004930", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/25004930" }, { "id": "25685702", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/25685702" }, { "id": "24680513", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24680513" }, { "id": "23382691", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23382691" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0100000.1110000000.010111100011111101.00010.01000", "uniprot_canonical_ac": "P01860-2" }, { "glytoucan_ac": "G50045TK", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "2138613", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/2138613" }, { "id": "233", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/233" }, { "id": "2363690", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/2363690" }, { "id": "1385", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1385" }, { "id": "3567160", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/3567160" }, { "id": "11500028", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/11500028" }, { "id": "271", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/271" }, { "id": "8943402", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/8943402" }, { "id": "12652077", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/12652077" }, { "id": "25685702", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/25685702" }, { "id": "25004930", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/25004930" }, { "id": "23382691", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23382691" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0100000.1100000000.010111100011111101.00010.01000", "uniprot_canonical_ac": "P01860-2" }, { "glytoucan_ac": "G55220VL", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "8943402", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/8943402" }, { "id": "271", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/271" }, { "id": "23382691", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23382691" }, { "id": "233", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/233" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0100000.1100000000.110100100011111110.10000.01000", "uniprot_canonical_ac": "P01860-2" }, { "glytoucan_ac": "G58667NI", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "2138613", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/2138613" }, { "id": "233", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/233" }, { "id": "2363690", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/2363690" }, { "id": "1385", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1385" }, { "id": "1639758", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/1639758" }, { "id": "3567160", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/3567160" }, { "id": "8943402", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/8943402" }, { "id": "271", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/271" }, { "id": "12652077", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/12652077" }, { "id": "24680513", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24680513" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0100000.1110000000.010000000001111000.10000.01000", "uniprot_canonical_ac": "P01860-2" }, { "glytoucan_ac": "G78059CC", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "2138613", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/2138613" }, { "id": "233", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/233" }, { "id": "2363690", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/2363690" }, { "id": "1385", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1385" }, { "id": "1639758", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/1639758" }, { "id": "3567160", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/3567160" }, { "id": "11500028", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/11500028" }, { "id": "271", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/271" }, { "id": "8943402", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/8943402" }, { "id": "12652077", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/12652077" }, { "id": "24680513", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24680513" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0100000.1110000000.010100000001111000.10000.01000", "uniprot_canonical_ac": "P01860-2" }, { "glytoucan_ac": "G80858MF", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "2138613", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/2138613" }, { "id": "233", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/233" }, { "id": "2363690", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/2363690" }, { "id": "1385", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1385" }, { "id": "1639758", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/1639758" }, { "id": "3567160", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/3567160" }, { "id": "11500028", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/11500028" }, { "id": "271", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/271" }, { "id": "8943402", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/8943402" }, { "id": "12652077", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/12652077" }, { "id": "24680513", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24680513" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0100000.1110000000.010100100001111000.10000.01000", "uniprot_canonical_ac": "P01860-2" }, { "glytoucan_ac": "G80966KZ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "8943402", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/8943402" }, { "id": "271", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/271" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0100000.1100000000.110100100001111100.10000.01000", "uniprot_canonical_ac": "P01860-2" } ], "glycan_expression": [ { "glytoucan_ac": "G58667NI", "abundance": "", "tissue": { "name": "ovary", "namespace": "UBERON", "id": "0000992", "url": "http://purl.obolibrary.org/obo/UBERON_0000992" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {} }, { "glytoucan_ac": "G58667NI", "abundance": "", "tissue": { "name": "ovary", "namespace": "UBERON", "id": "0000992", "url": "http://purl.obolibrary.org/obo/UBERON_0000992" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01860-2" }, { "glytoucan_ac": "G89993FE", "abundance": "", "tissue": { "name": "ovary", "namespace": "UBERON", "id": "0000992", "url": "http://purl.obolibrary.org/obo/UBERON_0000992" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {} }, { "glytoucan_ac": "G27919IH", "abundance": "", "tissue": { "name": "ovary", "namespace": "UBERON", "id": "0000992", "url": "http://purl.obolibrary.org/obo/UBERON_0000992" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {} }, { "glytoucan_ac": "G27919IH", "abundance": "", "tissue": { "name": "ovary", "namespace": "UBERON", "id": "0000992", "url": "http://purl.obolibrary.org/obo/UBERON_0000992" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01860-2" }, { "glytoucan_ac": "G36191CD", "abundance": "", "tissue": { "name": "ovary", "namespace": "UBERON", "id": "0000992", "url": "http://purl.obolibrary.org/obo/UBERON_0000992" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {} }, { "glytoucan_ac": "G36191CD", "abundance": "", "tissue": { "name": "ovary", "namespace": "UBERON", "id": "0000992", "url": "http://purl.obolibrary.org/obo/UBERON_0000992" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01860-2" }, { "glytoucan_ac": "G66937TJ", "abundance": "", "tissue": { "name": "ovary", "namespace": "UBERON", "id": "0000992", "url": "http://purl.obolibrary.org/obo/UBERON_0000992" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {} }, { "glytoucan_ac": "G80858MF", "abundance": "", "tissue": { "name": "ovary", "namespace": "UBERON", "id": "0000992", "url": "http://purl.obolibrary.org/obo/UBERON_0000992" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {} }, { "glytoucan_ac": "G80858MF", "abundance": "", "tissue": { "name": "ovary", "namespace": "UBERON", "id": "0000992", "url": "http://purl.obolibrary.org/obo/UBERON_0000992" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01860-2" }, { "glytoucan_ac": "G80966KZ", "abundance": "", "tissue": { "name": "ovary", "namespace": "UBERON", "id": "0000992", "url": "http://purl.obolibrary.org/obo/UBERON_0000992" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {} }, { "glytoucan_ac": "G80966KZ", "abundance": "", "tissue": { "name": "ovary", "namespace": "UBERON", "id": "0000992", "url": "http://purl.obolibrary.org/obo/UBERON_0000992" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01860-2" }, { "glytoucan_ac": "G81295CK", "abundance": "", "tissue": { "name": "ovary", "namespace": "UBERON", "id": "0000992", "url": "http://purl.obolibrary.org/obo/UBERON_0000992" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {} }, { "glytoucan_ac": "G06110VR", "abundance": "", "tissue": { "name": "ovary", "namespace": "UBERON", "id": "0000992", "url": "http://purl.obolibrary.org/obo/UBERON_0000992" }, "species": { "name": "Cricetulus griseus", "taxid": 10029, "reference_species": "Cricetulus griseus [10029]", "common_name": "Chinese hamster", "glygen_name": "Hamster" }, "cell_line": {} }, { "glytoucan_ac": "G06110VR", "abundance": "", "tissue": { "name": "ovary", "namespace": "UBERON", "id": "0000992", "url": "http://purl.obolibrary.org/obo/UBERON_0000992" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01860-2" }, { "glytoucan_ac": "G78059CC", "abundance": "", "tissue": { "name": "ovary", "namespace": "UBERON", "id": "0000992", "url": "http://purl.obolibrary.org/obo/UBERON_0000992" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {} }, { "glytoucan_ac": "G78059CC", "abundance": "", "tissue": { "name": "ovary", "namespace": "UBERON", "id": "0000992", "url": "http://purl.obolibrary.org/obo/UBERON_0000992" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01860-2" }, { "glytoucan_ac": "G50045TK", "abundance": "", "tissue": { "name": "ovary", "namespace": "UBERON", "id": "0000992", "url": "http://purl.obolibrary.org/obo/UBERON_0000992" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {} }, { "glytoucan_ac": "G50045TK", "abundance": "", "tissue": { "name": "ovary", "namespace": "UBERON", "id": "0000992", "url": "http://purl.obolibrary.org/obo/UBERON_0000992" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01860-2" }, { "glytoucan_ac": "G46687AB", "abundance": "", "tissue": { "name": "ovary", "namespace": "UBERON", "id": "0000992", "url": "http://purl.obolibrary.org/obo/UBERON_0000992" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {} }, { "glytoucan_ac": "G46687AB", "abundance": "", "tissue": { "name": "ovary", "namespace": "UBERON", "id": "0000992", "url": "http://purl.obolibrary.org/obo/UBERON_0000992" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01860-2" }, { "glytoucan_ac": "G55220VL", "abundance": "", "tissue": { "name": "ovary", "namespace": "UBERON", "id": "0000992", "url": "http://purl.obolibrary.org/obo/UBERON_0000992" }, "species": { "name": "Cricetulus griseus", "taxid": 10029, "reference_species": "Cricetulus griseus [10029]", "common_name": "Chinese hamster", "glygen_name": "Hamster" }, "cell_line": {} }, { "glytoucan_ac": "G55220VL", "abundance": "", "tissue": { "name": "ovary", "namespace": "UBERON", "id": "0000992", "url": "http://purl.obolibrary.org/obo/UBERON_0000992" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01860-2" }, { "glytoucan_ac": "G49874UX", "abundance": "", "tissue": { "name": "ovary", "namespace": "UBERON", "id": "0000992", "url": "http://purl.obolibrary.org/obo/UBERON_0000992" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {} }, { "glytoucan_ac": "G49874UX", "abundance": "", "tissue": { "name": "ovary", "namespace": "UBERON", "id": "0000992", "url": "http://purl.obolibrary.org/obo/UBERON_0000992" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01860-2" }, { "glytoucan_ac": "G39188ZX", "abundance": "", "tissue": { "name": "ovary", "namespace": "UBERON", "id": "0000992", "url": "http://purl.obolibrary.org/obo/UBERON_0000992" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {} }, { "glytoucan_ac": "G39188ZX", "abundance": "", "tissue": { "name": "ovary", "namespace": "UBERON", "id": "0000992", "url": "http://purl.obolibrary.org/obo/UBERON_0000992" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01860-2" }, { "glytoucan_ac": "G39213VZ", "abundance": "", "tissue": { "name": "ovary", "namespace": "UBERON", "id": "0000992", "url": "http://purl.obolibrary.org/obo/UBERON_0000992" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {} }, { "glytoucan_ac": "G23863VK", "abundance": "", "tissue": { "name": "ovary", "namespace": "UBERON", "id": "0000992", "url": "http://purl.obolibrary.org/obo/UBERON_0000992" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {} }, { "glytoucan_ac": "G23863VK", "abundance": "", "tissue": { "name": "ovary", "namespace": "UBERON", "id": "0000992", "url": "http://purl.obolibrary.org/obo/UBERON_0000992" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01860-2" } ], "record_id": "pubmed.8943402", "abstract": "", "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 17 } ], "sort_fields": [ "glytoucan_ac" ] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 13 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_sites", "count": 1 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 1 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 13 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "exact_sites", "count": 0 }, { "field": "fuzzy_sites", "count": 1 }, { "field": "fuzzy_n_linked_sites", "count": 1 }, { "field": "fuzzy_n_linked_glycan_sites", "count": 1 }, { "field": "fuzzy_n_linked_glycans", "count": 13 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "filter_code", "uniprot_canonical_ac" ] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 13 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_sites", "count": 1 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 1 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 13 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "exact_sites", "count": 0 }, { "field": "fuzzy_sites", "count": 1 }, { "field": "fuzzy_n_linked_sites", "count": 1 }, { "field": "fuzzy_n_linked_glycan_sites", "count": 1 }, { "field": "fuzzy_n_linked_glycans", "count": 13 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "filter_code", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Nucleotide sequences of all the gamma gene loci of murine immunoglobulin heavy chains.", "journal": "Genomics", "date": "1997", "authors": "Akahori Y, Kurosawa Y", "reference": { "type": "PubMed", "id": "9126488", "url": "https://pubmed.ncbi.nlm.nih.gov/9126488" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P01860-2", "protein_name": "Immunoglobulin heavy constant gamma 3", "gene_name": "IGHG3", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P01860", "url": "https://www.uniprot.org/uniprotkb/P01860" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.9126488", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "IgG subclass-independent improvement of antibody-dependent cellular cytotoxicity by fucose removal from Asn297-linked oligosaccharides.", "journal": "Journal of immunological methods", "date": "2005-11-30", "authors": "Niwa Rinpei, Natsume Akito, Uehara Aya, Wakitani Masako, Iida Shigeru, Uchida Kazuhisa, Satoh Mitsuo, Shitara Kenya", "reference": { "type": "PubMed", "id": "16219319", "url": "https://pubmed.ncbi.nlm.nih.gov/16219319" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P01861-2", "protein_name": "Immunoglobulin heavy constant gamma 4", "gene_name": "IGHG4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01857-2", "protein_name": "Immunoglobulin heavy constant gamma 1", "gene_name": "IGHG1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P01861", "url": "https://www.uniprot.org/uniprotkb/P01861" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.16219319", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Changes in antigen-specific IgG1 Fc N-glycosylation upon influenza and tetanus vaccination.", "journal": "Molecular & cellular proteomics : MCP", "date": "2012-04", "authors": "Selman Maurice H J, de Jong Sanne E, Soonawala Darius, Kroon Frank P, Adegnika Ayola Akim, Deelder Andr\u00e9 M, Hokke Cornelis H, Yazdanbakhsh Maria, Wuhrer Manfred", "reference": { "type": "PubMed", "id": "22184099", "url": "https://pubmed.ncbi.nlm.nih.gov/22184099" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P01861-2", "protein_name": "Immunoglobulin heavy constant gamma 4", "gene_name": "IGHG4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01859-2", "protein_name": "Immunoglobulin heavy constant gamma 2", "gene_name": "IGHG2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01857-2", "protein_name": "Immunoglobulin heavy constant gamma 1", "gene_name": "IGHG1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P01861", "url": "https://www.uniprot.org/uniprotkb/P01861" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "glycosylation": [ { "glytoucan_ac": "", "type": "N-linked", "subtype": "Complex", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) (complex) asparagine;Complex", "icn3d_view": {}, "start_pos": 177, "start_aa": "Asn", "end_pos": 177, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn177", "evidence": [ { "id": "P01861", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P01861#ptm_processing" }, { "id": "19159218", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19159218" }, { "id": "11406581", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/11406581" }, { "id": "20357243", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/20357243" }, { "id": "19139490", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19139490" }, { "id": "29133956", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29133956" }, { "id": "22184099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/22184099" }, { "id": "25733881", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/25733881" }, { "id": "39983994", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/39983994" }, { "id": "24190977", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24190977" }, { "id": "GLY_000143", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000143" } ], "filter_code": "001000000000000000000.10000000000000.00.01001", "uniprot_canonical_ac": "P01861-2" }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 176, "start_aa": "Asn", "end_pos": 176, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn176", "evidence": [ { "id": "21609021", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/21609021" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "29671580", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29671580" }, { "id": "P01859", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P01859#ptm_processing" }, { "id": "19159218", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19159218" }, { "id": "11406581", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/11406581" }, { "id": "20357243", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/20357243" }, { "id": "19139490", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19139490" }, { "id": "15084671", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/15084671" }, { "id": "29133956", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29133956" }, { "id": "22184099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/22184099" }, { "id": "39983994", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/39983994" }, { "id": "25733881", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/25733881" }, { "id": "24190977", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24190977" }, { "id": "GLY_000143", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000143" } ], "filter_code": "001000000000000000000.00010000000000.00.01001", "uniprot_canonical_ac": "P01859-2" }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": { "label": "iCn3D", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?bcifid=4ACP&bu=0&command=select+.B:297;+center+selection;+zoom+selection" }, "start_pos": 180, "start_aa": "Asn", "end_pos": 180, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn180", "evidence": [ { "id": "21609021", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/21609021" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "P01857", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P01857#ptm_processing" }, { "id": "19159218", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19159218" }, { "id": "19358553", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19358553" }, { "id": "11406581", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/11406581" }, { "id": "20357243", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/20357243" }, { "id": "19139490", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19139490" }, { "id": "29133956", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29133956" }, { "id": "26140596", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/26140596" }, { "id": "22184099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/22184099" }, { "id": "29445378", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29445378" }, { "id": "39983994", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/39983994" }, { "id": "36529104", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/36529104" }, { "id": "10917521", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/10917521" }, { "id": "10818239", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/10818239" }, { "id": "1E4K", "database": "PDB", "url": "https://www.rcsb.org/sequence/1E4K" }, { "id": "25733881", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/25733881" }, { "id": "25561553", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/25561553" }, { "id": "21768335", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/21768335" }, { "id": "3SGJ", "database": "PDB", "url": "https://www.rcsb.org/sequence/3SGJ" }, { "id": "4X4M", "database": "PDB", "url": "https://www.rcsb.org/sequence/4X4M" }, { "id": "3SGK", "database": "PDB", "url": "https://www.rcsb.org/sequence/3SGK" }, { "id": "24190977", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24190977" }, { "id": "GLY_000143", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000143" }, { "id": "P01857@N180", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P01857@N180" }, { "id": "4ACP", "database": "PDB", "url": "https://www.rcsb.org/structure/4ACP" }, { "id": "7Q3P", "database": "PDB", "url": "https://www.rcsb.org/structure/7Q3P" } ], "filter_code": "001000000000000000000.00010000000000.00.01101", "uniprot_canonical_ac": "P01857-2" } ], "record_id": "pubmed.22184099", "abstract": "", "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 3 }, { "field": "total_sites", "count": 3 }, { "field": "n_linked_sites", "count": 3 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "exact_sites", "count": 3 }, { "field": "exact_n_linked_sites", "count": 3 }, { "field": "fuzzy_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl", "filter_code", "uniprot_canonical_ac", "icn3d_view.label", "icn3d_view.url" ] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 3 }, { "field": "total_sites", "count": 3 }, { "field": "n_linked_sites", "count": 3 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "exact_sites", "count": 3 }, { "field": "exact_n_linked_sites", "count": 3 }, { "field": "fuzzy_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl", "filter_code", "uniprot_canonical_ac", "icn3d_view.label", "icn3d_view.url" ] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Staphylococcal protein A inhibits complement activation by interfering with IgG hexamer formation.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2021-02-16", "authors": "Cruz Ana Rita, Boer Maurits A den, Strasser J\u00fcrgen, Zwarthoff Seline A, Beurskens Frank J, de Haas Carla J C, Aerts Piet C, Wang Guanbo, de Jong Rob N, Bagnoli Fabio, van Strijp Jos A G, van Kessel Kok P M, Schuurman Janine, Preiner Johannes, Heck Albert J R, Rooijakkers Suzan H M", "reference": { "type": "PubMed", "id": "33563762", "url": "https://pubmed.ncbi.nlm.nih.gov/33563762" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P01861-2", "protein_name": "Immunoglobulin heavy constant gamma 4", "gene_name": "IGHG4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01859-2", "protein_name": "Immunoglobulin heavy constant gamma 2", "gene_name": "IGHG2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01857-2", "protein_name": "Immunoglobulin heavy constant gamma 1", "gene_name": "IGHG1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P01861", "url": "https://www.uniprot.org/uniprotkb/P01861" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 225, "end_pos": 225, "sequence_org": "E", "sequence_mut": "R", "comment": "Spontaneously forms hexameric Ig structures in solution in the absence of antigen; when associated with R-310 and Y-320.", "evidence": [ { "database": "UniProtKB", "id": "P01861", "url": "https://www.uniprot.org/uniprotkb/P01861" }, { "database": "PubMed", "id": "33563762", "url": "https://pubmed.ncbi.nlm.nih.gov/33563762" } ], "uniprot_canonical_ac": "P01861-2" }, { "start_pos": 310, "end_pos": 310, "sequence_org": "E", "sequence_mut": "R", "comment": "Spontaneously forms hexameric Ig structures in solution in the absence of antigen; when associated with R-225 and Y-320.", "evidence": [ { "database": "UniProtKB", "id": "P01861", "url": "https://www.uniprot.org/uniprotkb/P01861" }, { "database": "PubMed", "id": "33563762", "url": "https://pubmed.ncbi.nlm.nih.gov/33563762" } ], "uniprot_canonical_ac": "P01861-2" }, { "start_pos": 320, "end_pos": 320, "sequence_org": "S", "sequence_mut": "Y", "comment": "Spontaneously forms hexameric Ig structures in solution in the absence of antigen; when associated with R-225 and R-310.", "evidence": [ { "database": "UniProtKB", "id": "P01861", "url": "https://www.uniprot.org/uniprotkb/P01861" }, { "database": "PubMed", "id": "33563762", "url": "https://pubmed.ncbi.nlm.nih.gov/33563762" } ], "uniprot_canonical_ac": "P01861-2" }, { "start_pos": 224, "end_pos": 224, "sequence_org": "E", "sequence_mut": "R", "comment": "Spontaneously forms hexameric Ig structures in solution in the absence of antigen; when associated with R-309 and Y-319.", "evidence": [ { "database": "UniProtKB", "id": "P01859", "url": "https://www.uniprot.org/uniprotkb/P01859" }, { "database": "PubMed", "id": "33563762", "url": "https://pubmed.ncbi.nlm.nih.gov/33563762" } ], "uniprot_canonical_ac": "P01859-2" }, { "start_pos": 309, "end_pos": 309, "sequence_org": "E", "sequence_mut": "R", "comment": "Spontaneously forms hexameric Ig structures in solution in the absence of antigen; when associated with R-224 and Y-319.", "evidence": [ { "database": "UniProtKB", "id": "P01859", "url": "https://www.uniprot.org/uniprotkb/P01859" }, { "database": "PubMed", "id": "33563762", "url": "https://pubmed.ncbi.nlm.nih.gov/33563762" } ], "uniprot_canonical_ac": "P01859-2" }, { "start_pos": 319, "end_pos": 319, "sequence_org": "S", "sequence_mut": "Y", "comment": "Spontaneously forms hexameric Ig structures in solution in the absence of antigen; when associated with R-224 and R-309.", "evidence": [ { "database": "UniProtKB", "id": "P01859", "url": "https://www.uniprot.org/uniprotkb/P01859" }, { "database": "PubMed", "id": "33563762", "url": "https://pubmed.ncbi.nlm.nih.gov/33563762" } ], "uniprot_canonical_ac": "P01859-2" }, { "start_pos": 228, "end_pos": 228, "sequence_org": "E", "sequence_mut": "R", "comment": "Spontaneously forms hexameric Ig structures in solution in the absence of antigen; when associated with R-313 and Y-323.", "evidence": [ { "database": "UniProtKB", "id": "P01857", "url": "https://www.uniprot.org/uniprotkb/P01857" }, { "database": "PubMed", "id": "33563762", "url": "https://pubmed.ncbi.nlm.nih.gov/33563762" } ], "uniprot_canonical_ac": "P01857-2" }, { "start_pos": 313, "end_pos": 313, "sequence_org": "E", "sequence_mut": "R", "comment": "Spontaneously forms hexameric Ig structures in solution in the absence of antigen; when associated with R-228 and Y-323.", "evidence": [ { "database": "UniProtKB", "id": "P01857", "url": "https://www.uniprot.org/uniprotkb/P01857" }, { "database": "PubMed", "id": "33563762", "url": "https://pubmed.ncbi.nlm.nih.gov/33563762" } ], "uniprot_canonical_ac": "P01857-2" }, { "start_pos": 323, "end_pos": 323, "sequence_org": "S", "sequence_mut": "Y", "comment": "Spontaneously forms hexameric Ig structures in solution in the absence of antigen; when associated with R-228 and R-313.", "evidence": [ { "database": "UniProtKB", "id": "P01857", "url": "https://www.uniprot.org/uniprotkb/P01857" }, { "database": "PubMed", "id": "33563762", "url": "https://pubmed.ncbi.nlm.nih.gov/33563762" } ], "uniprot_canonical_ac": "P01857-2" } ], "record_id": "pubmed.33563762", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The unique properties of IgG4 and its roles in health and disease.", "journal": "Nature reviews. Immunology", "date": "2023-11", "authors": "Rispens Theo, Huijbers Maartje G", "reference": { "type": "PubMed", "id": "37095254", "url": "https://pubmed.ncbi.nlm.nih.gov/37095254" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P01861-2", "protein_name": "Immunoglobulin heavy constant gamma 4", "gene_name": "IGHG4", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P01861", "url": "https://www.uniprot.org/uniprotkb/P01861" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.37095254", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Human immunoglobulin subclasses. Partial amino acid sequence of the constant region of a gamma 4 chain.", "journal": "Biochem. J.", "date": "1970", "authors": "Pink J R, Buttery S H, De Vries G M, Milstein C", "reference": { "type": "PubMed", "id": "4192699", "url": "https://pubmed.ncbi.nlm.nih.gov/4192699" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P01861-2", "protein_name": "Immunoglobulin heavy constant gamma 4", "gene_name": "IGHG4", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P01861", "url": "https://www.uniprot.org/uniprotkb/P01861" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.4192699", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Nucleotide sequence of a human immunoglobulin C gamma 4 gene.", "journal": "DNA", "date": "1981", "authors": "Ellison J, Buxbaum J, Hood L", "reference": { "type": "PubMed", "id": "6299662", "url": "https://pubmed.ncbi.nlm.nih.gov/6299662" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P01861-2", "protein_name": "Immunoglobulin heavy constant gamma 4", "gene_name": "IGHG4", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P01861", "url": "https://www.uniprot.org/uniprotkb/P01861" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.6299662", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Evidence for a site-specific fucosylation of N-linked oligosaccharide of immunoglobulin A1 from normal human serum.", "journal": "Glycoconjugate journal", "date": "1998", "authors": "Tanaka A, Iwase H, Hiki Y, Kokubo T, Ishii-Karakasa I, Toma K, Kobayashi Y, Hotta K", "reference": { "type": "PubMed", "id": "10211705", "url": "https://pubmed.ncbi.nlm.nih.gov/10211705" }, "referenced_glycans": [ { "glytoucan_ac": "G20425TQ" }, { "glytoucan_ac": "G36191CD" }, { "glytoucan_ac": "G25520XG" }, { "glytoucan_ac": "G91636VS" }, { "glytoucan_ac": "G78059CC" }, { "glytoucan_ac": "G50045TK" }, { "glytoucan_ac": "G29857RC" }, { "glytoucan_ac": "G23863VK" } ], "referenced_proteins": [ { "uniprot_canonical_ac": "P01876-2", "protein_name": "Immunoglobulin heavy constant alpha 1", "gene_name": "IGHA1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P01876", "url": "https://www.uniprot.org/uniprotkb/P01876" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "glycosylation": [ { "glytoucan_ac": "G20425TQ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "10211705", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/10211705" }, { "id": "230", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/230" }, { "id": "17050773", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/17050773" }, { "id": "227", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/227" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0010000.1100000000.010111000011111100.00010.01000", "uniprot_canonical_ac": "P01876-2" }, { "glytoucan_ac": "G23863VK", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "10211705", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/10211705" }, { "id": "230", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/230" }, { "id": "17050773", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/17050773" }, { "id": "227", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/227" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0100000.1110000000.010111100011111101.00010.01000", "uniprot_canonical_ac": "P01876-2" }, { "glytoucan_ac": "G25520XG", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "10211705", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/10211705" }, { "id": "230", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/230" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0100000.1110000000.010100000001111000.10000.01000", "uniprot_canonical_ac": "P01876-2" }, { "glytoucan_ac": "G29857RC", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "10211705", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/10211705" }, { "id": "230", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/230" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0010000.1100000000.010100000001101000.10000.01000", "uniprot_canonical_ac": "P01876-2" }, { "glytoucan_ac": "G36191CD", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "10211705", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/10211705" }, { "id": "230", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/230" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0100000.1100000000.010100000001111000.10000.01000", "uniprot_canonical_ac": "P01876-2" }, { "glytoucan_ac": "G50045TK", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "10211705", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/10211705" }, { "id": "230", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/230" }, { "id": "17050773", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/17050773" }, { "id": "227", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/227" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0100000.1100000000.010111100011111101.00010.01000", "uniprot_canonical_ac": "P01876-2" }, { "glytoucan_ac": "G78059CC", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "10211705", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/10211705" }, { "id": "230", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/230" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0100000.1110000000.010100000001111000.10000.01000", "uniprot_canonical_ac": "P01876-2" }, { "glytoucan_ac": "G91636VS", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "10211705", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/10211705" }, { "id": "230", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/230" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0100000.1110000000.010111000001111101.00010.01000", "uniprot_canonical_ac": "P01876-2" } ], "glycan_expression": [ { "glytoucan_ac": "G20425TQ", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01876-2" }, { "glytoucan_ac": "G36191CD", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01876-2" }, { "glytoucan_ac": "G25520XG", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01876-2" }, { "glytoucan_ac": "G91636VS", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01876-2" }, { "glytoucan_ac": "G78059CC", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01876-2" }, { "glytoucan_ac": "G50045TK", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01876-2" }, { "glytoucan_ac": "G29857RC", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01876-2" }, { "glytoucan_ac": "G23863VK", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01876-2" } ], "record_id": "pubmed.10211705", "abstract": "", "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 8 } ], "sort_fields": [ "glytoucan_ac" ] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 8 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_sites", "count": 1 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 1 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 8 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "exact_sites", "count": 0 }, { "field": "fuzzy_sites", "count": 1 }, { "field": "fuzzy_n_linked_sites", "count": 1 }, { "field": "fuzzy_n_linked_glycan_sites", "count": 1 }, { "field": "fuzzy_n_linked_glycans", "count": 8 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "filter_code", "uniprot_canonical_ac" ] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 8 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_sites", "count": 1 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 1 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 8 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "exact_sites", "count": 0 }, { "field": "fuzzy_sites", "count": 1 }, { "field": "fuzzy_n_linked_sites", "count": 1 }, { "field": "fuzzy_n_linked_glycan_sites", "count": 1 }, { "field": "fuzzy_n_linked_glycans", "count": 8 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "filter_code", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Primary structure of a human IgA1 immunoglobulin. IV. Streptococcal IgA1 protease, digestion, Fab and Fc fragments, and the complete amino acid sequence of the alpha 1 heavy chain.", "journal": "J. Biol. Chem.", "date": "1979", "authors": "Putnam FW, Liu YS, Low TL", "reference": { "type": "PubMed", "id": "107164", "url": "https://pubmed.ncbi.nlm.nih.gov/107164" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P01876-2", "protein_name": "Immunoglobulin heavy constant alpha 1", "gene_name": "IGHA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01768-1", "protein_name": "Immunoglobulin heavy variable 3-30", "gene_name": "IGHV3-30", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P01876", "url": "https://www.uniprot.org/uniprotkb/P01876" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.107164", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Analysis of glycoform of O-glycan from human myeloma immunoglobulin A1 by gas-phase hydrazinolysis following pyridylamination of oligosaccharides.", "journal": "Analytical biochemistry", "date": "1992", "authors": "Iwase H, Ishii-Karakasa I, Fujii E, Hotta K, Hiki Y, Kobayashi Y", "reference": { "type": "PubMed", "id": "1280920", "url": "https://pubmed.ncbi.nlm.nih.gov/1280920" }, "referenced_glycans": [ { "glytoucan_ac": "G00031MO" }, { "glytoucan_ac": "G65562ZE" }, { "glytoucan_ac": "G74722FL" }, { "glytoucan_ac": "G81006GJ" }, { "glytoucan_ac": "G01614ZM" }, { "glytoucan_ac": "G29931IJ" } ], "referenced_proteins": [ { "uniprot_canonical_ac": "P01876-2", "protein_name": "Immunoglobulin heavy constant alpha 1", "gene_name": "IGHA1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P01876", "url": "https://www.uniprot.org/uniprotkb/P01876" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "glycosylation": [ { "glytoucan_ac": "G00031MO", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "1280920", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/1280920" }, { "id": "230", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/230" }, { "id": "2628063", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/2628063" }, { "id": "9442070", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/9442070" }, { "id": "7215351", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/7215351" }, { "id": "20030399", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/20030399" } ], "filter_code": "000000000000000000000.0000000.00000000001000.1000000.1100000000.010100100011111100.10000.01000", "uniprot_canonical_ac": "P01876-2" }, { "glytoucan_ac": "G01614ZM", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "1280920", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/1280920" }, { "id": "230", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/230" }, { "id": "2628063", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/2628063" }, { "id": "9442070", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/9442070" } ], "filter_code": "000000000000000000000.0000000.00000000001000.1000000.1100100000.010000000011111001.10000.01000", "uniprot_canonical_ac": "P01876-2" }, { "glytoucan_ac": "G29931IJ", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "40667337", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/40667337" }, { "id": "TP5868669", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP5868669" }, { "id": "1280920", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/1280920" }, { "id": "230", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/230" }, { "id": "2628063", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/2628063" }, { "id": "9442070", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/9442070" }, { "id": "7215351", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/7215351" }, { "id": "4373463", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/4373463" }, { "id": "20030399", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/20030399" } ], "filter_code": "000000000000000000000.0000000.00000000001000.1000000.1100000000.110100100011111100.00010.01000", "uniprot_canonical_ac": "P01876-2" }, { "glytoucan_ac": "G65562ZE", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "1280920", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/1280920" }, { "id": "230", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/230" }, { "id": "2628063", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/2628063" }, { "id": "9442070", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/9442070" }, { "id": "7215351", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/7215351" } ], "filter_code": "000000000000000000000.0000000.00000000001000.1000000.1100100000.010100000011111011.10000.01000", "uniprot_canonical_ac": "P01876-2" }, { "glytoucan_ac": "G74722FL", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "40667337", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/40667337" }, { "id": "TP5868669", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP5868669" }, { "id": "1280920", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/1280920" }, { "id": "230", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/230" }, { "id": "2628063", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/2628063" }, { "id": "9442070", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/9442070" }, { "id": "7215351", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/7215351" }, { "id": "20030399", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/20030399" } ], "filter_code": "000000000000000000000.0000000.00000000001000.1000000.1100100000.010100000011111111.00100.01000", "uniprot_canonical_ac": "P01876-2" }, { "glytoucan_ac": "G81006GJ", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "40667337", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/40667337" }, { "id": "TP5868669", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP5868669" }, { "id": "1280920", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/1280920" }, { "id": "230", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/230" }, { "id": "2628063", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/2628063" }, { "id": "9442070", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/9442070" }, { "id": "20030399", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/20030399" } ], "filter_code": "000000000000000000000.0000000.00000000001000.1000000.1100100000.010000000011111101.00100.01000", "uniprot_canonical_ac": "P01876-2" } ], "glycan_expression": [ { "glytoucan_ac": "G00031MO", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01876-2" }, { "glytoucan_ac": "G65562ZE", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01876-2" }, { "glytoucan_ac": "G74722FL", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01876-2" }, { "glytoucan_ac": "G81006GJ", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01876-2" }, { "glytoucan_ac": "G01614ZM", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01876-2" }, { "glytoucan_ac": "G29931IJ", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01876-2" } ], "record_id": "pubmed.1280920", "abstract": "", "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 6 } ], "sort_fields": [ "glytoucan_ac" ] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 6 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 1 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 6 }, { "field": "exact_sites", "count": 0 }, { "field": "fuzzy_sites", "count": 1 }, { "field": "fuzzy_o_linked_sites", "count": 1 }, { "field": "fuzzy_o_linked_glycan_sites", "count": 1 }, { "field": "fuzzy_o_linked_glycans", "count": 6 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "filter_code", "uniprot_canonical_ac" ] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 6 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 1 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 6 }, { "field": "exact_sites", "count": 0 }, { "field": "fuzzy_sites", "count": 1 }, { "field": "fuzzy_o_linked_sites", "count": 1 }, { "field": "fuzzy_o_linked_glycan_sites", "count": 1 }, { "field": "fuzzy_o_linked_glycans", "count": 6 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "filter_code", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Differential glycosylation of polymeric and monomeric IgA: a possible role in glomerular inflammation in IgA nephropathy.", "journal": "Journal of the American Society of Nephrology : JASN", "date": "2006", "authors": "Oortwijn BD, Roos A, Royle L, van Gijlswijk-Janssen DJ, Faber-Krol MC, Eijgenraam JW, Dwek RA, Daha MR, Rudd PM, van Kooten C", "reference": { "type": "PubMed", "id": "17050773", "url": "https://pubmed.ncbi.nlm.nih.gov/17050773" }, "referenced_glycans": [ { "glytoucan_ac": "G79568CQ" }, { "glytoucan_ac": "G42358LZ" }, { "glytoucan_ac": "G43157UW" }, { "glytoucan_ac": "G26403SG" }, { "glytoucan_ac": "G20425TQ" }, { "glytoucan_ac": "G36131WL" }, { "glytoucan_ac": "G65219TP" }, { "glytoucan_ac": "G37868ZX" }, { "glytoucan_ac": "G91473PK" }, { "glytoucan_ac": "G81295CK" }, { "glytoucan_ac": "G05850WN" }, { "glytoucan_ac": "G06110VR" }, { "glytoucan_ac": "G06356OH" }, { "glytoucan_ac": "G84452RH" }, { "glytoucan_ac": "G22140GZ" }, { "glytoucan_ac": "G22310AV" }, { "glytoucan_ac": "G33780DA" }, { "glytoucan_ac": "G57818FI" }, { "glytoucan_ac": "G02030ZB" }, { "glytoucan_ac": "G08146BT" }, { "glytoucan_ac": "G50045TK" }, { "glytoucan_ac": "G46687AB" }, { "glytoucan_ac": "G55052CN" }, { "glytoucan_ac": "G55220VL" }, { "glytoucan_ac": "G48414YA" }, { "glytoucan_ac": "G45495MK" }, { "glytoucan_ac": "G39619TI" }, { "glytoucan_ac": "G23432EQ" }, { "glytoucan_ac": "G23863VK" }, { "glytoucan_ac": "G75798PH" }, { "glytoucan_ac": "G31936TA" }, { "glytoucan_ac": "G61937QU" } ], "referenced_proteins": [ { "uniprot_canonical_ac": "P01876-2", "protein_name": "Immunoglobulin heavy constant alpha 1", "gene_name": "IGHA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01877-2", "protein_name": "Immunoglobulin heavy constant alpha 2", "gene_name": "IGHA2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P01876", "url": "https://www.uniprot.org/uniprotkb/P01876" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "glycosylation": [ { "glytoucan_ac": "G02030ZB", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "17050773", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/17050773" }, { "id": "227", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/227" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0010000.1110100000.000111000001111101.00100.01000", "uniprot_canonical_ac": "P01876-2" }, { "glytoucan_ac": "G05850WN", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "17050773", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/17050773" }, { "id": "227", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/227" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0010000.1110100000.000100000001001100.00001.01000", "uniprot_canonical_ac": "P01876-2" }, { "glytoucan_ac": "G06110VR", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "17050773", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/17050773" }, { "id": "227", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/227" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0100000.1100000000.110111100011111111.00010.01000", "uniprot_canonical_ac": "P01876-2" }, { "glytoucan_ac": "G06356OH", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "17050773", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/17050773" }, { "id": "227", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/227" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0100000.1100100000.010111000011111101.00100.01000", "uniprot_canonical_ac": "P01876-2" }, { "glytoucan_ac": "G08146BT", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "17050773", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/17050773" }, { "id": "227", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/227" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0010000.1110100000.010100000011111100.00001.01000", "uniprot_canonical_ac": "P01876-2" }, { "glytoucan_ac": "G20425TQ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "10211705", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/10211705" }, { "id": "230", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/230" }, { "id": "17050773", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/17050773" }, { "id": "227", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/227" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0010000.1100000000.010111000011111100.00010.01000", "uniprot_canonical_ac": "P01876-2" }, { "glytoucan_ac": "G22140GZ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "17050773", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/17050773" }, { "id": "227", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/227" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0100000.1100000000.010100000001111100.00001.01000", "uniprot_canonical_ac": "P01876-2" }, { "glytoucan_ac": "G22310AV", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "4436308", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/4436308" }, { "id": "230", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/230" }, { "id": "4172099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/4172099" }, { "id": "227", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/227" }, { "id": "17050773", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/17050773" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0010000.1110100000.010111000011111101.00100.01000", "uniprot_canonical_ac": "P01876-2" }, { "glytoucan_ac": "G23432EQ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "17050773", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/17050773" }, { "id": "227", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/227" }, { "id": "20030399", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/20030399" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0100000.1100000000.010111000001101100.00010.01000", "uniprot_canonical_ac": "P01876-2" }, { "glytoucan_ac": "G23863VK", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "10211705", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/10211705" }, { "id": "230", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/230" }, { "id": "17050773", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/17050773" }, { "id": "227", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/227" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0100000.1110000000.010111100011111101.00010.01000", "uniprot_canonical_ac": "P01876-2" }, { "glytoucan_ac": "G26403SG", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "4436308", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/4436308" }, { "id": "230", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/230" }, { "id": "17050773", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/17050773" }, { "id": "227", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/227" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0010000.1100100000.000011000001001100.00100.01000", "uniprot_canonical_ac": "P01876-2" }, { "glytoucan_ac": "G31936TA", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "17050773", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/17050773" }, { "id": "227", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/227" }, { "id": "20030399", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/20030399" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0100000.1100000000.010111100001111100.00010.01000", "uniprot_canonical_ac": "P01876-2" }, { "glytoucan_ac": "G33780DA", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "17050773", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/17050773" }, { "id": "227", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/227" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0010000.1100100000.000000000001001000.00001.01000", "uniprot_canonical_ac": "P01876-2" }, { "glytoucan_ac": "G36131WL", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "17050773", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/17050773" }, { "id": "227", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/227" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0010000.1100000000.010100000001101000.00001.01000", "uniprot_canonical_ac": "P01876-2" }, { "glytoucan_ac": "G37868ZX", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "17050773", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/17050773" }, { "id": "227", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/227" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0100000.1100100000.010100000001011100.00001.01000", "uniprot_canonical_ac": "P01876-2" }, { "glytoucan_ac": "G39619TI", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "17050773", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/17050773" }, { "id": "227", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/227" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0010000.1100000000.010101000001101100.00010.01000", "uniprot_canonical_ac": "P01876-2" }, { "glytoucan_ac": "G42358LZ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "17050773", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/17050773" }, { "id": "227", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/227" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0010000.1100100000.010100000001111100.00001.01000", "uniprot_canonical_ac": "P01876-2" }, { "glytoucan_ac": "G43157UW", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "17050773", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/17050773" }, { "id": "227", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/227" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0100000.1100000000.010100000001111100.00001.01000", "uniprot_canonical_ac": "P01876-2" }, { "glytoucan_ac": "G45495MK", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "17050773", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/17050773" }, { "id": "227", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/227" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0010000.1110100000.010100000011111100.00001.01000", "uniprot_canonical_ac": "P01876-2" }, { "glytoucan_ac": "G46687AB", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "2737211", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/2737211" }, { "id": "230", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/230" }, { "id": "17050773", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/17050773" }, { "id": "227", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/227" } ], "filter_code": "000000000000000000000.0000000.00000000001000.0100000.1110000000.010111100011111101.00010.01000", "uniprot_canonical_ac": "P01876-2" }, { "glytoucan_ac": "G48414YA", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "17050773", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/17050773" }, { "id": "227", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/227" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0010000.1100100000.010111000011111100.00100.01000", "uniprot_canonical_ac": "P01876-2" }, { "glytoucan_ac": "G50045TK", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "10211705", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/10211705" }, { "id": "230", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/230" }, { "id": "17050773", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/17050773" }, { "id": "227", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/227" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0100000.1100000000.010111100011111101.00010.01000", "uniprot_canonical_ac": "P01876-2" }, { "glytoucan_ac": "G55052CN", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "17050773", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/17050773" }, { "id": "227", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/227" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0100000.1100000000.010100000001001000.00001.01000", "uniprot_canonical_ac": "P01876-2" }, { "glytoucan_ac": "G55220VL", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "17050773", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/17050773" }, { "id": "227", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/227" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0100000.1100000000.110100100011111110.10000.01000", "uniprot_canonical_ac": "P01876-2" }, { "glytoucan_ac": "G57818FI", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "17050773", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/17050773" }, { "id": "227", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/227" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0100000.1110000000.010100000001111100.00001.01000", "uniprot_canonical_ac": "P01876-2" }, { "glytoucan_ac": "G61937QU", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "17050773", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/17050773" }, { "id": "227", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/227" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0100000.1110000000.010100000001111100.00001.01000", "uniprot_canonical_ac": "P01876-2" }, { "glytoucan_ac": "G65219TP", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "17050773", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/17050773" }, { "id": "227", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/227" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0010000.1110100000.000100000001101000.00001.01000", "uniprot_canonical_ac": "P01876-2" }, { "glytoucan_ac": "G75798PH", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "17050773", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/17050773" }, { "id": "227", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/227" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0100000.1100000000.010000000001101000.00001.01000", "uniprot_canonical_ac": "P01876-2" }, { "glytoucan_ac": "G79568CQ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "17050773", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/17050773" }, { "id": "227", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/227" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0100000.1100000000.010111000001111100.00010.01000", "uniprot_canonical_ac": "P01876-2" }, { "glytoucan_ac": "G81295CK", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "2737211", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/2737211" }, { "id": "230", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/230" }, { "id": "17050773", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/17050773" }, { "id": "227", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/227" } ], "filter_code": "000000000000000000000.0000000.00000000001000.0100000.1100000000.010111100011111101.00010.01000", "uniprot_canonical_ac": "P01876-2" }, { "glytoucan_ac": "G84452RH", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "17050773", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/17050773" }, { "id": "227", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/227" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0010000.1110100000.010111000011111101.00100.01000", "uniprot_canonical_ac": "P01876-2" }, { "glytoucan_ac": "G91473PK", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "17050773", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/17050773" }, { "id": "227", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/227" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0010000.1110100000.000110000001101100.00100.01000", "uniprot_canonical_ac": "P01876-2" }, { "glytoucan_ac": "G02030ZB", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "17050773", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/17050773" }, { "id": "227", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/227" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0010000.1110100000.000111000001111101.00100.01000", "uniprot_canonical_ac": "P01877-2" }, { "glytoucan_ac": "G05850WN", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "17050773", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/17050773" }, { "id": "227", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/227" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0010000.1110100000.000100000001001100.00001.01000", "uniprot_canonical_ac": "P01877-2" }, { "glytoucan_ac": "G06110VR", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "17050773", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/17050773" }, { "id": "227", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/227" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0100000.1100000000.110111100011111111.00010.01000", "uniprot_canonical_ac": "P01877-2" }, { "glytoucan_ac": "G06356OH", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "17050773", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/17050773" }, { "id": "227", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/227" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0100000.1100100000.010111000011111101.00100.01000", "uniprot_canonical_ac": "P01877-2" }, { "glytoucan_ac": "G08146BT", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "17050773", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/17050773" }, { "id": "227", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/227" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0010000.1110100000.010100000011111100.00001.01000", "uniprot_canonical_ac": "P01877-2" }, { "glytoucan_ac": "G20425TQ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "17050773", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/17050773" }, { "id": "227", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/227" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0010000.1100000000.010111000011111100.00010.01000", "uniprot_canonical_ac": "P01877-2" }, { "glytoucan_ac": "G22140GZ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "17050773", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/17050773" }, { "id": "227", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/227" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0100000.1100000000.010100000001111100.00001.01000", "uniprot_canonical_ac": "P01877-2" }, { "glytoucan_ac": "G22310AV", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "4172099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/4172099" }, { "id": "227", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/227" }, { "id": "17050773", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/17050773" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0010000.1110100000.010111000011111101.00100.01000", "uniprot_canonical_ac": "P01877-2" }, { "glytoucan_ac": "G23432EQ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "17050773", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/17050773" }, { "id": "227", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/227" }, { "id": "20030399", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/20030399" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0100000.1100000000.010111000001101100.00010.01000", "uniprot_canonical_ac": "P01877-2" }, { "glytoucan_ac": "G23863VK", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "17050773", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/17050773" }, { "id": "227", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/227" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0100000.1110000000.010111100011111101.00010.01000", "uniprot_canonical_ac": "P01877-2" }, { "glytoucan_ac": "G26403SG", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "17050773", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/17050773" }, { "id": "227", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/227" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0010000.1100100000.000011000001001100.00100.01000", "uniprot_canonical_ac": "P01877-2" }, { "glytoucan_ac": "G31936TA", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "17050773", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/17050773" }, { "id": "227", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/227" }, { "id": "20030399", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/20030399" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0100000.1100000000.010111100001111100.00010.01000", "uniprot_canonical_ac": "P01877-2" }, { "glytoucan_ac": "G33780DA", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "17050773", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/17050773" }, { "id": "227", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/227" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0010000.1100100000.000000000001001000.00001.01000", "uniprot_canonical_ac": "P01877-2" }, { "glytoucan_ac": "G36131WL", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "17050773", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/17050773" }, { "id": "227", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/227" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0010000.1100000000.010100000001101000.00001.01000", "uniprot_canonical_ac": "P01877-2" }, { "glytoucan_ac": "G37868ZX", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "17050773", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/17050773" }, { "id": "227", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/227" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0100000.1100100000.010100000001011100.00001.01000", "uniprot_canonical_ac": "P01877-2" }, { "glytoucan_ac": "G39619TI", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "17050773", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/17050773" }, { "id": "227", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/227" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0010000.1100000000.010101000001101100.00010.01000", "uniprot_canonical_ac": "P01877-2" }, { "glytoucan_ac": "G42358LZ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "17050773", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/17050773" }, { "id": "227", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/227" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0010000.1100100000.010100000001111100.00001.01000", "uniprot_canonical_ac": "P01877-2" }, { "glytoucan_ac": "G43157UW", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "17050773", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/17050773" }, { "id": "227", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/227" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0100000.1100000000.010100000001111100.00001.01000", "uniprot_canonical_ac": "P01877-2" }, { "glytoucan_ac": "G45495MK", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "17050773", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/17050773" }, { "id": "227", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/227" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0010000.1110100000.010100000011111100.00001.01000", "uniprot_canonical_ac": "P01877-2" }, { "glytoucan_ac": "G46687AB", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "17050773", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/17050773" }, { "id": "227", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/227" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0100000.1110000000.010111100011111101.00010.01000", "uniprot_canonical_ac": "P01877-2" }, { "glytoucan_ac": "G48414YA", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "17050773", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/17050773" }, { "id": "227", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/227" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0010000.1100100000.010111000011111100.00100.01000", "uniprot_canonical_ac": "P01877-2" }, { "glytoucan_ac": "G50045TK", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "17050773", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/17050773" }, { "id": "227", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/227" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0100000.1100000000.010111100011111101.00010.01000", "uniprot_canonical_ac": "P01877-2" }, { "glytoucan_ac": "G55052CN", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "17050773", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/17050773" }, { "id": "227", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/227" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0100000.1100000000.010100000001001000.00001.01000", "uniprot_canonical_ac": "P01877-2" }, { "glytoucan_ac": "G55220VL", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "17050773", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/17050773" }, { "id": "227", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/227" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0100000.1100000000.110100100011111110.10000.01000", "uniprot_canonical_ac": "P01877-2" }, { "glytoucan_ac": "G57818FI", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "17050773", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/17050773" }, { "id": "227", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/227" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0100000.1110000000.010100000001111100.00001.01000", "uniprot_canonical_ac": "P01877-2" }, { "glytoucan_ac": "G61937QU", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "17050773", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/17050773" }, { "id": "227", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/227" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0100000.1110000000.010100000001111100.00001.01000", "uniprot_canonical_ac": "P01877-2" }, { "glytoucan_ac": "G65219TP", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "17050773", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/17050773" }, { "id": "227", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/227" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0010000.1110100000.000100000001101000.00001.01000", "uniprot_canonical_ac": "P01877-2" }, { "glytoucan_ac": "G75798PH", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "17050773", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/17050773" }, { "id": "227", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/227" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0100000.1100000000.010000000001101000.00001.01000", "uniprot_canonical_ac": "P01877-2" }, { "glytoucan_ac": "G79568CQ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "17050773", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/17050773" }, { "id": "227", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/227" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0100000.1100000000.010111000001111100.00010.01000", "uniprot_canonical_ac": "P01877-2" }, { "glytoucan_ac": "G81295CK", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "17050773", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/17050773" }, { "id": "227", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/227" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0100000.1100000000.010111100011111101.00010.01000", "uniprot_canonical_ac": "P01877-2" }, { "glytoucan_ac": "G84452RH", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "17050773", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/17050773" }, { "id": "227", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/227" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0010000.1110100000.010111000011111101.00100.01000", "uniprot_canonical_ac": "P01877-2" }, { "glytoucan_ac": "G91473PK", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "17050773", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/17050773" }, { "id": "227", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/227" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0010000.1110100000.000110000001101100.00100.01000", "uniprot_canonical_ac": "P01877-2" } ], "glycan_expression": [ { "glytoucan_ac": "G79568CQ", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01876-2" }, { "glytoucan_ac": "G79568CQ", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01877-2" }, { "glytoucan_ac": "G42358LZ", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01876-2" }, { "glytoucan_ac": "G42358LZ", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01877-2" }, { "glytoucan_ac": "G43157UW", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01876-2" }, { "glytoucan_ac": "G43157UW", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01877-2" }, { "glytoucan_ac": "G26403SG", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01876-2" }, { "glytoucan_ac": "G26403SG", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01877-2" }, { "glytoucan_ac": "G20425TQ", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01876-2" }, { "glytoucan_ac": "G20425TQ", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01877-2" }, { "glytoucan_ac": "G36131WL", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01876-2" }, { "glytoucan_ac": "G36131WL", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01877-2" }, { "glytoucan_ac": "G65219TP", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01876-2" }, { "glytoucan_ac": "G65219TP", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01877-2" }, { "glytoucan_ac": "G37868ZX", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01876-2" }, { "glytoucan_ac": "G37868ZX", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01877-2" }, { "glytoucan_ac": "G91473PK", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01876-2" }, { "glytoucan_ac": "G91473PK", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01877-2" }, { "glytoucan_ac": "G81295CK", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01876-2" }, { "glytoucan_ac": "G81295CK", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01877-2" }, { "glytoucan_ac": "G05850WN", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01876-2" }, { "glytoucan_ac": "G05850WN", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01877-2" }, { "glytoucan_ac": "G06110VR", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01876-2" }, { "glytoucan_ac": "G06110VR", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01877-2" }, { "glytoucan_ac": "G06356OH", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01876-2" }, { "glytoucan_ac": "G06356OH", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01877-2" }, { "glytoucan_ac": "G84452RH", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01876-2" }, { "glytoucan_ac": "G84452RH", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01877-2" }, { "glytoucan_ac": "G22140GZ", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01876-2" }, { "glytoucan_ac": "G22140GZ", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01877-2" }, { "glytoucan_ac": "G22310AV", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01876-2" }, { "glytoucan_ac": "G22310AV", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01877-2" }, { "glytoucan_ac": "G33780DA", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01876-2" }, { "glytoucan_ac": "G33780DA", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01877-2" }, { "glytoucan_ac": "G57818FI", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01876-2" }, { "glytoucan_ac": "G57818FI", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01877-2" }, { "glytoucan_ac": "G02030ZB", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01876-2" }, { "glytoucan_ac": "G02030ZB", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01877-2" }, { "glytoucan_ac": "G08146BT", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01876-2" }, { "glytoucan_ac": "G08146BT", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01877-2" }, { "glytoucan_ac": "G50045TK", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01876-2" }, { "glytoucan_ac": "G50045TK", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01877-2" }, { "glytoucan_ac": "G46687AB", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01876-2" }, { "glytoucan_ac": "G46687AB", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01877-2" }, { "glytoucan_ac": "G55052CN", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01876-2" }, { "glytoucan_ac": "G55052CN", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01877-2" }, { "glytoucan_ac": "G55220VL", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01876-2" }, { "glytoucan_ac": "G55220VL", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01877-2" }, { "glytoucan_ac": "G48414YA", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01876-2" }, { "glytoucan_ac": "G48414YA", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01877-2" }, { "glytoucan_ac": "G45495MK", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01876-2" }, { "glytoucan_ac": "G45495MK", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01877-2" }, { "glytoucan_ac": "G39619TI", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01876-2" }, { "glytoucan_ac": "G39619TI", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01877-2" }, { "glytoucan_ac": "G23432EQ", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01876-2" }, { "glytoucan_ac": "G23432EQ", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01877-2" }, { "glytoucan_ac": "G23863VK", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01876-2" }, { "glytoucan_ac": "G23863VK", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01877-2" }, { "glytoucan_ac": "G75798PH", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01876-2" }, { "glytoucan_ac": "G75798PH", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01877-2" }, { "glytoucan_ac": "G31936TA", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01876-2" }, { "glytoucan_ac": "G31936TA", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01877-2" }, { "glytoucan_ac": "G61937QU", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01876-2" }, { "glytoucan_ac": "G61937QU", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01877-2" } ], "record_id": "pubmed.17050773", "abstract": "", "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 32 } ], "sort_fields": [ "glytoucan_ac" ] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 64 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_sites", "count": 1 }, { "field": "o_linked_sites", "count": 1 }, { "field": "n_linked_glycan_sites", "count": 1 }, { "field": "o_linked_glycan_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 32 }, { "field": "o_linked_glycans", "count": 2 }, { "field": "exact_sites", "count": 0 }, { "field": "fuzzy_sites", "count": 1 }, { "field": "fuzzy_n_linked_sites", "count": 1 }, { "field": "fuzzy_n_linked_glycan_sites", "count": 1 }, { "field": "fuzzy_n_linked_glycans", "count": 32 }, { "field": "fuzzy_o_linked_sites", "count": 1 }, { "field": "fuzzy_o_linked_glycan_sites", "count": 1 }, { "field": "fuzzy_o_linked_glycans", "count": 2 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "filter_code", "uniprot_canonical_ac" ] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 64 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_sites", "count": 1 }, { "field": "o_linked_sites", "count": 1 }, { "field": "n_linked_glycan_sites", "count": 1 }, { "field": "o_linked_glycan_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 32 }, { "field": "o_linked_glycans", "count": 2 }, { "field": "exact_sites", "count": 0 }, { "field": "fuzzy_sites", "count": 1 }, { "field": "fuzzy_n_linked_sites", "count": 1 }, { "field": "fuzzy_n_linked_glycan_sites", "count": 1 }, { "field": "fuzzy_n_linked_glycans", "count": 32 }, { "field": "fuzzy_o_linked_sites", "count": 1 }, { "field": "fuzzy_o_linked_glycan_sites", "count": 1 }, { "field": "fuzzy_o_linked_glycans", "count": 2 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "filter_code", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Clustered O-glycans of IgA1: defining macro- and microheterogeneity by use of electron capture/transfer dissociation.", "journal": "Molecular & cellular proteomics : MCP", "date": "2010", "authors": "Takahashi K, Wall SB, Suzuki H, Smith AD 4th, Hall S, Poulsen K, Kilian M, Mobley JA, Julian BA, Mestecky J, Novak J, Renfrow MB", "reference": { "type": "PubMed", "id": "20823119", "url": "https://pubmed.ncbi.nlm.nih.gov/20823119" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P01876-2", "protein_name": "Immunoglobulin heavy constant alpha 1", "gene_name": "IGHA1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P01876", "url": "https://www.uniprot.org/uniprotkb/P01876" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "glycosylation": [ { "glytoucan_ac": "", "type": "O-linked", "subtype": "O-GalNAcylation", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "T", "relation": "attached", "comment": "O-linked (GalNAc...) threonine;O-GalNAcylation", "icn3d_view": {}, "start_pos": 106, "start_aa": "Thr", "end_pos": 106, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr106", "evidence": [ { "id": "P01876", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P01876#ptm_processing" }, { "id": "20823119", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/20823119" }, { "id": "31959827", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/31959827" } ], "filter_code": "000000000000000010000.00000010000000.00.01001", "uniprot_canonical_ac": "P01876-2" }, { "glytoucan_ac": "", "type": "O-linked", "subtype": "O-GalNAcylation", "prediction_tool_list": [ { "label": "isoglyp", "url": "https://github.com/jonmohl/ISOGlyP" } ], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "T", "relation": "attached", "comment": "O-linked (GalNAc...) threonine;O-GalNAcylation", "icn3d_view": {}, "start_pos": 109, "start_aa": "Thr", "end_pos": 109, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr109", "evidence": [ { "id": "P01876", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P01876#ptm_processing" }, { "id": "20823119", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/20823119" }, { "id": "31959827", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/31959827" }, { "id": "GLY_001151", "database": "GlyGen", "url": "https://data.glygen.org/GLY_001151" } ], "filter_code": "000000000000000010000.00000010000000.00.01000", "uniprot_canonical_ac": "P01876-2" }, { "glytoucan_ac": "", "type": "O-linked", "subtype": "O-GalNAcylation", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "S", "relation": "attached", "comment": "O-linked (GalNAc...) serine;O-GalNAcylation", "icn3d_view": {}, "start_pos": 111, "start_aa": "Ser", "end_pos": 111, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser111", "evidence": [ { "id": "P01876", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P01876#ptm_processing" }, { "id": "4373463", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/4373463" }, { "id": "20823119", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/20823119" }, { "id": "31959827", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/31959827" } ], "filter_code": "000000000000000100000.00000010000000.00.01001", "uniprot_canonical_ac": "P01876-2" }, { "glytoucan_ac": "", "type": "O-linked", "subtype": "O-GalNAcylation", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "S", "relation": "attached", "comment": "O-linked (GalNAc...) serine;O-GalNAcylation", "icn3d_view": {}, "start_pos": 113, "start_aa": "Ser", "end_pos": 113, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser113", "evidence": [ { "id": "P01876", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P01876#ptm_processing" }, { "id": "4373463", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/4373463" }, { "id": "20823119", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/20823119" }, { "id": "31959827", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/31959827" } ], "filter_code": "000000000000000100000.00000010000000.00.01000", "uniprot_canonical_ac": "P01876-2" }, { "glytoucan_ac": "", "type": "O-linked", "subtype": "O-GalNAcylation", "prediction_tool_list": [ { "label": "isoglyp", "url": "https://github.com/jonmohl/ISOGlyP" } ], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "T", "relation": "attached", "comment": "O-linked (GalNAc...) threonine;O-GalNAcylation", "icn3d_view": {}, "start_pos": 117, "start_aa": "Thr", "end_pos": 117, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr117", "evidence": [ { "id": "P01876", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P01876#ptm_processing" }, { "id": "20823119", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/20823119" }, { "id": "31959827", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/31959827" }, { "id": "GLY_001151", "database": "GlyGen", "url": "https://data.glygen.org/GLY_001151" } ], "filter_code": "000000000000000010000.00000010000000.00.01001", "uniprot_canonical_ac": "P01876-2" } ], "record_id": "pubmed.20823119", "abstract": "", "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 5 }, { "field": "total_sites", "count": 5 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 5 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "exact_sites", "count": 5 }, { "field": "exact_o_linked_sites", "count": 5 }, { "field": "fuzzy_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl", "filter_code", "uniprot_canonical_ac" ] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 5 }, { "field": "total_sites", "count": 5 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 5 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "exact_sites", "count": 5 }, { "field": "exact_o_linked_sites", "count": 5 }, { "field": "fuzzy_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl", "filter_code", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Naturally occurring structural isomers in serum IgA1 o-glycosylation.", "journal": "Journal of proteome research", "date": "2012", "authors": "Takahashi K, Smith AD, Poulsen K, Kilian M, Julian BA, Mestecky J, Novak J, Renfrow MB", "reference": { "type": "PubMed", "id": "22067045", "url": "https://pubmed.ncbi.nlm.nih.gov/22067045" }, "referenced_glycans": [ { "glytoucan_ac": "G74722FL" }, { "glytoucan_ac": "G57321FI" }, { "glytoucan_ac": "G29931IJ" }, { "glytoucan_ac": "G46252BF" }, { "glytoucan_ac": "G76355TG" } ], "referenced_proteins": [ { "uniprot_canonical_ac": "P01876-2", "protein_name": "Immunoglobulin heavy constant alpha 1", "gene_name": "IGHA1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P01876", "url": "https://www.uniprot.org/uniprotkb/P01876" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "glycosylation": [ { "glytoucan_ac": "G29931IJ", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "T", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 106, "start_aa": "T", "end_pos": 106, "end_aa": "T", "residue": "T", "site_lbl": "T106", "evidence": [ { "id": "40667337", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/40667337" }, { "id": "TP5868669", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP5868669" }, { "id": "22067045", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/22067045" }, { "id": "230", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/230" } ], "filter_code": "000000000000000010000.0000000.00000000001000.1000000.1100000000.110100100011111100.00010.01001", "uniprot_canonical_ac": "P01876-2" }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "T", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 106, "start_aa": "Thr", "end_pos": 106, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr106", "evidence": [ { "id": "22067045", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/22067045" }, { "id": "230", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/230" } ], "filter_code": "000000000000000010000.0000000.00000000001000.1000000.0100000000.010100100011111110.10000.01001", "uniprot_canonical_ac": "P01876-2" }, { "glytoucan_ac": "G76355TG", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "T", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 106, "start_aa": "Thr", "end_pos": 106, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr106", "evidence": [ { "id": "22067045", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/22067045" }, { "id": "230", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/230" } ], "filter_code": "000000000000000010000.0000000.00000000001000.1000000.1100000000.010000000001001000.10000.01001", "uniprot_canonical_ac": "P01876-2" }, { "glytoucan_ac": "G29931IJ", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "T", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 109, "start_aa": "T", "end_pos": 109, "end_aa": "T", "residue": "T", "site_lbl": "T109", "evidence": [ { "id": "40667337", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/40667337" }, { "id": "TP5868669", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP5868669" }, { "id": "22067045", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/22067045" }, { "id": "230", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/230" } ], "filter_code": "000000000000000010000.0000000.00000000001000.1000000.1100000000.110100100011111100.00010.01000", "uniprot_canonical_ac": "P01876-2" }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "T", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 109, "start_aa": "Thr", "end_pos": 109, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr109", "evidence": [ { "id": "22067045", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/22067045" }, { "id": "230", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/230" } ], "filter_code": "000000000000000010000.0000000.00000000001000.1000000.0100000000.010100100011111110.10000.01000", "uniprot_canonical_ac": "P01876-2" }, { "glytoucan_ac": "G76355TG", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "T", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 109, "start_aa": "Thr", "end_pos": 109, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr109", "evidence": [ { "id": "22067045", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/22067045" }, { "id": "230", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/230" } ], "filter_code": "000000000000000010000.0000000.00000000001000.1000000.1100000000.010000000001001000.10000.01000", "uniprot_canonical_ac": "P01876-2" }, { "glytoucan_ac": "G29931IJ", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "S", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 111, "start_aa": "S", "end_pos": 111, "end_aa": "S", "residue": "S", "site_lbl": "S111", "evidence": [ { "id": "40667337", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/40667337" }, { "id": "TP5868669", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP5868669" }, { "id": "4373463", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/4373463" }, { "id": "230", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/230" }, { "id": "22067045", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/22067045" } ], "filter_code": "000000000000000100000.0000000.00000000001000.1000000.1100000000.110100100011111100.00010.01001", "uniprot_canonical_ac": "P01876-2" }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "S", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 111, "start_aa": "Ser", "end_pos": 111, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser111", "evidence": [ { "id": "22067045", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/22067045" }, { "id": "230", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/230" } ], "filter_code": "000000000000000100000.0000000.00000000001000.1000000.0100000000.010100100011111110.10000.01001", "uniprot_canonical_ac": "P01876-2" }, { "glytoucan_ac": "G76355TG", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "S", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 111, "start_aa": "Ser", "end_pos": 111, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser111", "evidence": [ { "id": "22067045", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/22067045" }, { "id": "230", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/230" } ], "filter_code": "000000000000000100000.0000000.00000000001000.1000000.1100000000.010000000001001000.10000.01001", "uniprot_canonical_ac": "P01876-2" }, { "glytoucan_ac": "G29931IJ", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "S", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 113, "start_aa": "S", "end_pos": 113, "end_aa": "S", "residue": "S", "site_lbl": "S113", "evidence": [ { "id": "40667337", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/40667337" }, { "id": "TP5868669", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP5868669" }, { "id": "4373463", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/4373463" }, { "id": "230", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/230" }, { "id": "22067045", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/22067045" } ], "filter_code": "000000000000000100000.0000000.00000000001000.1000000.1100000000.110100100011111100.00010.01000", "uniprot_canonical_ac": "P01876-2" }, { "glytoucan_ac": "G46252BF", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "S", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 113, "start_aa": "Ser", "end_pos": 113, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser113", "evidence": [ { "id": "22067045", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/22067045" }, { "id": "230", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/230" } ], "filter_code": "000000000000000100000.0000000.00000000001000.1000000.1100100000.010100000011111111.00001.01000", "uniprot_canonical_ac": "P01876-2" }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "S", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 113, "start_aa": "Ser", "end_pos": 113, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser113", "evidence": [ { "id": "22067045", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/22067045" }, { "id": "230", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/230" } ], "filter_code": "000000000000000100000.0000000.00000000001000.1000000.0100000000.010100100011111110.10000.01000", "uniprot_canonical_ac": "P01876-2" }, { "glytoucan_ac": "G74722FL", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "S", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 113, "start_aa": "S", "end_pos": 113, "end_aa": "S", "residue": "S", "site_lbl": "S113", "evidence": [ { "id": "40667337", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/40667337" }, { "id": "TP5868669", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP5868669" }, { "id": "22067045", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/22067045" }, { "id": "230", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/230" } ], "filter_code": "000000000000000100000.0000000.00000000001000.1000000.1100100000.010100000011111111.00100.01000", "uniprot_canonical_ac": "P01876-2" }, { "glytoucan_ac": "G76355TG", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "S", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 113, "start_aa": "Ser", "end_pos": 113, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser113", "evidence": [ { "id": "22067045", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/22067045" }, { "id": "230", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/230" } ], "filter_code": "000000000000000100000.0000000.00000000001000.1000000.1100000000.010000000001001000.10000.01000", "uniprot_canonical_ac": "P01876-2" }, { "glytoucan_ac": "G29931IJ", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "T", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 114, "start_aa": "T", "end_pos": 114, "end_aa": "T", "residue": "T", "site_lbl": "T114", "evidence": [ { "id": "40667337", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/40667337" }, { "id": "TP5868669", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP5868669" }, { "id": "22067045", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/22067045" }, { "id": "230", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/230" } ], "filter_code": "000000000000000010000.0000000.00000000001000.1000000.1100000000.110100100011111100.00010.01001", "uniprot_canonical_ac": "P01876-2" }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "T", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 114, "start_aa": "Thr", "end_pos": 114, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr114", "evidence": [ { "id": "22067045", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/22067045" }, { "id": "230", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/230" } ], "filter_code": "000000000000000010000.0000000.00000000001000.1000000.0100000000.010100100011111110.10000.01001", "uniprot_canonical_ac": "P01876-2" }, { "glytoucan_ac": "G76355TG", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "T", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 114, "start_aa": "Thr", "end_pos": 114, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr114", "evidence": [ { "id": "22067045", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/22067045" }, { "id": "230", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/230" } ], "filter_code": "000000000000000010000.0000000.00000000001000.1000000.1100000000.010000000001001000.10000.01001", "uniprot_canonical_ac": "P01876-2" }, { "glytoucan_ac": "G29931IJ", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "T", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 117, "start_aa": "T", "end_pos": 117, "end_aa": "T", "residue": "T", "site_lbl": "T117", "evidence": [ { "id": "40667337", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/40667337" }, { "id": "TP5868669", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP5868669" }, { "id": "22067045", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/22067045" }, { "id": "230", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/230" } ], "filter_code": "000000000000000010000.0000000.00000000001000.1000000.1100000000.110100100011111100.00010.01001", "uniprot_canonical_ac": "P01876-2" }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "T", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 117, "start_aa": "Thr", "end_pos": 117, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr117", "evidence": [ { "id": "22067045", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/22067045" }, { "id": "230", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/230" } ], "filter_code": "000000000000000010000.0000000.00000000001000.1000000.0100000000.010100100011111110.10000.01001", "uniprot_canonical_ac": "P01876-2" }, { "glytoucan_ac": "G76355TG", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "T", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 117, "start_aa": "Thr", "end_pos": 117, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr117", "evidence": [ { "id": "22067045", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/22067045" }, { "id": "230", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/230" } ], "filter_code": "000000000000000010000.0000000.00000000001000.1000000.1100000000.010000000001001000.10000.01001", "uniprot_canonical_ac": "P01876-2" } ], "glycan_expression": [ { "glytoucan_ac": "G74722FL", "abundance": "", "tissue": { "name": "blood plasma", "namespace": "UBERON", "id": "0001969", "url": "http://purl.obolibrary.org/obo/UBERON_0001969" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01876-2", "residue": "Ser", "start_pos": 113, "end_pos": 113 }, { "glytoucan_ac": "G57321FI", "abundance": "", "tissue": { "name": "blood plasma", "namespace": "UBERON", "id": "0001969", "url": "http://purl.obolibrary.org/obo/UBERON_0001969" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01876-2", "residue": "Thr", "start_pos": 117, "end_pos": 117 }, { "glytoucan_ac": "G57321FI", "abundance": "", "tissue": { "name": "blood plasma", "namespace": "UBERON", "id": "0001969", "url": "http://purl.obolibrary.org/obo/UBERON_0001969" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01876-2", "residue": "Thr", "start_pos": 114, "end_pos": 114 }, { "glytoucan_ac": "G57321FI", "abundance": "", "tissue": { "name": "blood plasma", "namespace": "UBERON", "id": "0001969", "url": "http://purl.obolibrary.org/obo/UBERON_0001969" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01876-2", "residue": "Thr", "start_pos": 106, "end_pos": 106 }, { "glytoucan_ac": "G57321FI", "abundance": "", "tissue": { "name": "blood plasma", "namespace": "UBERON", "id": "0001969", "url": "http://purl.obolibrary.org/obo/UBERON_0001969" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01876-2", "residue": "Thr", "start_pos": 109, "end_pos": 109 }, { "glytoucan_ac": "G57321FI", "abundance": "", "tissue": { "name": "blood plasma", "namespace": "UBERON", "id": "0001969", "url": "http://purl.obolibrary.org/obo/UBERON_0001969" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01876-2", "residue": "Ser", "start_pos": 113, "end_pos": 113 }, { "glytoucan_ac": "G57321FI", "abundance": "", "tissue": { "name": "blood plasma", "namespace": "UBERON", "id": "0001969", "url": "http://purl.obolibrary.org/obo/UBERON_0001969" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01876-2", "residue": "Ser", "start_pos": 111, "end_pos": 111 }, { "glytoucan_ac": "G29931IJ", "abundance": "", "tissue": { "name": "blood plasma", "namespace": "UBERON", "id": "0001969", "url": "http://purl.obolibrary.org/obo/UBERON_0001969" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01876-2", "residue": "Thr", "start_pos": 117, "end_pos": 117 }, { "glytoucan_ac": "G29931IJ", "abundance": "", "tissue": { "name": "blood plasma", "namespace": "UBERON", "id": "0001969", "url": "http://purl.obolibrary.org/obo/UBERON_0001969" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01876-2", "residue": "Thr", "start_pos": 114, "end_pos": 114 }, { "glytoucan_ac": "G29931IJ", "abundance": "", "tissue": { "name": "blood plasma", "namespace": "UBERON", "id": "0001969", "url": "http://purl.obolibrary.org/obo/UBERON_0001969" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01876-2", "residue": "Ser", "start_pos": 113, "end_pos": 113 }, { "glytoucan_ac": "G29931IJ", "abundance": "", "tissue": { "name": "blood plasma", "namespace": "UBERON", "id": "0001969", "url": "http://purl.obolibrary.org/obo/UBERON_0001969" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01876-2", "residue": "Thr", "start_pos": 106, "end_pos": 106 }, { "glytoucan_ac": "G29931IJ", "abundance": "", "tissue": { "name": "blood plasma", "namespace": "UBERON", "id": "0001969", "url": "http://purl.obolibrary.org/obo/UBERON_0001969" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01876-2", "residue": "Thr", "start_pos": 109, "end_pos": 109 }, { "glytoucan_ac": "G29931IJ", "abundance": "", "tissue": { "name": "blood plasma", "namespace": "UBERON", "id": "0001969", "url": "http://purl.obolibrary.org/obo/UBERON_0001969" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01876-2", "residue": "Ser", "start_pos": 111, "end_pos": 111 }, { "glytoucan_ac": "G46252BF", "abundance": "", "tissue": { "name": "blood plasma", "namespace": "UBERON", "id": "0001969", "url": "http://purl.obolibrary.org/obo/UBERON_0001969" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01876-2", "residue": "Ser", "start_pos": 113, "end_pos": 113 }, { "glytoucan_ac": "G76355TG", "abundance": "", "tissue": { "name": "blood plasma", "namespace": "UBERON", "id": "0001969", "url": "http://purl.obolibrary.org/obo/UBERON_0001969" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01876-2", "residue": "Thr", "start_pos": 117, "end_pos": 117 }, { "glytoucan_ac": "G76355TG", "abundance": "", "tissue": { "name": "blood plasma", "namespace": "UBERON", "id": "0001969", "url": "http://purl.obolibrary.org/obo/UBERON_0001969" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01876-2", "residue": "Thr", "start_pos": 114, "end_pos": 114 }, { "glytoucan_ac": "G76355TG", "abundance": "", "tissue": { "name": "blood plasma", "namespace": "UBERON", "id": "0001969", "url": "http://purl.obolibrary.org/obo/UBERON_0001969" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01876-2", "residue": "Ser", "start_pos": 113, "end_pos": 113 }, { "glytoucan_ac": "G76355TG", "abundance": "", "tissue": { "name": "blood plasma", "namespace": "UBERON", "id": "0001969", "url": "http://purl.obolibrary.org/obo/UBERON_0001969" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01876-2", "residue": "Thr", "start_pos": 106, "end_pos": 106 }, { "glytoucan_ac": "G76355TG", "abundance": "", "tissue": { "name": "blood plasma", "namespace": "UBERON", "id": "0001969", "url": "http://purl.obolibrary.org/obo/UBERON_0001969" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01876-2", "residue": "Thr", "start_pos": 109, "end_pos": 109 }, { "glytoucan_ac": "G76355TG", "abundance": "", "tissue": { "name": "blood plasma", "namespace": "UBERON", "id": "0001969", "url": "http://purl.obolibrary.org/obo/UBERON_0001969" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01876-2", "residue": "Ser", "start_pos": 111, "end_pos": 111 } ], "record_id": "pubmed.22067045", "abstract": "", "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 5 } ], "sort_fields": [ "glytoucan_ac" ] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 20 }, { "field": "total_sites", "count": 6 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 6 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 6 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 5 }, { "field": "exact_sites", "count": 6 }, { "field": "exact_o_linked_sites", "count": 6 }, { "field": "exact_o_linked_glycan_sites", "count": 6 }, { "field": "exact_o_linked_glycans", "count": 5 }, { "field": "fuzzy_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl", "filter_code", "uniprot_canonical_ac" ] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 20 }, { "field": "total_sites", "count": 6 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 6 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 6 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 5 }, { "field": "exact_sites", "count": 6 }, { "field": "exact_o_linked_sites", "count": 6 }, { "field": "exact_o_linked_glycan_sites", "count": 6 }, { "field": "exact_o_linked_glycans", "count": 5 }, { "field": "fuzzy_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl", "filter_code", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The structure and function of human IgA.", "journal": "The Biochemical journal", "date": "1990-10-15", "authors": "Kerr M A", "reference": { "type": "PubMed", "id": "2241915", "url": "https://pubmed.ncbi.nlm.nih.gov/2241915" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P01876-2", "protein_name": "Immunoglobulin heavy constant alpha 1", "gene_name": "IGHA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01877-2", "protein_name": "Immunoglobulin heavy constant alpha 2", "gene_name": "IGHA2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P01876", "url": "https://www.uniprot.org/uniprotkb/P01876" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.2241915", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "O-linked oligosaccharides from human serum immunoglobulin A1.", "journal": "Biochemical Society transactions", "date": "1989", "authors": "Field MC, Dwek RA, Edge CJ, Rademacher TW", "reference": { "type": "PubMed", "id": "2628063", "url": "https://pubmed.ncbi.nlm.nih.gov/2628063" }, "referenced_glycans": [ { "glytoucan_ac": "G00031MO" }, { "glytoucan_ac": "G65562ZE" }, { "glytoucan_ac": "G74722FL" }, { "glytoucan_ac": "G81006GJ" }, { "glytoucan_ac": "G84906ML" }, { "glytoucan_ac": "G40269CS" }, { "glytoucan_ac": "G57321FI" }, { "glytoucan_ac": "G01614ZM" }, { "glytoucan_ac": "G29931IJ" } ], "referenced_proteins": [ { "uniprot_canonical_ac": "P01876-2", "protein_name": "Immunoglobulin heavy constant alpha 1", "gene_name": "IGHA1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P01876", "url": "https://www.uniprot.org/uniprotkb/P01876" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "glycosylation": [ { "glytoucan_ac": "G00031MO", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "1280920", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/1280920" }, { "id": "230", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/230" }, { "id": "2628063", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/2628063" }, { "id": "9442070", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/9442070" }, { "id": "7215351", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/7215351" }, { "id": "20030399", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/20030399" } ], "filter_code": "000000000000000000000.0000000.00000000001000.1000000.1100000000.010100100011111100.10000.01000", "uniprot_canonical_ac": "P01876-2" }, { "glytoucan_ac": "G01614ZM", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "1280920", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/1280920" }, { "id": "230", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/230" }, { "id": "2628063", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/2628063" }, { "id": "9442070", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/9442070" } ], "filter_code": "000000000000000000000.0000000.00000000001000.1000000.1100100000.010000000011111001.10000.01000", "uniprot_canonical_ac": "P01876-2" }, { "glytoucan_ac": "G29931IJ", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "40667337", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/40667337" }, { "id": "TP5868669", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP5868669" }, { "id": "1280920", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/1280920" }, { "id": "230", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/230" }, { "id": "2628063", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/2628063" }, { "id": "9442070", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/9442070" }, { "id": "7215351", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/7215351" }, { "id": "4373463", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/4373463" }, { "id": "20030399", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/20030399" } ], "filter_code": "000000000000000000000.0000000.00000000001000.1000000.1100000000.110100100011111100.00010.01000", "uniprot_canonical_ac": "P01876-2" }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "2628063", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/2628063" }, { "id": "230", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/230" } ], "filter_code": "000000000000000000000.0000000.00000000001000.1000000.0100000000.010100100011111110.10000.01000", "uniprot_canonical_ac": "P01876-2" }, { "glytoucan_ac": "G65562ZE", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "1280920", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/1280920" }, { "id": "230", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/230" }, { "id": "2628063", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/2628063" }, { "id": "9442070", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/9442070" }, { "id": "7215351", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/7215351" } ], "filter_code": "000000000000000000000.0000000.00000000001000.1000000.1100100000.010100000011111011.10000.01000", "uniprot_canonical_ac": "P01876-2" }, { "glytoucan_ac": "G74722FL", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "40667337", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/40667337" }, { "id": "TP5868669", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP5868669" }, { "id": "1280920", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/1280920" }, { "id": "230", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/230" }, { "id": "2628063", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/2628063" }, { "id": "9442070", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/9442070" }, { "id": "7215351", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/7215351" }, { "id": "20030399", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/20030399" } ], "filter_code": "000000000000000000000.0000000.00000000001000.1000000.1100100000.010100000011111111.00100.01000", "uniprot_canonical_ac": "P01876-2" }, { "glytoucan_ac": "G81006GJ", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "40667337", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/40667337" }, { "id": "TP5868669", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP5868669" }, { "id": "1280920", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/1280920" }, { "id": "230", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/230" }, { "id": "2628063", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/2628063" }, { "id": "9442070", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/9442070" }, { "id": "20030399", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/20030399" } ], "filter_code": "000000000000000000000.0000000.00000000001000.1000000.1100100000.010000000011111101.00100.01000", "uniprot_canonical_ac": "P01876-2" } ], "glycan_expression": [ { "glytoucan_ac": "G00031MO", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01876-2" }, { "glytoucan_ac": "G65562ZE", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01876-2" }, { "glytoucan_ac": "G74722FL", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01876-2" }, { "glytoucan_ac": "G81006GJ", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01876-2" }, { "glytoucan_ac": "G84906ML", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {} }, { "glytoucan_ac": "G40269CS", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {} }, { "glytoucan_ac": "G57321FI", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01876-2" }, { "glytoucan_ac": "G01614ZM", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01876-2" }, { "glytoucan_ac": "G29931IJ", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01876-2" } ], "record_id": "pubmed.2628063", "abstract": "", "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 9 } ], "sort_fields": [ "glytoucan_ac" ] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 7 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 1 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 7 }, { "field": "exact_sites", "count": 0 }, { "field": "fuzzy_sites", "count": 1 }, { "field": "fuzzy_o_linked_sites", "count": 1 }, { "field": "fuzzy_o_linked_glycan_sites", "count": 1 }, { "field": "fuzzy_o_linked_glycans", "count": 7 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "filter_code", "uniprot_canonical_ac" ] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 7 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 1 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 7 }, { "field": "exact_sites", "count": 0 }, { "field": "fuzzy_sites", "count": 1 }, { "field": "fuzzy_o_linked_sites", "count": 1 }, { "field": "fuzzy_o_linked_glycan_sites", "count": 1 }, { "field": "fuzzy_o_linked_glycans", "count": 7 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "filter_code", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Primary structure of twenty three neutral and monosialylated oligosaccharides O-glycosidically linked to the human secretory immunoglobulin A hinge region determined by a combination of permethylation analysis and 400-MHz 1H-NMR spectroscopy.", "journal": "European journal of biochemistry", "date": "1989", "authors": "Pierce-Cretel A, Decottignies JP, Wieruszeski JM, Strecker G, Montreuil J, Spik G", "reference": { "type": "PubMed", "id": "2737211", "url": "https://pubmed.ncbi.nlm.nih.gov/2737211" }, "referenced_glycans": [ { "glytoucan_ac": "G00979XR" }, { "glytoucan_ac": "G59658KK" }, { "glytoucan_ac": "G08140FC" }, { "glytoucan_ac": "G41928NU" }, { "glytoucan_ac": "G42300CL" }, { "glytoucan_ac": "G27248RA" }, { "glytoucan_ac": "G13863XN" }, { "glytoucan_ac": "G72620YF" }, { "glytoucan_ac": "G35528EA" }, { "glytoucan_ac": "G64973KT" }, { "glytoucan_ac": "G66419SM" }, { "glytoucan_ac": "G25278BX" }, { "glytoucan_ac": "G25538MM" }, { "glytoucan_ac": "G12111NA" }, { "glytoucan_ac": "G12616PJ" }, { "glytoucan_ac": "G18132YR" }, { "glytoucan_ac": "G18559VR" }, { "glytoucan_ac": "G19555CW" }, { "glytoucan_ac": "G60067UC" }, { "glytoucan_ac": "G60145BJ" }, { "glytoucan_ac": "G81295CK" }, { "glytoucan_ac": "G05784QE" }, { "glytoucan_ac": "G53404LB" }, { "glytoucan_ac": "G98795OG" }, { "glytoucan_ac": "G40792HV" }, { "glytoucan_ac": "G22498IQ" }, { "glytoucan_ac": "G77550KK" }, { "glytoucan_ac": "G33508VK" }, { "glytoucan_ac": "G34100DU" }, { "glytoucan_ac": "G70783BY" }, { "glytoucan_ac": "G71306LD" }, { "glytoucan_ac": "G63628AV" }, { "glytoucan_ac": "G64206XB" }, { "glytoucan_ac": "G57068ZS" }, { "glytoucan_ac": "G94514IB" }, { "glytoucan_ac": "G94854LT" }, { "glytoucan_ac": "G08244KE" }, { "glytoucan_ac": "G08244YE" }, { "glytoucan_ac": "G29622NE" }, { "glytoucan_ac": "G46687AB" }, { "glytoucan_ac": "G46748BU" }, { "glytoucan_ac": "G47681UP" }, { "glytoucan_ac": "G04114CX" }, { "glytoucan_ac": "G04765GH" }, { "glytoucan_ac": "G54896JZ" }, { "glytoucan_ac": "G55259BS" }, { "glytoucan_ac": "G49854OS" }, { "glytoucan_ac": "G46524LG" }, { "glytoucan_ac": "G38812YS" }, { "glytoucan_ac": "G39523KI" }, { "glytoucan_ac": "G24363HJ" }, { "glytoucan_ac": "G75709RV" }, { "glytoucan_ac": "G16984QJ" }, { "glytoucan_ac": "G31685JQ" }, { "glytoucan_ac": "G31916IQ" }, { "glytoucan_ac": "G32216IU" } ], "referenced_proteins": [ { "uniprot_canonical_ac": "P01876-2", "protein_name": "Immunoglobulin heavy constant alpha 1", "gene_name": "IGHA1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P01876", "url": "https://www.uniprot.org/uniprotkb/P01876" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "glycosylation": [ { "glytoucan_ac": "G00979XR", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "2737211", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/2737211" }, { "id": "230", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/230" } ], "filter_code": "000000000000000000000.0000000.00000000001000.0100000.1100000000.000000000001000000.10000.01000", "uniprot_canonical_ac": "P01876-2" }, { "glytoucan_ac": "G04114CX", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "2737211", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/2737211" }, { "id": "230", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/230" } ], "filter_code": "000000000000000000000.0000000.00000000001000.0100000.1110100000.000000000001000000.10000.01000", "uniprot_canonical_ac": "P01876-2" }, { "glytoucan_ac": "G04765GH", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "2737211", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/2737211" }, { "id": "230", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/230" } ], "filter_code": "000000000000000000000.0000000.00000000001000.0100000.1100000000.000000000001000000.10000.01000", "uniprot_canonical_ac": "P01876-2" }, { "glytoucan_ac": "G12616PJ", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "2737211", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/2737211" }, { "id": "230", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/230" } ], "filter_code": "000000000000000000000.0000000.00000000001000.0100000.1100100000.000000000001000000.10000.01000", "uniprot_canonical_ac": "P01876-2" }, { "glytoucan_ac": "G13863XN", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "2737211", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/2737211" }, { "id": "230", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/230" } ], "filter_code": "000000000000000000000.0000000.00000000001000.0010000.1110100000.000000000001000000.10000.01000", "uniprot_canonical_ac": "P01876-2" }, { "glytoucan_ac": "G24363HJ", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "2737211", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/2737211" }, { "id": "230", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/230" } ], "filter_code": "000000000000000000000.0000000.00000000001000.0100000.1100100000.000000000001000000.10000.01000", "uniprot_canonical_ac": "P01876-2" }, { "glytoucan_ac": "G25278BX", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "2737211", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/2737211" }, { "id": "230", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/230" } ], "filter_code": "000000000000000000000.0000000.00000000001000.0010000.1110100000.000000000001000000.00100.01000", "uniprot_canonical_ac": "P01876-2" }, { "glytoucan_ac": "G25538MM", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "2737211", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/2737211" }, { "id": "230", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/230" } ], "filter_code": "000000000000000000000.0000000.00000000001000.0100000.1110000000.000000000001000000.10000.01000", "uniprot_canonical_ac": "P01876-2" }, { "glytoucan_ac": "G27248RA", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "2737211", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/2737211" }, { "id": "230", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/230" } ], "filter_code": "000000000000000000000.0000000.00000000001000.0010000.1110100000.000000000001000000.10000.01000", "uniprot_canonical_ac": "P01876-2" }, { "glytoucan_ac": "G31685JQ", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "2737211", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/2737211" }, { "id": "230", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/230" } ], "filter_code": "000000000000000000000.0000000.00000000001000.1000000.1110000000.110111100111111101.00010.01000", "uniprot_canonical_ac": "P01876-2" }, { "glytoucan_ac": "G31916IQ", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "2737211", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/2737211" }, { "id": "230", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/230" } ], "filter_code": "000000000000000000000.0000000.00000000001000.0100000.1100100000.000111100001100100.00100.01000", "uniprot_canonical_ac": "P01876-2" }, { "glytoucan_ac": "G33508VK", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "2737211", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/2737211" }, { "id": "230", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/230" } ], "filter_code": "000000000000000000000.0000000.00000000001000.0100000.1100000000.000000000001000000.10000.01000", "uniprot_canonical_ac": "P01876-2" }, { "glytoucan_ac": "G34100DU", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "2737211", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/2737211" }, { "id": "230", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/230" } ], "filter_code": "000000000000000000000.0000000.00000000001000.0100000.1100000000.000000000001000000.10000.01000", "uniprot_canonical_ac": "P01876-2" }, { "glytoucan_ac": "G39523KI", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "2737211", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/2737211" }, { "id": "230", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/230" } ], "filter_code": "000000000000000000000.0000000.00000000001000.0100000.1110100000.000000000001000000.10000.01000", "uniprot_canonical_ac": "P01876-2" }, { "glytoucan_ac": "G46524LG", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "2737211", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/2737211" }, { "id": "230", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/230" } ], "filter_code": "000000000000000000000.0000000.00000000001000.0010000.1110100000.000001000001000000.00100.01000", "uniprot_canonical_ac": "P01876-2" }, { "glytoucan_ac": "G46687AB", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "2737211", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/2737211" }, { "id": "230", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/230" }, { "id": "17050773", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/17050773" }, { "id": "227", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/227" } ], "filter_code": "000000000000000000000.0000000.00000000001000.0100000.1110000000.010111100011111101.00010.01000", "uniprot_canonical_ac": "P01876-2" }, { "glytoucan_ac": "G46748BU", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "2737211", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/2737211" }, { "id": "230", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/230" } ], "filter_code": "000000000000000000000.0000000.00000000001000.0100000.1100100000.010000000001111001.10000.01000", "uniprot_canonical_ac": "P01876-2" }, { "glytoucan_ac": "G47681UP", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "2737211", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/2737211" }, { "id": "230", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/230" }, { "id": "4172099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/4172099" }, { "id": "227", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/227" } ], "filter_code": "000000000000000000000.0000000.00000000001000.0100000.1100100000.010000000001000000.00100.01000", "uniprot_canonical_ac": "P01876-2" }, { "glytoucan_ac": "G49854OS", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "2737211", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/2737211" }, { "id": "230", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/230" } ], "filter_code": "000000000000000000000.0000000.00000000001000.0100000.1110100000.000000000001000000.10000.01000", "uniprot_canonical_ac": "P01876-2" }, { "glytoucan_ac": "G54896JZ", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "2737211", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/2737211" }, { "id": "230", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/230" } ], "filter_code": "000000000000000000000.0000000.00000000001000.0100000.1110100000.000000000001000000.10000.01000", "uniprot_canonical_ac": "P01876-2" }, { "glytoucan_ac": "G59658KK", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "2737211", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/2737211" }, { "id": "230", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/230" } ], "filter_code": "000000000000000000000.0000000.00000000001000.0010000.1110100000.000000000001000000.10000.01000", "uniprot_canonical_ac": "P01876-2" }, { "glytoucan_ac": "G60067UC", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "2737211", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/2737211" }, { "id": "230", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/230" } ], "filter_code": "000000000000000000000.0000000.00000000001000.0100000.1110000000.000000000001000000.10000.01000", "uniprot_canonical_ac": "P01876-2" }, { "glytoucan_ac": "G60145BJ", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "2737211", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/2737211" }, { "id": "230", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/230" } ], "filter_code": "000000000000000000000.0000000.00000000001000.0100000.1100000000.010111100011111100.00010.01000", "uniprot_canonical_ac": "P01876-2" }, { "glytoucan_ac": "G63628AV", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "2737211", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/2737211" }, { "id": "230", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/230" }, { "id": "9442070", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/9442070" }, { "id": "7215351", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/7215351" }, { "id": "20030399", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/20030399" } ], "filter_code": "000000000000000000000.0000000.00000000001000.1000000.1100000000.110110100111111111.00010.01000", "uniprot_canonical_ac": "P01876-2" }, { "glytoucan_ac": "G64206XB", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "2737211", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/2737211" }, { "id": "230", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/230" } ], "filter_code": "000000000000000000000.0000000.00000000001000.0100000.1100000000.000000000001000000.10000.01000", "uniprot_canonical_ac": "P01876-2" }, { "glytoucan_ac": "G64973KT", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "2737211", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/2737211" }, { "id": "230", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/230" }, { "id": "7215351", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/7215351" } ], "filter_code": "000000000000000000000.0000000.00000000001000.1000000.1100000000.010100000001111001.10000.01000", "uniprot_canonical_ac": "P01876-2" }, { "glytoucan_ac": "G66419SM", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "2737211", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/2737211" }, { "id": "230", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/230" } ], "filter_code": "000000000000000000000.0000000.00000000001000.0100000.1100100000.000000000001000000.10000.01000", "uniprot_canonical_ac": "P01876-2" }, { "glytoucan_ac": "G70783BY", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "2737211", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/2737211" }, { "id": "230", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/230" } ], "filter_code": "000000000000000000000.0000000.00000000001000.0100000.1110000000.000000000001000000.10000.01000", "uniprot_canonical_ac": "P01876-2" }, { "glytoucan_ac": "G71306LD", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "2737211", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/2737211" }, { "id": "230", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/230" } ], "filter_code": "000000000000000000000.0000000.00000000001000.0100000.1110000000.000000000001000000.10000.01000", "uniprot_canonical_ac": "P01876-2" }, { "glytoucan_ac": "G77550KK", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "2737211", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/2737211" }, { "id": "230", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/230" } ], "filter_code": "000000000000000000000.0000000.00000000001000.0010000.1110100000.000000000001000000.10000.01000", "uniprot_canonical_ac": "P01876-2" }, { "glytoucan_ac": "G81295CK", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "2737211", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/2737211" }, { "id": "230", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/230" }, { "id": "17050773", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/17050773" }, { "id": "227", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/227" } ], "filter_code": "000000000000000000000.0000000.00000000001000.0100000.1100000000.010111100011111101.00010.01000", "uniprot_canonical_ac": "P01876-2" }, { "glytoucan_ac": "G94514IB", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "2737211", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/2737211" }, { "id": "230", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/230" } ], "filter_code": "000000000000000000000.0000000.00000000001000.1000000.1110000000.010000000001000000.10000.01000", "uniprot_canonical_ac": "P01876-2" }, { "glytoucan_ac": "G94854LT", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "2737211", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/2737211" }, { "id": "230", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/230" } ], "filter_code": "000000000000000000000.0000000.00000000001000.0100000.1110000000.010011100011111101.00010.01000", "uniprot_canonical_ac": "P01876-2" } ], "glycan_expression": [ { "glytoucan_ac": "G00979XR", "abundance": "", "tissue": { "name": "milk", "namespace": "UBERON", "id": "0001913", "url": "http://purl.obolibrary.org/obo/UBERON_0001913" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01876-2" }, { "glytoucan_ac": "G59658KK", "abundance": "", "tissue": { "name": "milk", "namespace": "UBERON", "id": "0001913", "url": "http://purl.obolibrary.org/obo/UBERON_0001913" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01876-2" }, { "glytoucan_ac": "G08140FC", "abundance": "", "tissue": { "name": "milk", "namespace": "UBERON", "id": "0001913", "url": "http://purl.obolibrary.org/obo/UBERON_0001913" }, "species": { "name": "Bos taurus", "taxid": 9913, "reference_species": "Bos taurus [9913]", "common_name": "Bovine", "glygen_name": "Bovine" }, "cell_line": {} }, { "glytoucan_ac": "G41928NU", "abundance": "", "tissue": { "name": "milk", "namespace": "UBERON", "id": "0001913", "url": "http://purl.obolibrary.org/obo/UBERON_0001913" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {} }, { "glytoucan_ac": "G42300CL", "abundance": "", "tissue": { "name": "milk", "namespace": "UBERON", "id": "0001913", "url": "http://purl.obolibrary.org/obo/UBERON_0001913" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {} }, { "glytoucan_ac": "G27248RA", "abundance": "", "tissue": { "name": "milk", "namespace": "UBERON", "id": "0001913", "url": "http://purl.obolibrary.org/obo/UBERON_0001913" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01876-2" }, { "glytoucan_ac": "G13863XN", "abundance": "", "tissue": { "name": "milk", "namespace": "UBERON", "id": "0001913", "url": "http://purl.obolibrary.org/obo/UBERON_0001913" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01876-2" }, { "glytoucan_ac": "G72620YF", "abundance": "", "tissue": { "name": "milk", "namespace": "UBERON", "id": "0001913", "url": "http://purl.obolibrary.org/obo/UBERON_0001913" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {} }, { "glytoucan_ac": "G35528EA", "abundance": "", "tissue": { "name": "milk", "namespace": "UBERON", "id": "0001913", "url": "http://purl.obolibrary.org/obo/UBERON_0001913" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {} }, { "glytoucan_ac": "G64973KT", "abundance": "", "tissue": { "name": "milk", "namespace": "UBERON", "id": "0001913", "url": "http://purl.obolibrary.org/obo/UBERON_0001913" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01876-2" }, { "glytoucan_ac": "G66419SM", "abundance": "", "tissue": { "name": "milk", "namespace": "UBERON", "id": "0001913", "url": "http://purl.obolibrary.org/obo/UBERON_0001913" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01876-2" }, { "glytoucan_ac": "G25278BX", "abundance": "", "tissue": { "name": "milk", "namespace": "UBERON", "id": "0001913", "url": "http://purl.obolibrary.org/obo/UBERON_0001913" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01876-2" }, { "glytoucan_ac": "G25538MM", "abundance": "", "tissue": { "name": "milk", "namespace": "UBERON", "id": "0001913", "url": "http://purl.obolibrary.org/obo/UBERON_0001913" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01876-2" }, { "glytoucan_ac": "G12111NA", "abundance": "", "tissue": { "name": "milk", "namespace": "UBERON", "id": "0001913", "url": "http://purl.obolibrary.org/obo/UBERON_0001913" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {} }, { "glytoucan_ac": "G12616PJ", "abundance": "", "tissue": { "name": "milk", "namespace": "UBERON", "id": "0001913", "url": "http://purl.obolibrary.org/obo/UBERON_0001913" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01876-2" }, { "glytoucan_ac": "G18132YR", "abundance": "", "tissue": { "name": "milk", "namespace": "UBERON", "id": "0001913", "url": "http://purl.obolibrary.org/obo/UBERON_0001913" }, "species": { "name": "Bos taurus", "taxid": 9913, "reference_species": "Bos taurus [9913]", "common_name": "Bovine", "glygen_name": "Bovine" }, "cell_line": {} }, { "glytoucan_ac": "G18559VR", "abundance": "", "tissue": { "name": "milk", "namespace": "UBERON", "id": "0001913", "url": "http://purl.obolibrary.org/obo/UBERON_0001913" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {} }, { "glytoucan_ac": "G19555CW", "abundance": "", "tissue": { "name": "milk", "namespace": "UBERON", "id": "0001913", "url": "http://purl.obolibrary.org/obo/UBERON_0001913" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {} }, { "glytoucan_ac": "G60067UC", "abundance": "", "tissue": { "name": "milk", "namespace": "UBERON", "id": "0001913", "url": "http://purl.obolibrary.org/obo/UBERON_0001913" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01876-2" }, { "glytoucan_ac": "G60145BJ", "abundance": "", "tissue": { "name": "milk", "namespace": "UBERON", "id": "0001913", "url": "http://purl.obolibrary.org/obo/UBERON_0001913" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01876-2" }, { "glytoucan_ac": "G81295CK", "abundance": "", "tissue": { "name": "milk", "namespace": "UBERON", "id": "0001913", "url": "http://purl.obolibrary.org/obo/UBERON_0001913" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01876-2" }, { "glytoucan_ac": "G05784QE", "abundance": "", "tissue": { "name": "milk", "namespace": "UBERON", "id": "0001913", "url": "http://purl.obolibrary.org/obo/UBERON_0001913" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {} }, { "glytoucan_ac": "G53404LB", "abundance": "", "tissue": { "name": "milk", "namespace": "UBERON", "id": "0001913", "url": "http://purl.obolibrary.org/obo/UBERON_0001913" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {} }, { "glytoucan_ac": "G98795OG", "abundance": "", "tissue": { "name": "milk", "namespace": "UBERON", "id": "0001913", "url": "http://purl.obolibrary.org/obo/UBERON_0001913" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {} }, { "glytoucan_ac": "G40792HV", "abundance": "", "tissue": { "name": "milk", "namespace": "UBERON", "id": "0001913", "url": "http://purl.obolibrary.org/obo/UBERON_0001913" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {} }, { "glytoucan_ac": "G22498IQ", "abundance": "", "tissue": { "name": "milk", "namespace": "UBERON", "id": "0001913", "url": "http://purl.obolibrary.org/obo/UBERON_0001913" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {} }, { "glytoucan_ac": "G77550KK", "abundance": "", "tissue": { "name": "milk", "namespace": "UBERON", "id": "0001913", "url": "http://purl.obolibrary.org/obo/UBERON_0001913" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01876-2" }, { "glytoucan_ac": "G33508VK", "abundance": "", "tissue": { "name": "milk", "namespace": "UBERON", "id": "0001913", "url": "http://purl.obolibrary.org/obo/UBERON_0001913" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01876-2" }, { "glytoucan_ac": "G34100DU", "abundance": "", "tissue": { "name": "milk", "namespace": "UBERON", "id": "0001913", "url": "http://purl.obolibrary.org/obo/UBERON_0001913" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01876-2" }, { "glytoucan_ac": "G70783BY", "abundance": "", "tissue": { "name": "milk", "namespace": "UBERON", "id": "0001913", "url": "http://purl.obolibrary.org/obo/UBERON_0001913" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01876-2" }, { "glytoucan_ac": "G71306LD", "abundance": "", "tissue": { "name": "milk", "namespace": "UBERON", "id": "0001913", "url": "http://purl.obolibrary.org/obo/UBERON_0001913" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01876-2" }, { "glytoucan_ac": "G63628AV", "abundance": "", "tissue": { "name": "milk", "namespace": "UBERON", "id": "0001913", "url": "http://purl.obolibrary.org/obo/UBERON_0001913" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01876-2" }, { "glytoucan_ac": "G64206XB", "abundance": "", "tissue": { "name": "milk", "namespace": "UBERON", "id": "0001913", "url": "http://purl.obolibrary.org/obo/UBERON_0001913" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01876-2" }, { "glytoucan_ac": "G57068ZS", "abundance": "", "tissue": { "name": "milk", "namespace": "UBERON", "id": "0001913", "url": "http://purl.obolibrary.org/obo/UBERON_0001913" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {} }, { "glytoucan_ac": "G94514IB", "abundance": "", "tissue": { "name": "milk", "namespace": "UBERON", "id": "0001913", "url": "http://purl.obolibrary.org/obo/UBERON_0001913" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01876-2" }, { "glytoucan_ac": "G94854LT", "abundance": "", "tissue": { "name": "milk", "namespace": "UBERON", "id": "0001913", "url": "http://purl.obolibrary.org/obo/UBERON_0001913" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01876-2" }, { "glytoucan_ac": "G08244KE", "abundance": "", "tissue": { "name": "milk", "namespace": "UBERON", "id": "0001913", "url": "http://purl.obolibrary.org/obo/UBERON_0001913" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {} }, { "glytoucan_ac": "G08244YE", "abundance": "", "tissue": { "name": "milk", "namespace": "UBERON", "id": "0001913", "url": "http://purl.obolibrary.org/obo/UBERON_0001913" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {} }, { "glytoucan_ac": "G29622NE", "abundance": "", "tissue": { "name": "milk", "namespace": "UBERON", "id": "0001913", "url": "http://purl.obolibrary.org/obo/UBERON_0001913" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {} }, { "glytoucan_ac": "G46687AB", "abundance": "", "tissue": { "name": "milk", "namespace": "UBERON", "id": "0001913", "url": "http://purl.obolibrary.org/obo/UBERON_0001913" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01876-2" }, { "glytoucan_ac": "G46748BU", "abundance": "", "tissue": { "name": "milk", "namespace": "UBERON", "id": "0001913", "url": "http://purl.obolibrary.org/obo/UBERON_0001913" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01876-2" }, { "glytoucan_ac": "G47681UP", "abundance": "", "tissue": { "name": "milk", "namespace": "UBERON", "id": "0001913", "url": "http://purl.obolibrary.org/obo/UBERON_0001913" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01876-2" }, { "glytoucan_ac": "G04114CX", "abundance": "", "tissue": { "name": "milk", "namespace": "UBERON", "id": "0001913", "url": "http://purl.obolibrary.org/obo/UBERON_0001913" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01876-2" }, { "glytoucan_ac": "G04765GH", "abundance": "", "tissue": { "name": "milk", "namespace": "UBERON", "id": "0001913", "url": "http://purl.obolibrary.org/obo/UBERON_0001913" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01876-2" }, { "glytoucan_ac": "G54896JZ", "abundance": "", "tissue": { "name": "milk", "namespace": "UBERON", "id": "0001913", "url": "http://purl.obolibrary.org/obo/UBERON_0001913" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01876-2" }, { "glytoucan_ac": "G55259BS", "abundance": "", "tissue": { "name": "milk", "namespace": "UBERON", "id": "0001913", "url": "http://purl.obolibrary.org/obo/UBERON_0001913" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {} }, { "glytoucan_ac": "G49854OS", "abundance": "", "tissue": { "name": "milk", "namespace": "UBERON", "id": "0001913", "url": "http://purl.obolibrary.org/obo/UBERON_0001913" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01876-2" }, { "glytoucan_ac": "G46524LG", "abundance": "", "tissue": { "name": "milk", "namespace": "UBERON", "id": "0001913", "url": "http://purl.obolibrary.org/obo/UBERON_0001913" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01876-2" }, { "glytoucan_ac": "G38812YS", "abundance": "", "tissue": { "name": "milk", "namespace": "UBERON", "id": "0001913", "url": "http://purl.obolibrary.org/obo/UBERON_0001913" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {} }, { "glytoucan_ac": "G39523KI", "abundance": "", "tissue": { "name": "milk", "namespace": "UBERON", "id": "0001913", "url": "http://purl.obolibrary.org/obo/UBERON_0001913" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01876-2" }, { "glytoucan_ac": "G24363HJ", "abundance": "", "tissue": { "name": "milk", "namespace": "UBERON", "id": "0001913", "url": "http://purl.obolibrary.org/obo/UBERON_0001913" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01876-2" }, { "glytoucan_ac": "G75709RV", "abundance": "", "tissue": { "name": "milk", "namespace": "UBERON", "id": "0001913", "url": "http://purl.obolibrary.org/obo/UBERON_0001913" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {} }, { "glytoucan_ac": "G16984QJ", "abundance": "", "tissue": { "name": "milk", "namespace": "UBERON", "id": "0001913", "url": "http://purl.obolibrary.org/obo/UBERON_0001913" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {} }, { "glytoucan_ac": "G31685JQ", "abundance": "", "tissue": { "name": "milk", "namespace": "UBERON", "id": "0001913", "url": "http://purl.obolibrary.org/obo/UBERON_0001913" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01876-2" }, { "glytoucan_ac": "G31916IQ", "abundance": "", "tissue": { "name": "milk", "namespace": "UBERON", "id": "0001913", "url": "http://purl.obolibrary.org/obo/UBERON_0001913" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01876-2" }, { "glytoucan_ac": "G32216IU", "abundance": "", "tissue": { "name": "milk", "namespace": "UBERON", "id": "0001913", "url": "http://purl.obolibrary.org/obo/UBERON_0001913" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {} } ], "record_id": "pubmed.2737211", "abstract": "", "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 56 } ], "sort_fields": [ "glytoucan_ac" ] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 33 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 1 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 33 }, { "field": "exact_sites", "count": 0 }, { "field": "fuzzy_sites", "count": 1 }, { "field": "fuzzy_o_linked_sites", "count": 1 }, { "field": "fuzzy_o_linked_glycan_sites", "count": 1 }, { "field": "fuzzy_o_linked_glycans", "count": 33 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "filter_code", "uniprot_canonical_ac" ] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 33 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 1 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 33 }, { "field": "exact_sites", "count": 0 }, { "field": "fuzzy_sites", "count": 1 }, { "field": "fuzzy_o_linked_sites", "count": 1 }, { "field": "fuzzy_o_linked_glycan_sites", "count": 1 }, { "field": "fuzzy_o_linked_glycans", "count": 33 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "filter_code", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "IgA N- and O-glycosylation profiling reveals no association with the pregnancy-related improvement in rheumatoid arthritis.", "journal": "Arthritis research & therapy", "date": "2017-07-05", "authors": "Bondt Albert, Nicolardi Simone, Jansen Bas C, Kuijper T Martijn, Hazes Johanna M W, van der Burgt Yuri E M, Wuhrer Manfred, Dolhain Radboud J E M", "reference": { "type": "PubMed", "id": "28679431", "url": "https://pubmed.ncbi.nlm.nih.gov/28679431" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P01876-2", "protein_name": "Immunoglobulin heavy constant alpha 1", "gene_name": "IGHA1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P01876", "url": "https://www.uniprot.org/uniprotkb/P01876" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "glycosylation": [ { "glytoucan_ac": "", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true, "automatic_literature_mining": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": { "label": "iCn3D", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?bcifid=6UE7&bu=0&command=select+.B:263;+center+selection;+zoom+selection" }, "start_pos": 144, "start_aa": "Asn", "end_pos": 144, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn144", "evidence": [ { "id": "19838169", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19838169" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "P01876", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P01876#ptm_processing" }, { "id": "19139490", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19139490" }, { "id": "15084671", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/15084671" }, { "id": "22171320", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/22171320" }, { "id": "36677706", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/36677706" }, { "id": "GLY_000481", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000481" }, { "id": "28679431", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/28679431" }, { "id": "6UE7", "database": "PDB", "url": "https://www.rcsb.org/structure/6UE7" }, { "id": "8SKU", "database": "PDB", "url": "https://www.rcsb.org/structure/8SKU" }, { "id": "8SKV", "database": "PDB", "url": "https://www.rcsb.org/structure/8SKV" }, { "id": "9OFR", "database": "PDB", "url": "https://www.rcsb.org/structure/9OFR" } ], "mining_tool": "GlycoSiteMiner_1.0", "mining_tool_list": [ { "label": "GlycoSiteMiner_1.0" } ], "filter_code": "001000000000000000000.00010000000000.00.01001", "uniprot_canonical_ac": "P01876-2" } ], "record_id": "pubmed.28679431", "abstract": "", "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_sites", "count": 1 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "exact_sites", "count": 1 }, { "field": "exact_n_linked_sites", "count": 1 }, { "field": "fuzzy_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "icn3d_view.label", "icn3d_view.url", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl", "mining_tool", "filter_code", "uniprot_canonical_ac" ] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_sites", "count": 1 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "exact_sites", "count": 1 }, { "field": "exact_n_linked_sites", "count": 1 }, { "field": "fuzzy_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "icn3d_view.label", "icn3d_view.url", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl", "mining_tool", "filter_code", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_sites", "count": 1 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "exact_sites", "count": 1 }, { "field": "exact_n_linked_sites", "count": 1 }, { "field": "fuzzy_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "icn3d_view.label", "icn3d_view.url", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl", "mining_tool", "filter_code", "uniprot_canonical_ac" ] } ] }, { "title": "Galactose-Deficient IgA1-Specific Antibody Recognizes GalNAc-Modified Unique Epitope on Hinge Region of IgA1.", "journal": "Monoclonal antibodies in immunodiagnosis and immunotherapy", "date": "2018-12", "authors": "Yamasaki Kohei, Suzuki Hitoshi, Yasutake Junichi, Yamazaki Yuji, Suzuki Yusuke", "reference": { "type": "PubMed", "id": "30570353", "url": "https://pubmed.ncbi.nlm.nih.gov/30570353" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P01876-2", "protein_name": "Immunoglobulin heavy constant alpha 1", "gene_name": "IGHA1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P01876", "url": "https://www.uniprot.org/uniprotkb/P01876" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "glycosylation": [ { "glytoucan_ac": "", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "automatic_literature_mining", "site_category_dict": { "automatic_literature_mining": true }, "site_seq": "T", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 225, "start_aa": "Thr", "end_pos": 225, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr225", "evidence": [ { "id": "9442070", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/9442070" }, { "id": "GLY_000481", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000481" }, { "id": "30570353", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30570353" } ], "mining_tool": "GlycoSiteMiner_1.0", "mining_tool_list": [ { "label": "GlycoSiteMiner_1.0" } ], "filter_code": "000000000000000010000.00000000001000.00.01000", "uniprot_canonical_ac": "P01876-2" } ], "record_id": "pubmed.30570353", "abstract": "", "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 1 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "exact_sites", "count": 1 }, { "field": "exact_o_linked_sites", "count": 1 }, { "field": "fuzzy_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl", "mining_tool", "filter_code", "uniprot_canonical_ac" ] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 1 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "exact_sites", "count": 1 }, { "field": "exact_o_linked_sites", "count": 1 }, { "field": "fuzzy_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl", "mining_tool", "filter_code", "uniprot_canonical_ac" ] } ] }, { "title": "Aberrant RL2 O-GlcNAc antibody reactivity against serum-IgA1 of patients with colorectal cancer.", "journal": "Glycoconjugate journal", "date": "2021", "authors": "Verathamjamras C, Sriwitool TE, Netsirisawan P, Chaiyawat P, Chokchaichamnankit D, Prasongsook N, Srisomsap C, Svasti J, Champattanachai V", "reference": { "type": "PubMed", "id": "33608772", "url": "https://pubmed.ncbi.nlm.nih.gov/33608772" }, "referenced_glycans": [ { "glytoucan_ac": "G49108TO" } ], "referenced_proteins": [ { "uniprot_canonical_ac": "P01876-2", "protein_name": "Immunoglobulin heavy constant alpha 1", "gene_name": "IGHA1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P01876", "url": "https://www.uniprot.org/uniprotkb/P01876" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "glycosylation": [ { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 268, "start_aa": "Ser", "end_pos": 268, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser268", "evidence": [ { "id": "33608772", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33608772" }, { "id": "P01876", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P01876" }, { "id": "30397120", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30397120" }, { "id": "26853435", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/26853435" }, { "id": "38665916", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/38665916" }, { "id": "P01876", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/P01876" } ], "filter_code": "000000000000000100000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "P01876-2" }, { "glytoucan_ac": "", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "automatic_literature_mining", "site_category_dict": { "automatic_literature_mining": true }, "site_seq": "S", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 268, "start_aa": "Ser", "end_pos": 268, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser268", "evidence": [ { "id": "33608772", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33608772" }, { "id": "GLY_000481", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000481" } ], "mining_tool": "GlycoSiteMiner_1.0", "mining_tool_list": [ { "label": "GlycoSiteMiner_1.0" } ], "filter_code": "000000000000000100000.00000000001000.00.01000", "uniprot_canonical_ac": "P01876-2" } ], "glycan_expression": [ { "glytoucan_ac": "G49108TO", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01876-2", "residue": "Ser", "start_pos": 268, "end_pos": 268 } ], "record_id": "pubmed.33608772", "abstract": "", "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "glytoucan_ac" ] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 1 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "exact_sites", "count": 1 }, { "field": "exact_o_linked_sites", "count": 1 }, { "field": "exact_o_linked_glycan_sites", "count": 1 }, { "field": "exact_o_linked_glycans", "count": 1 }, { "field": "fuzzy_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl", "filter_code", "uniprot_canonical_ac", "mining_tool" ] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 1 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "exact_sites", "count": 1 }, { "field": "exact_o_linked_sites", "count": 1 }, { "field": "exact_o_linked_glycan_sites", "count": 1 }, { "field": "exact_o_linked_glycans", "count": 1 }, { "field": "fuzzy_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl", "filter_code", "uniprot_canonical_ac", "mining_tool" ] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 1 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "exact_sites", "count": 1 }, { "field": "exact_o_linked_sites", "count": 1 }, { "field": "fuzzy_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl", "filter_code", "uniprot_canonical_ac", "mining_tool" ] } ] }, { "title": "[Rule of antibody structure. Primary structure of a human monoclonal IgA-immunoglobulin (myeloma protein Tro). VII. Purification and characterization of the disulfide bridges].", "journal": "Hoppe-Seyler's Zeitschrift fur physiologische Chemie", "date": "1979", "authors": "Yang C, Kratzin H, Gotz H, Hilschmann N", "reference": { "type": "PubMed", "id": "393607", "url": "https://pubmed.ncbi.nlm.nih.gov/393607" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P01876-2", "protein_name": "Immunoglobulin heavy constant alpha 1", "gene_name": "IGHA1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P01876", "url": "https://www.uniprot.org/uniprotkb/P01876" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.393607", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Investigations on the oligosaccharide units of an A myeloma globulin.", "journal": "The Biochemical journal", "date": "1968", "authors": "Dawson G, Clamp JR", "reference": { "type": "PubMed", "id": "4172099", "url": "https://pubmed.ncbi.nlm.nih.gov/4172099" }, "referenced_glycans": [ { "glytoucan_ac": "G52706RS" }, { "glytoucan_ac": "G41860WU" }, { "glytoucan_ac": "G22310AV" }, { "glytoucan_ac": "G16276PY" }, { "glytoucan_ac": "G47681UP" }, { "glytoucan_ac": "G23453IV" } ], "referenced_proteins": [ { "uniprot_canonical_ac": "P01876-2", "protein_name": "Immunoglobulin heavy constant alpha 1", "gene_name": "IGHA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01877-2", "protein_name": "Immunoglobulin heavy constant alpha 2", "gene_name": "IGHA2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P01876", "url": "https://www.uniprot.org/uniprotkb/P01876" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "glycosylation": [ { "glytoucan_ac": "G16276PY", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "4172099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/4172099" }, { "id": "227", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/227" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0010000.1110100000.000000000001000000.00001.01000", "uniprot_canonical_ac": "P01876-2" }, { "glytoucan_ac": "G22310AV", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "4436308", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/4436308" }, { "id": "230", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/230" }, { "id": "4172099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/4172099" }, { "id": "227", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/227" }, { "id": "17050773", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/17050773" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0010000.1110100000.010111000011111101.00100.01000", "uniprot_canonical_ac": "P01876-2" }, { "glytoucan_ac": "G23453IV", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "4172099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/4172099" }, { "id": "227", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/227" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0100000.1100000000.010111100011111101.00010.01000", "uniprot_canonical_ac": "P01876-2" }, { "glytoucan_ac": "G47681UP", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "2737211", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/2737211" }, { "id": "230", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/230" }, { "id": "4172099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/4172099" }, { "id": "227", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/227" } ], "filter_code": "000000000000000000000.0000000.00000000001000.0100000.1100100000.010000000001000000.00100.01000", "uniprot_canonical_ac": "P01876-2" }, { "glytoucan_ac": "G52706RS", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "4172099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/4172099" }, { "id": "227", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/227" } ], "filter_code": "000000000000000000000.0000000.00000000001000.0100000.1100100000.000000000001000000.00001.01000", "uniprot_canonical_ac": "P01876-2" }, { "glytoucan_ac": "G16276PY", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "4172099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/4172099" }, { "id": "227", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/227" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0010000.1110100000.000000000001000000.00001.01000", "uniprot_canonical_ac": "P01877-2" }, { "glytoucan_ac": "G22310AV", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "4172099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/4172099" }, { "id": "227", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/227" }, { "id": "17050773", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/17050773" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0010000.1110100000.010111000011111101.00100.01000", "uniprot_canonical_ac": "P01877-2" }, { "glytoucan_ac": "G23453IV", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "4172099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/4172099" }, { "id": "227", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/227" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0100000.1100000000.010111100011111101.00010.01000", "uniprot_canonical_ac": "P01877-2" }, { "glytoucan_ac": "G47681UP", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "4172099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/4172099" }, { "id": "227", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/227" } ], "filter_code": "000000000000000000000.0000000.00000000001000.0100000.1100100000.010000000001000000.00100.01000", "uniprot_canonical_ac": "P01877-2" }, { "glytoucan_ac": "G52706RS", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "4172099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/4172099" }, { "id": "227", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/227" } ], "filter_code": "000000000000000000000.0000000.00000000001000.0100000.1100100000.000000000001000000.00001.01000", "uniprot_canonical_ac": "P01877-2" } ], "glycan_expression": [ { "glytoucan_ac": "G52706RS", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01876-2" }, { "glytoucan_ac": "G52706RS", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01877-2" }, { "glytoucan_ac": "G22310AV", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01876-2" }, { "glytoucan_ac": "G22310AV", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01877-2" }, { "glytoucan_ac": "G16276PY", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01876-2" }, { "glytoucan_ac": "G16276PY", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01877-2" }, { "glytoucan_ac": "G47681UP", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01876-2" }, { "glytoucan_ac": "G47681UP", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01877-2" }, { "glytoucan_ac": "G23453IV", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01876-2" }, { "glytoucan_ac": "G23453IV", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01877-2" } ], "record_id": "pubmed.4172099", "abstract": "", "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 6 } ], "sort_fields": [ "glytoucan_ac" ] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 10 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_sites", "count": 1 }, { "field": "o_linked_sites", "count": 1 }, { "field": "n_linked_glycan_sites", "count": 1 }, { "field": "o_linked_glycan_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 3 }, { "field": "o_linked_glycans", "count": 2 }, { "field": "exact_sites", "count": 0 }, { "field": "fuzzy_sites", "count": 1 }, { "field": "fuzzy_n_linked_sites", "count": 1 }, { "field": "fuzzy_n_linked_glycan_sites", "count": 1 }, { "field": "fuzzy_n_linked_glycans", "count": 3 }, { "field": "fuzzy_o_linked_sites", "count": 1 }, { "field": "fuzzy_o_linked_glycan_sites", "count": 1 }, { "field": "fuzzy_o_linked_glycans", "count": 2 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "filter_code", "uniprot_canonical_ac" ] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 10 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_sites", "count": 1 }, { "field": "o_linked_sites", "count": 1 }, { "field": "n_linked_glycan_sites", "count": 1 }, { "field": "o_linked_glycan_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 3 }, { "field": "o_linked_glycans", "count": 2 }, { "field": "exact_sites", "count": 0 }, { "field": "fuzzy_sites", "count": 1 }, { "field": "fuzzy_n_linked_sites", "count": 1 }, { "field": "fuzzy_n_linked_glycan_sites", "count": 1 }, { "field": "fuzzy_n_linked_glycans", "count": 3 }, { "field": "fuzzy_o_linked_sites", "count": 1 }, { "field": "fuzzy_o_linked_glycan_sites", "count": 1 }, { "field": "fuzzy_o_linked_glycans", "count": 2 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "filter_code", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Structure of the carbohydrate units of IgA1 immunoglobulin. II. Structure of the O-glycosidically linked oligosaccharide units.", "journal": "The Journal of biological chemistry", "date": "1974", "authors": "Baenziger J, Kornfeld S", "reference": { "type": "PubMed", "id": "4373463", "url": "https://pubmed.ncbi.nlm.nih.gov/4373463" }, "referenced_glycans": [ { "glytoucan_ac": "G00031MO" }, { "glytoucan_ac": "G54499HR" }, { "glytoucan_ac": "G57321FI" }, { "glytoucan_ac": "G29931IJ" } ], "referenced_proteins": [ { "uniprot_canonical_ac": "P01876-2", "protein_name": "Immunoglobulin heavy constant alpha 1", "gene_name": "IGHA1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P01876", "url": "https://www.uniprot.org/uniprotkb/P01876" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "glycosylation": [ { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "S", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 105, "start_aa": "Ser", "end_pos": 105, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser105", "evidence": [ { "id": "4373463", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/4373463" }, { "id": "230", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/230" } ], "filter_code": "000000000000000100000.0000000.00000000001000.1000000.0100000000.010100100011111110.10000.01001", "uniprot_canonical_ac": "P01876-2" }, { "glytoucan_ac": "", "type": "O-linked", "subtype": "O-GalNAcylation", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "S", "relation": "attached", "comment": "O-linked (GalNAc...) serine;O-GalNAcylation", "icn3d_view": {}, "start_pos": 105, "start_aa": "Ser", "end_pos": 105, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser105", "evidence": [ { "id": "P01876", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P01876#ptm_processing" }, { "id": "4373463", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/4373463" } ], "filter_code": "000000000000000100000.00000010000000.00.01001", "uniprot_canonical_ac": "P01876-2" }, { "glytoucan_ac": "G00031MO", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "S", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 111, "start_aa": "Ser", "end_pos": 111, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser111", "evidence": [ { "id": "4373463", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/4373463" }, { "id": "230", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/230" } ], "filter_code": "000000000000000100000.0000000.00000000001000.1000000.1100000000.010100100011111100.10000.01001", "uniprot_canonical_ac": "P01876-2" }, { "glytoucan_ac": "G29931IJ", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "S", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 111, "start_aa": "S", "end_pos": 111, "end_aa": "S", "residue": "S", "site_lbl": "S111", "evidence": [ { "id": "40667337", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/40667337" }, { "id": "TP5868669", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP5868669" }, { "id": "4373463", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/4373463" }, { "id": "230", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/230" }, { "id": "22067045", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/22067045" } ], "filter_code": "000000000000000100000.0000000.00000000001000.1000000.1100000000.110100100011111100.00010.01001", "uniprot_canonical_ac": "P01876-2" }, { "glytoucan_ac": "", "type": "O-linked", "subtype": "O-GalNAcylation", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "S", "relation": "attached", "comment": "O-linked (GalNAc...) serine;O-GalNAcylation", "icn3d_view": {}, "start_pos": 111, "start_aa": "Ser", "end_pos": 111, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser111", "evidence": [ { "id": "P01876", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P01876#ptm_processing" }, { "id": "4373463", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/4373463" }, { "id": "20823119", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/20823119" }, { "id": "31959827", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/31959827" } ], "filter_code": "000000000000000100000.00000010000000.00.01001", "uniprot_canonical_ac": "P01876-2" }, { "glytoucan_ac": "G00031MO", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "S", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 113, "start_aa": "Ser", "end_pos": 113, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser113", "evidence": [ { "id": "4373463", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/4373463" }, { "id": "230", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/230" } ], "filter_code": "000000000000000100000.0000000.00000000001000.1000000.1100000000.010100100011111100.10000.01000", "uniprot_canonical_ac": "P01876-2" }, { "glytoucan_ac": "G29931IJ", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "S", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 113, "start_aa": "S", "end_pos": 113, "end_aa": "S", "residue": "S", "site_lbl": "S113", "evidence": [ { "id": "40667337", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/40667337" }, { "id": "TP5868669", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP5868669" }, { "id": "4373463", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/4373463" }, { "id": "230", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/230" }, { "id": "22067045", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/22067045" } ], "filter_code": "000000000000000100000.0000000.00000000001000.1000000.1100000000.110100100011111100.00010.01000", "uniprot_canonical_ac": "P01876-2" }, { "glytoucan_ac": "", "type": "O-linked", "subtype": "O-GalNAcylation", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "S", "relation": "attached", "comment": "O-linked (GalNAc...) serine;O-GalNAcylation", "icn3d_view": {}, "start_pos": 113, "start_aa": "Ser", "end_pos": 113, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser113", "evidence": [ { "id": "P01876", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P01876#ptm_processing" }, { "id": "4373463", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/4373463" }, { "id": "20823119", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/20823119" }, { "id": "31959827", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/31959827" } ], "filter_code": "000000000000000100000.00000010000000.00.01000", "uniprot_canonical_ac": "P01876-2" }, { "glytoucan_ac": "G00031MO", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "S", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 119, "start_aa": "Ser", "end_pos": 119, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser119", "evidence": [ { "id": "4373463", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/4373463" }, { "id": "230", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/230" } ], "filter_code": "000000000000000100000.0000000.00000000001000.1000000.1100000000.010100100011111100.10000.01001", "uniprot_canonical_ac": "P01876-2" }, { "glytoucan_ac": "G29931IJ", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "S", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 119, "start_aa": "S", "end_pos": 119, "end_aa": "S", "residue": "S", "site_lbl": "S119", "evidence": [ { "id": "40667337", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/40667337" }, { "id": "TP5868669", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP5868669" }, { "id": "4373463", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/4373463" }, { "id": "230", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/230" } ], "filter_code": "000000000000000100000.0000000.00000000001000.1000000.1100000000.110100100011111100.00010.01001", "uniprot_canonical_ac": "P01876-2" }, { "glytoucan_ac": "", "type": "O-linked", "subtype": "O-GalNAcylation", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "S", "relation": "attached", "comment": "O-linked (GalNAc...) serine;O-GalNAcylation", "icn3d_view": {}, "start_pos": 119, "start_aa": "Ser", "end_pos": 119, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser119", "evidence": [ { "id": "P01876", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P01876#ptm_processing" }, { "id": "4373463", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/4373463" } ], "filter_code": "000000000000000100000.00000010000000.00.01001", "uniprot_canonical_ac": "P01876-2" }, { "glytoucan_ac": "G00031MO", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "S", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 121, "start_aa": "Ser", "end_pos": 121, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser121", "evidence": [ { "id": "4373463", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/4373463" }, { "id": "230", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/230" } ], "filter_code": "000000000000000100000.0000000.00000000001000.1000000.1100000000.010100100011111100.10000.01001", "uniprot_canonical_ac": "P01876-2" }, { "glytoucan_ac": "G29931IJ", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "S", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 121, "start_aa": "Ser", "end_pos": 121, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser121", "evidence": [ { "id": "4373463", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/4373463" }, { "id": "230", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/230" } ], "filter_code": "000000000000000100000.0000000.00000000001000.1000000.1100000000.110100100011111100.00010.01001", "uniprot_canonical_ac": "P01876-2" }, { "glytoucan_ac": "", "type": "O-linked", "subtype": "O-GalNAcylation", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "S", "relation": "attached", "comment": "O-linked (GalNAc...) serine;O-GalNAcylation", "icn3d_view": {}, "start_pos": 121, "start_aa": "Ser", "end_pos": 121, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser121", "evidence": [ { "id": "P01876", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P01876#ptm_processing" }, { "id": "4373463", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/4373463" } ], "filter_code": "000000000000000100000.00000010000000.00.01001", "uniprot_canonical_ac": "P01876-2" }, { "glytoucan_ac": "G29931IJ", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "40667337", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/40667337" }, { "id": "TP5868669", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP5868669" }, { "id": "1280920", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/1280920" }, { "id": "230", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/230" }, { "id": "2628063", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/2628063" }, { "id": "9442070", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/9442070" }, { "id": "7215351", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/7215351" }, { "id": "4373463", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/4373463" }, { "id": "20030399", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/20030399" } ], "filter_code": "000000000000000000000.0000000.00000000001000.1000000.1100000000.110100100011111100.00010.01000", "uniprot_canonical_ac": "P01876-2" }, { "glytoucan_ac": "G54499HR", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "4373463", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/4373463" }, { "id": "230", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/230" } ], "filter_code": "000000000000000000000.0000000.00000000001000.1000000.1100000000.010100100011111100.00001.01000", "uniprot_canonical_ac": "P01876-2" } ], "glycan_expression": [ { "glytoucan_ac": "G00031MO", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01876-2", "residue": "Ser", "start_pos": 111, "end_pos": 111 }, { "glytoucan_ac": "G00031MO", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01876-2", "residue": "Ser", "start_pos": 113, "end_pos": 113 }, { "glytoucan_ac": "G00031MO", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01876-2", "residue": "Ser", "start_pos": 119, "end_pos": 119 }, { "glytoucan_ac": "G00031MO", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01876-2", "residue": "Ser", "start_pos": 121, "end_pos": 121 }, { "glytoucan_ac": "G54499HR", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01876-2" }, { "glytoucan_ac": "G57321FI", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01876-2", "residue": "Ser", "start_pos": 105, "end_pos": 105 }, { "glytoucan_ac": "G29931IJ", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01876-2" }, { "glytoucan_ac": "G29931IJ", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01876-2", "residue": "Ser", "start_pos": 111, "end_pos": 111 }, { "glytoucan_ac": "G29931IJ", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01876-2", "residue": "Ser", "start_pos": 113, "end_pos": 113 }, { "glytoucan_ac": "G29931IJ", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01876-2", "residue": "Ser", "start_pos": 119, "end_pos": 119 }, { "glytoucan_ac": "G29931IJ", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01876-2", "residue": "Ser", "start_pos": 121, "end_pos": 121 } ], "record_id": "pubmed.4373463", "abstract": "", "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 4 } ], "sort_fields": [ "glytoucan_ac" ] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 16 }, { "field": "total_sites", "count": 6 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 6 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 6 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 4 }, { "field": "exact_sites", "count": 5 }, { "field": "exact_o_linked_sites", "count": 5 }, { "field": "exact_o_linked_glycan_sites", "count": 5 }, { "field": "exact_o_linked_glycans", "count": 3 }, { "field": "fuzzy_sites", "count": 1 }, { "field": "fuzzy_o_linked_sites", "count": 1 }, { "field": "fuzzy_o_linked_glycan_sites", "count": 1 }, { "field": "fuzzy_o_linked_glycans", "count": 2 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl", "filter_code", "uniprot_canonical_ac" ] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 5 }, { "field": "total_sites", "count": 5 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 5 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "exact_sites", "count": 5 }, { "field": "exact_o_linked_sites", "count": 5 }, { "field": "fuzzy_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl", "filter_code", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 11 }, { "field": "total_sites", "count": 6 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 6 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 6 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 4 }, { "field": "exact_sites", "count": 5 }, { "field": "exact_o_linked_sites", "count": 5 }, { "field": "exact_o_linked_glycan_sites", "count": 5 }, { "field": "exact_o_linked_glycans", "count": 3 }, { "field": "fuzzy_sites", "count": 1 }, { "field": "fuzzy_o_linked_sites", "count": 1 }, { "field": "fuzzy_o_linked_glycan_sites", "count": 1 }, { "field": "fuzzy_o_linked_glycans", "count": 2 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl", "filter_code", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Structure of the carbohydrate units of IgA1 immunoglobulin. I. Composition, glycopeptide isolation, and structure of the asparagine-linked oligosaccharide units.", "journal": "The Journal of biological chemistry", "date": "1974", "authors": "Baenziger J, Kornfeld S", "reference": { "type": "PubMed", "id": "4436308", "url": "https://pubmed.ncbi.nlm.nih.gov/4436308" }, "referenced_glycans": [ { "glytoucan_ac": "G26403SG" }, { "glytoucan_ac": "G25140TA" }, { "glytoucan_ac": "G66760KM" }, { "glytoucan_ac": "G22310AV" }, { "glytoucan_ac": "G56749GV" }, { "glytoucan_ac": "G50779LX" } ], "referenced_proteins": [ { "uniprot_canonical_ac": "P01876-2", "protein_name": "Immunoglobulin heavy constant alpha 1", "gene_name": "IGHA1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P01876", "url": "https://www.uniprot.org/uniprotkb/P01876" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "glycosylation": [ { "glytoucan_ac": "G22310AV", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "4436308", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/4436308" }, { "id": "230", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/230" }, { "id": "4172099", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/4172099" }, { "id": "227", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/227" }, { "id": "17050773", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/17050773" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0010000.1110100000.010111000011111101.00100.01000", "uniprot_canonical_ac": "P01876-2" }, { "glytoucan_ac": "G25140TA", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "4436308", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/4436308" }, { "id": "230", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/230" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0010000.1100100000.000100000001000000.10000.01000", "uniprot_canonical_ac": "P01876-2" }, { "glytoucan_ac": "G26403SG", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "4436308", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/4436308" }, { "id": "230", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/230" }, { "id": "17050773", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/17050773" }, { "id": "227", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/227" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0010000.1100100000.000011000001001100.00100.01000", "uniprot_canonical_ac": "P01876-2" }, { "glytoucan_ac": "G50779LX", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "4436308", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/4436308" }, { "id": "230", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/230" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0010000.1100100000.000000000001000000.10000.01000", "uniprot_canonical_ac": "P01876-2" }, { "glytoucan_ac": "G56749GV", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "4436308", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/4436308" }, { "id": "230", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/230" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0010000.1110100000.010100000001111000.10000.01000", "uniprot_canonical_ac": "P01876-2" }, { "glytoucan_ac": "G66760KM", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "4436308", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/4436308" }, { "id": "230", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/230" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0010000.1100100000.000111000001100100.00100.01000", "uniprot_canonical_ac": "P01876-2" } ], "glycan_expression": [ { "glytoucan_ac": "G26403SG", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01876-2" }, { "glytoucan_ac": "G25140TA", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01876-2" }, { "glytoucan_ac": "G66760KM", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01876-2" }, { "glytoucan_ac": "G22310AV", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01876-2" }, { "glytoucan_ac": "G56749GV", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01876-2" }, { "glytoucan_ac": "G50779LX", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01876-2" } ], "record_id": "pubmed.4436308", "abstract": "", "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 6 } ], "sort_fields": [ "glytoucan_ac" ] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 6 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_sites", "count": 1 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 1 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 6 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "exact_sites", "count": 0 }, { "field": "fuzzy_sites", "count": 1 }, { "field": "fuzzy_n_linked_sites", "count": 1 }, { "field": "fuzzy_n_linked_glycan_sites", "count": 1 }, { "field": "fuzzy_n_linked_glycans", "count": 6 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "filter_code", "uniprot_canonical_ac" ] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 6 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_sites", "count": 1 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 1 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 6 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "exact_sites", "count": 0 }, { "field": "fuzzy_sites", "count": 1 }, { "field": "fuzzy_n_linked_sites", "count": 1 }, { "field": "fuzzy_n_linked_glycan_sites", "count": 1 }, { "field": "fuzzy_n_linked_glycans", "count": 6 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "filter_code", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Mechanisms of divergence and convergence of the human immunoglobulin alpha 1 and alpha 2 constant region gene sequences.", "journal": "Cell", "date": "1984", "authors": "Flanagan JG, Lefranc MP, Rabbitts TH", "reference": { "type": "PubMed", "id": "6421489", "url": "https://pubmed.ncbi.nlm.nih.gov/6421489" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P01876-2", "protein_name": "Immunoglobulin heavy constant alpha 1", "gene_name": "IGHA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01877-2", "protein_name": "Immunoglobulin heavy constant alpha 2", "gene_name": "IGHA2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P01876", "url": "https://www.uniprot.org/uniprotkb/P01876" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.6421489", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Heterogeneity of the glycans O-glycosidically linked to the hinge region of secretory immunoglobulins from human milk.", "journal": "European journal of biochemistry", "date": "1981", "authors": "Pierce-Cretel A, Pamblanco M, Strecker G, Montreuil J, Spik G", "reference": { "type": "PubMed", "id": "7215351", "url": "https://pubmed.ncbi.nlm.nih.gov/7215351" }, "referenced_glycans": [ { "glytoucan_ac": "G00031MO" }, { "glytoucan_ac": "G00033MO" }, { "glytoucan_ac": "G64973KT" }, { "glytoucan_ac": "G65562ZE" }, { "glytoucan_ac": "G74722FL" }, { "glytoucan_ac": "G18132YR" }, { "glytoucan_ac": "G40269CS" }, { "glytoucan_ac": "G63628AV" }, { "glytoucan_ac": "G29931IJ" }, { "glytoucan_ac": "G45129XM" }, { "glytoucan_ac": "G32550BI" } ], "referenced_proteins": [ { "uniprot_canonical_ac": "P01876-2", "protein_name": "Immunoglobulin heavy constant alpha 1", "gene_name": "IGHA1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P01876", "url": "https://www.uniprot.org/uniprotkb/P01876" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "glycosylation": [ { "glytoucan_ac": "G00031MO", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "1280920", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/1280920" }, { "id": "230", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/230" }, { "id": "2628063", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/2628063" }, { "id": "9442070", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/9442070" }, { "id": "7215351", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/7215351" }, { "id": "20030399", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/20030399" } ], "filter_code": "000000000000000000000.0000000.00000000001000.1000000.1100000000.010100100011111100.10000.01000", "uniprot_canonical_ac": "P01876-2" }, { "glytoucan_ac": "G00033MO", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "7215351", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/7215351" }, { "id": "230", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/230" } ], "filter_code": "000000000000000000000.0000000.00000000001000.1000000.1100000000.010000100001111100.10000.01000", "uniprot_canonical_ac": "P01876-2" }, { "glytoucan_ac": "G29931IJ", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "40667337", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/40667337" }, { "id": "TP5868669", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP5868669" }, { "id": "1280920", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/1280920" }, { "id": "230", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/230" }, { "id": "2628063", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/2628063" }, { "id": "9442070", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/9442070" }, { "id": "7215351", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/7215351" }, { "id": "4373463", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/4373463" }, { "id": "20030399", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/20030399" } ], "filter_code": "000000000000000000000.0000000.00000000001000.1000000.1100000000.110100100011111100.00010.01000", "uniprot_canonical_ac": "P01876-2" }, { "glytoucan_ac": "G32550BI", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "40667337", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/40667337" }, { "id": "TP5868669", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP5868669" }, { "id": "7215351", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/7215351" }, { "id": "230", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/230" } ], "filter_code": "000000000000000000000.0000000.00000000001000.1000000.1100000000.111110100111111111.00010.01000", "uniprot_canonical_ac": "P01876-2" }, { "glytoucan_ac": "G63628AV", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "2737211", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/2737211" }, { "id": "230", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/230" }, { "id": "9442070", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/9442070" }, { "id": "7215351", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/7215351" }, { "id": "20030399", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/20030399" } ], "filter_code": "000000000000000000000.0000000.00000000001000.1000000.1100000000.110110100111111111.00010.01000", "uniprot_canonical_ac": "P01876-2" }, { "glytoucan_ac": "G64973KT", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "2737211", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/2737211" }, { "id": "230", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/230" }, { "id": "7215351", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/7215351" } ], "filter_code": "000000000000000000000.0000000.00000000001000.1000000.1100000000.010100000001111001.10000.01000", "uniprot_canonical_ac": "P01876-2" }, { "glytoucan_ac": "G65562ZE", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "1280920", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/1280920" }, { "id": "230", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/230" }, { "id": "2628063", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/2628063" }, { "id": "9442070", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/9442070" }, { "id": "7215351", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/7215351" } ], "filter_code": "000000000000000000000.0000000.00000000001000.1000000.1100100000.010100000011111011.10000.01000", "uniprot_canonical_ac": "P01876-2" }, { "glytoucan_ac": "G74722FL", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "40667337", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/40667337" }, { "id": "TP5868669", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP5868669" }, { "id": "1280920", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/1280920" }, { "id": "230", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/230" }, { "id": "2628063", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/2628063" }, { "id": "9442070", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/9442070" }, { "id": "7215351", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/7215351" }, { "id": "20030399", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/20030399" } ], "filter_code": "000000000000000000000.0000000.00000000001000.1000000.1100100000.010100000011111111.00100.01000", "uniprot_canonical_ac": "P01876-2" } ], "glycan_expression": [ { "glytoucan_ac": "G00031MO", "abundance": "", "tissue": { "name": "milk", "namespace": "UBERON", "id": "0001913", "url": "http://purl.obolibrary.org/obo/UBERON_0001913" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01876-2" }, { "glytoucan_ac": "G00033MO", "abundance": "", "tissue": { "name": "milk", "namespace": "UBERON", "id": "0001913", "url": "http://purl.obolibrary.org/obo/UBERON_0001913" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01876-2" }, { "glytoucan_ac": "G64973KT", "abundance": "", "tissue": { "name": "milk", "namespace": "UBERON", "id": "0001913", "url": "http://purl.obolibrary.org/obo/UBERON_0001913" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01876-2" }, { "glytoucan_ac": "G65562ZE", "abundance": "", "tissue": { "name": "milk", "namespace": "UBERON", "id": "0001913", "url": "http://purl.obolibrary.org/obo/UBERON_0001913" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01876-2" }, { "glytoucan_ac": "G74722FL", "abundance": "", "tissue": { "name": "milk", "namespace": "UBERON", "id": "0001913", "url": "http://purl.obolibrary.org/obo/UBERON_0001913" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01876-2" }, { "glytoucan_ac": "G18132YR", "abundance": "", "tissue": { "name": "milk", "namespace": "UBERON", "id": "0001913", "url": "http://purl.obolibrary.org/obo/UBERON_0001913" }, "species": { "name": "Bos taurus", "taxid": 9913, "reference_species": "Bos taurus [9913]", "common_name": "Bovine", "glygen_name": "Bovine" }, "cell_line": {} }, { "glytoucan_ac": "G40269CS", "abundance": "", "tissue": { "name": "milk", "namespace": "UBERON", "id": "0001913", "url": "http://purl.obolibrary.org/obo/UBERON_0001913" }, "species": { "name": "Bos taurus", "taxid": 9913, "reference_species": "Bos taurus [9913]", "common_name": "Bovine", "glygen_name": "Bovine" }, "cell_line": {} }, { "glytoucan_ac": "G63628AV", "abundance": "", "tissue": { "name": "milk", "namespace": "UBERON", "id": "0001913", "url": "http://purl.obolibrary.org/obo/UBERON_0001913" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01876-2" }, { "glytoucan_ac": "G29931IJ", "abundance": "", "tissue": { "name": "milk", "namespace": "UBERON", "id": "0001913", "url": "http://purl.obolibrary.org/obo/UBERON_0001913" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01876-2" }, { "glytoucan_ac": "G32550BI", "abundance": "", "tissue": { "name": "milk", "namespace": "UBERON", "id": "0001913", "url": "http://purl.obolibrary.org/obo/UBERON_0001913" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01876-2" } ], "record_id": "pubmed.7215351", "abstract": "", "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 11 } ], "sort_fields": [ "glytoucan_ac" ] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 8 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 1 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 8 }, { "field": "exact_sites", "count": 0 }, { "field": "fuzzy_sites", "count": 1 }, { "field": "fuzzy_o_linked_sites", "count": 1 }, { "field": "fuzzy_o_linked_glycan_sites", "count": 1 }, { "field": "fuzzy_o_linked_glycans", "count": 8 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "filter_code", "uniprot_canonical_ac" ] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 8 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 1 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 8 }, { "field": "exact_sites", "count": 0 }, { "field": "fuzzy_sites", "count": 1 }, { "field": "fuzzy_o_linked_sites", "count": 1 }, { "field": "fuzzy_o_linked_glycan_sites", "count": 1 }, { "field": "fuzzy_o_linked_glycans", "count": 8 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "filter_code", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The primary structure of a monoclonal IgA-immunoglobulin (IgA Tro.), II. The amino acid sequence of the H-chain, alpha-type, subgroup III; structure of the complete IgA-molecule.", "journal": "Hoppe-Seyler's Z. Physiol. Chem.", "date": "1975", "authors": "Kratzin H, Altevogt P, Ruban E, Kortt A, Staroscik K, Hilschmann N", "reference": { "type": "PubMed", "id": "809331", "url": "https://pubmed.ncbi.nlm.nih.gov/809331" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P01876-2", "protein_name": "Immunoglobulin heavy constant alpha 1", "gene_name": "IGHA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01762-1", "protein_name": "Immunoglobulin heavy variable 3-11", "gene_name": "IGHV3-11", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P01876", "url": "https://www.uniprot.org/uniprotkb/P01876" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.809331", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The glycosylation and structure of human serum IgA1, Fab, and Fc regions and the role of N-glycosylation on Fcalpha receptor interactions.", "journal": "The Journal of biological chemistry", "date": "1998", "authors": "Mattu TS, Pleass RJ, Willis AC, Kilian M, Wormald MR, Lellouch AC, Rudd PM, Woof JM, Dwek RA", "reference": { "type": "PubMed", "id": "9442070", "url": "https://pubmed.ncbi.nlm.nih.gov/9442070" }, "referenced_glycans": [ { "glytoucan_ac": "G00031MO" }, { "glytoucan_ac": "G65562ZE" }, { "glytoucan_ac": "G74722FL" }, { "glytoucan_ac": "G81006GJ" }, { "glytoucan_ac": "G77477NL" }, { "glytoucan_ac": "G63628AV" }, { "glytoucan_ac": "G56682BC" }, { "glytoucan_ac": "G01614ZM" }, { "glytoucan_ac": "G29931IJ" } ], "referenced_proteins": [ { "uniprot_canonical_ac": "P01876-2", "protein_name": "Immunoglobulin heavy constant alpha 1", "gene_name": "IGHA1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P01876", "url": "https://www.uniprot.org/uniprotkb/P01876" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "glycosylation": [ { "glytoucan_ac": "", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "automatic_literature_mining", "site_category_dict": { "automatic_literature_mining": true }, "site_seq": "T", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 225, "start_aa": "Thr", "end_pos": 225, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr225", "evidence": [ { "id": "9442070", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/9442070" }, { "id": "GLY_000481", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000481" }, { "id": "30570353", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30570353" } ], "mining_tool": "GlycoSiteMiner_1.0", "mining_tool_list": [ { "label": "GlycoSiteMiner_1.0" } ], "filter_code": "000000000000000010000.00000000001000.00.01000", "uniprot_canonical_ac": "P01876-2" }, { "glytoucan_ac": "G00031MO", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "1280920", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/1280920" }, { "id": "230", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/230" }, { "id": "2628063", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/2628063" }, { "id": "9442070", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/9442070" }, { "id": "7215351", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/7215351" }, { "id": "20030399", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/20030399" } ], "filter_code": "000000000000000000000.0000000.00000000001000.1000000.1100000000.010100100011111100.10000.01000", "uniprot_canonical_ac": "P01876-2" }, { "glytoucan_ac": "G01614ZM", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "1280920", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/1280920" }, { "id": "230", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/230" }, { "id": "2628063", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/2628063" }, { "id": "9442070", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/9442070" } ], "filter_code": "000000000000000000000.0000000.00000000001000.1000000.1100100000.010000000011111001.10000.01000", "uniprot_canonical_ac": "P01876-2" }, { "glytoucan_ac": "G29931IJ", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "40667337", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/40667337" }, { "id": "TP5868669", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP5868669" }, { "id": "1280920", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/1280920" }, { "id": "230", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/230" }, { "id": "2628063", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/2628063" }, { "id": "9442070", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/9442070" }, { "id": "7215351", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/7215351" }, { "id": "4373463", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/4373463" }, { "id": "20030399", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/20030399" } ], "filter_code": "000000000000000000000.0000000.00000000001000.1000000.1100000000.110100100011111100.00010.01000", "uniprot_canonical_ac": "P01876-2" }, { "glytoucan_ac": "G56682BC", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "9442070", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/9442070" }, { "id": "230", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/230" } ], "filter_code": "000000000000000000000.0000000.00000000001000.1000000.1100100000.010100000011111001.10000.01000", "uniprot_canonical_ac": "P01876-2" }, { "glytoucan_ac": "G63628AV", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "2737211", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/2737211" }, { "id": "230", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/230" }, { "id": "9442070", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/9442070" }, { "id": "7215351", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/7215351" }, { "id": "20030399", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/20030399" } ], "filter_code": "000000000000000000000.0000000.00000000001000.1000000.1100000000.110110100111111111.00010.01000", "uniprot_canonical_ac": "P01876-2" }, { "glytoucan_ac": "G65562ZE", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "1280920", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/1280920" }, { "id": "230", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/230" }, { "id": "2628063", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/2628063" }, { "id": "9442070", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/9442070" }, { "id": "7215351", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/7215351" } ], "filter_code": "000000000000000000000.0000000.00000000001000.1000000.1100100000.010100000011111011.10000.01000", "uniprot_canonical_ac": "P01876-2" }, { "glytoucan_ac": "G74722FL", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "40667337", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/40667337" }, { "id": "TP5868669", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP5868669" }, { "id": "1280920", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/1280920" }, { "id": "230", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/230" }, { "id": "2628063", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/2628063" }, { "id": "9442070", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/9442070" }, { "id": "7215351", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/7215351" }, { "id": "20030399", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/20030399" } ], "filter_code": "000000000000000000000.0000000.00000000001000.1000000.1100100000.010100000011111111.00100.01000", "uniprot_canonical_ac": "P01876-2" }, { "glytoucan_ac": "G77477NL", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "9442070", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/9442070" }, { "id": "230", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/230" } ], "filter_code": "000000000000000000000.0000000.00000000001000.1000000.1100000000.000000000001010000.10000.01000", "uniprot_canonical_ac": "P01876-2" }, { "glytoucan_ac": "G81006GJ", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "40667337", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/40667337" }, { "id": "TP5868669", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP5868669" }, { "id": "1280920", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/1280920" }, { "id": "230", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/230" }, { "id": "2628063", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/2628063" }, { "id": "9442070", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/9442070" }, { "id": "20030399", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/20030399" } ], "filter_code": "000000000000000000000.0000000.00000000001000.1000000.1100100000.010000000011111101.00100.01000", "uniprot_canonical_ac": "P01876-2" } ], "glycan_expression": [ { "glytoucan_ac": "G00031MO", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01876-2" }, { "glytoucan_ac": "G65562ZE", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01876-2" }, { "glytoucan_ac": "G74722FL", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01876-2" }, { "glytoucan_ac": "G81006GJ", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01876-2" }, { "glytoucan_ac": "G77477NL", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01876-2" }, { "glytoucan_ac": "G63628AV", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01876-2" }, { "glytoucan_ac": "G56682BC", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01876-2" }, { "glytoucan_ac": "G01614ZM", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01876-2" }, { "glytoucan_ac": "G29931IJ", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01876-2" } ], "record_id": "pubmed.9442070", "abstract": "", "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 9 } ], "sort_fields": [ "glytoucan_ac" ] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 10 }, { "field": "total_sites", "count": 2 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 2 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 9 }, { "field": "exact_sites", "count": 1 }, { "field": "exact_o_linked_sites", "count": 1 }, { "field": "fuzzy_sites", "count": 1 }, { "field": "fuzzy_o_linked_sites", "count": 1 }, { "field": "fuzzy_o_linked_glycan_sites", "count": 1 }, { "field": "fuzzy_o_linked_glycans", "count": 9 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl", "mining_tool", "filter_code", "uniprot_canonical_ac" ] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 9 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 1 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 9 }, { "field": "exact_sites", "count": 0 }, { "field": "fuzzy_sites", "count": 1 }, { "field": "fuzzy_o_linked_sites", "count": 1 }, { "field": "fuzzy_o_linked_glycan_sites", "count": 1 }, { "field": "fuzzy_o_linked_glycans", "count": 9 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl", "mining_tool", "filter_code", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 1 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "exact_sites", "count": 1 }, { "field": "exact_o_linked_sites", "count": 1 }, { "field": "fuzzy_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl", "mining_tool", "filter_code", "uniprot_canonical_ac" ] } ] }, { "title": "Immunoglobulin D: properties, measurement, and clinical relevance.", "journal": "Clinical and diagnostic laboratory immunology", "date": "2000-03", "authors": "Vladutiu A O", "reference": { "type": "PubMed", "id": "10702483", "url": "https://pubmed.ncbi.nlm.nih.gov/10702483" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P01880-2", "protein_name": "Immunoglobulin heavy constant delta", "gene_name": "IGHD", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P01880", "url": "https://www.uniprot.org/uniprotkb/P01880" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.10702483", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Structural and functional properties of membrane and secreted IgD.", "journal": "Molecular immunology", "date": "2000-10", "authors": "Preud'homme J L, Petit I, Barra A, Morel F, Lecron J C, Leli\u00e8vre E", "reference": { "type": "PubMed", "id": "11282392", "url": "https://pubmed.ncbi.nlm.nih.gov/11282392" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P01880-2", "protein_name": "Immunoglobulin heavy constant delta", "gene_name": "IGHD", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P01880", "url": "https://www.uniprot.org/uniprotkb/P01880" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.11282392", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The glycosylation of human serum IgD and IgE and the accessibility of identified oligomannose structures for interaction with mannan-binding lectin.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "2004", "authors": "Arnold JN, Radcliffe CM, Wormald MR, Royle L, Harvey DJ, Crispin M, Dwek RA, Sim RB, Rudd PM", "reference": { "type": "PubMed", "id": "15557177", "url": "https://pubmed.ncbi.nlm.nih.gov/15557177" }, "referenced_glycans": [ { "glytoucan_ac": "G00031MO" }, { "glytoucan_ac": "G79568CQ" }, { "glytoucan_ac": "G82020ZR" }, { "glytoucan_ac": "G43157UW" }, { "glytoucan_ac": "G26403SG" }, { "glytoucan_ac": "G72667IM" }, { "glytoucan_ac": "G95368PR" }, { "glytoucan_ac": "G65562ZE" }, { "glytoucan_ac": "G66538GV" }, { "glytoucan_ac": "G24835MQ" }, { "glytoucan_ac": "G12708JQ" }, { "glytoucan_ac": "G74722FL" }, { "glytoucan_ac": "G66676MI" }, { "glytoucan_ac": "G66760KM" }, { "glytoucan_ac": "G60145BJ" }, { "glytoucan_ac": "G61627IG" }, { "glytoucan_ac": "G91473PK" }, { "glytoucan_ac": "G91636VS" }, { "glytoucan_ac": "G80966KZ" }, { "glytoucan_ac": "G81006GJ" }, { "glytoucan_ac": "G81295CK" }, { "glytoucan_ac": "G05724UK" }, { "glytoucan_ac": "G06110VR" }, { "glytoucan_ac": "G06356OH" }, { "glytoucan_ac": "G84452RH" }, { "glytoucan_ac": "G22140GZ" }, { "glytoucan_ac": "G22310AV" }, { "glytoucan_ac": "G33609NS" }, { "glytoucan_ac": "G70101JE" }, { "glytoucan_ac": "G64527OM" }, { "glytoucan_ac": "G56682BC" }, { "glytoucan_ac": "G56903ZB" }, { "glytoucan_ac": "G57818FI" }, { "glytoucan_ac": "G01614ZM" }, { "glytoucan_ac": "G02030ZB" }, { "glytoucan_ac": "G03127AL" }, { "glytoucan_ac": "G94854LT" }, { "glytoucan_ac": "G50045TK" }, { "glytoucan_ac": "G27993JQ" }, { "glytoucan_ac": "G46687AB" }, { "glytoucan_ac": "G47909JD" }, { "glytoucan_ac": "G03382KH" }, { "glytoucan_ac": "G55052CN" }, { "glytoucan_ac": "G55220VL" }, { "glytoucan_ac": "G48414YA" }, { "glytoucan_ac": "G49874UX" }, { "glytoucan_ac": "G29880MM" }, { "glytoucan_ac": "G29931IJ" }, { "glytoucan_ac": "G39188ZX" }, { "glytoucan_ac": "G23432EQ" }, { "glytoucan_ac": "G23453IV" }, { "glytoucan_ac": "G23863VK" }, { "glytoucan_ac": "G75798PH" }, { "glytoucan_ac": "G68698AP" }, { "glytoucan_ac": "G61937QU" } ], "referenced_proteins": [ { "uniprot_canonical_ac": "P01880-2", "protein_name": "Immunoglobulin heavy constant delta", "gene_name": "IGHD", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01854-2", "protein_name": "Immunoglobulin heavy constant epsilon", "gene_name": "IGHE", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P01880", "url": "https://www.uniprot.org/uniprotkb/P01880" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "glycosylation": [ { "glytoucan_ac": "G00031MO", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "15557177", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/15557177" }, { "id": "1943", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1943" } ], "filter_code": "000000000000000000000.0000000.00000000001000.1000000.1100000000.010100100011111100.10000.01000", "uniprot_canonical_ac": "P01880-2" }, { "glytoucan_ac": "G01614ZM", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "15557177", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/15557177" }, { "id": "1943", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1943" } ], "filter_code": "000000000000000000000.0000000.00000000001000.1000000.1100100000.010000000011111001.10000.01000", "uniprot_canonical_ac": "P01880-2" }, { "glytoucan_ac": "G02030ZB", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "15557177", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/15557177" }, { "id": "1943", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1943" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0010000.1110100000.000111000001111101.00100.01000", "uniprot_canonical_ac": "P01880-2" }, { "glytoucan_ac": "G03382KH", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "15557177", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/15557177" }, { "id": "1943", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1943" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0100000.1110000000.010111000001111101.00010.01000", "uniprot_canonical_ac": "P01880-2" }, { "glytoucan_ac": "G05724UK", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "15557177", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/15557177" }, { "id": "1943", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1943" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0100000.1100000000.110111100011111110.00010.01000", "uniprot_canonical_ac": "P01880-2" }, { "glytoucan_ac": "G06110VR", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "15557177", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/15557177" }, { "id": "1943", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1943" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0100000.1100000000.110111100011111111.00010.01000", "uniprot_canonical_ac": "P01880-2" }, { "glytoucan_ac": "G06356OH", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "15557177", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/15557177" }, { "id": "1943", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1943" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0100000.1100100000.010111000011111101.00100.01000", "uniprot_canonical_ac": "P01880-2" }, { "glytoucan_ac": "G12708JQ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "15557177", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/15557177" }, { "id": "1943", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1943" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0010000.1110100000.010100000001011000.00001.01000", "uniprot_canonical_ac": "P01880-2" }, { "glytoucan_ac": "G22140GZ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "15557177", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/15557177" }, { "id": "1943", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1943" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0100000.1100000000.010100000001111100.00001.01000", "uniprot_canonical_ac": "P01880-2" }, { "glytoucan_ac": "G22310AV", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "15557177", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/15557177" }, { "id": "1943", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1943" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0010000.1110100000.010111000011111101.00100.01000", "uniprot_canonical_ac": "P01880-2" }, { "glytoucan_ac": "G23432EQ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "15557177", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/15557177" }, { "id": "1943", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1943" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0100000.1100000000.010111000001101100.00010.01000", "uniprot_canonical_ac": "P01880-2" }, { "glytoucan_ac": "G23453IV", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "15557177", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/15557177" }, { "id": "1943", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1943" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0100000.1100000000.010111100011111101.00010.01000", "uniprot_canonical_ac": "P01880-2" }, { "glytoucan_ac": "G23863VK", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "15557177", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/15557177" }, { "id": "1943", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1943" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0100000.1110000000.010111100011111101.00010.01000", "uniprot_canonical_ac": "P01880-2" }, { "glytoucan_ac": "G24835MQ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "15557177", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/15557177" }, { "id": "1943", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1943" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0100000.1100100000.010010000001101100.00100.01000", "uniprot_canonical_ac": "P01880-2" }, { "glytoucan_ac": "G26403SG", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "15557177", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/15557177" }, { "id": "1943", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1943" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0010000.1100100000.000011000001001100.00100.01000", "uniprot_canonical_ac": "P01880-2" }, { "glytoucan_ac": "G27993JQ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "15557177", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/15557177" }, { "id": "1943", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1943" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0100000.1100000000.010100000001101000.00001.01000", "uniprot_canonical_ac": "P01880-2" }, { "glytoucan_ac": "G29880MM", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "15557177", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/15557177" }, { "id": "1943", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1943" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0100000.1110000000.010111100001111100.00010.01000", "uniprot_canonical_ac": "P01880-2" }, { "glytoucan_ac": "G29931IJ", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "15557177", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/15557177" }, { "id": "1943", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1943" } ], "filter_code": "000000000000000000000.0000000.00000000001000.1000000.1100000000.110100100011111100.00010.01000", "uniprot_canonical_ac": "P01880-2" }, { "glytoucan_ac": "G39188ZX", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "15557177", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/15557177" }, { "id": "1943", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1943" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0100000.1100000000.111111100011111110.00010.01000", "uniprot_canonical_ac": "P01880-2" }, { "glytoucan_ac": "G43157UW", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "15557177", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/15557177" }, { "id": "1943", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1943" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0100000.1100000000.010100000001111100.00001.01000", "uniprot_canonical_ac": "P01880-2" }, { "glytoucan_ac": "G46687AB", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "15557177", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/15557177" }, { "id": "1943", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1943" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0100000.1110000000.010111100011111101.00010.01000", "uniprot_canonical_ac": "P01880-2" }, { "glytoucan_ac": "G48414YA", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "15557177", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/15557177" }, { "id": "1943", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1943" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0010000.1100100000.010111000011111100.00100.01000", "uniprot_canonical_ac": "P01880-2" }, { "glytoucan_ac": "G49874UX", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "15557177", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/15557177" }, { "id": "1943", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1943" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0100000.1110000000.010111100011111101.00010.01000", "uniprot_canonical_ac": "P01880-2" }, { "glytoucan_ac": "G50045TK", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "15557177", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/15557177" }, { "id": "1943", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1943" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0100000.1100000000.010111100011111101.00010.01000", "uniprot_canonical_ac": "P01880-2" }, { "glytoucan_ac": "G55052CN", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "15557177", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/15557177" }, { "id": "1943", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1943" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0100000.1100000000.010100000001001000.00001.01000", "uniprot_canonical_ac": "P01880-2" }, { "glytoucan_ac": "G55220VL", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "15557177", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/15557177" }, { "id": "1943", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1943" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0100000.1100000000.110100100011111110.10000.01000", "uniprot_canonical_ac": "P01880-2" }, { "glytoucan_ac": "G56682BC", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "15557177", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/15557177" }, { "id": "1943", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1943" } ], "filter_code": "000000000000000000000.0000000.00000000001000.1000000.1100100000.010100000011111001.10000.01000", "uniprot_canonical_ac": "P01880-2" }, { "glytoucan_ac": "G56903ZB", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "15557177", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/15557177" }, { "id": "1943", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1943" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0100000.1110000000.010100100001111100.00001.01000", "uniprot_canonical_ac": "P01880-2" }, { "glytoucan_ac": "G57818FI", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "15557177", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/15557177" }, { "id": "1943", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1943" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0100000.1110000000.010100000001111100.00001.01000", "uniprot_canonical_ac": "P01880-2" }, { "glytoucan_ac": "G61627IG", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "15557177", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/15557177" }, { "id": "1943", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1943" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0100000.1110000000.010100000001111100.00001.01000", "uniprot_canonical_ac": "P01880-2" }, { "glytoucan_ac": "G61937QU", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "15557177", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/15557177" }, { "id": "1943", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1943" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0100000.1110000000.010100000001111100.00001.01000", "uniprot_canonical_ac": "P01880-2" }, { "glytoucan_ac": "G64527OM", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "15557177", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/15557177" }, { "id": "1943", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1943" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0100000.1100000000.110111100011111111.00010.01000", "uniprot_canonical_ac": "P01880-2" }, { "glytoucan_ac": "G65562ZE", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "15557177", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/15557177" }, { "id": "1943", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1943" } ], "filter_code": "000000000000000000000.0000000.00000000001000.1000000.1100100000.010100000011111011.10000.01000", "uniprot_canonical_ac": "P01880-2" }, { "glytoucan_ac": "G66676MI", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "15557177", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/15557177" }, { "id": "1943", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1943" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0100000.1100000000.110100100001111110.00001.01000", "uniprot_canonical_ac": "P01880-2" }, { "glytoucan_ac": "G66760KM", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "15557177", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/15557177" }, { "id": "1943", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1943" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0010000.1100100000.000111000001100100.00100.01000", "uniprot_canonical_ac": "P01880-2" }, { "glytoucan_ac": "G68698AP", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "15557177", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/15557177" }, { "id": "1943", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1943" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0100000.1110000000.000100000001110100.00001.01000", "uniprot_canonical_ac": "P01880-2" }, { "glytoucan_ac": "G70101JE", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "15557177", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/15557177" }, { "id": "1943", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1943" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0100000.1100000000.110111100001111110.00010.01000", "uniprot_canonical_ac": "P01880-2" }, { "glytoucan_ac": "G72667IM", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "15557177", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/15557177" }, { "id": "1943", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1943" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0010000.1110100000.000111000001111101.00100.01000", "uniprot_canonical_ac": "P01880-2" }, { "glytoucan_ac": "G74722FL", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "15557177", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/15557177" }, { "id": "1943", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1943" } ], "filter_code": "000000000000000000000.0000000.00000000001000.1000000.1100100000.010100000011111111.00100.01000", "uniprot_canonical_ac": "P01880-2" }, { "glytoucan_ac": "G75798PH", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "15557177", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/15557177" }, { "id": "1943", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1943" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0100000.1100000000.010000000001101000.00001.01000", "uniprot_canonical_ac": "P01880-2" }, { "glytoucan_ac": "G79568CQ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "15557177", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/15557177" }, { "id": "1943", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1943" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0100000.1100000000.010111000001111100.00010.01000", "uniprot_canonical_ac": "P01880-2" }, { "glytoucan_ac": "G80966KZ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "15557177", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/15557177" }, { "id": "1943", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1943" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0100000.1100000000.110100100001111100.10000.01000", "uniprot_canonical_ac": "P01880-2" }, { "glytoucan_ac": "G81006GJ", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "15557177", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/15557177" }, { "id": "1943", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1943" } ], "filter_code": "000000000000000000000.0000000.00000000001000.1000000.1100100000.010000000011111101.00100.01000", "uniprot_canonical_ac": "P01880-2" }, { "glytoucan_ac": "G81295CK", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "15557177", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/15557177" }, { "id": "1943", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1943" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0100000.1100000000.010111100011111101.00010.01000", "uniprot_canonical_ac": "P01880-2" }, { "glytoucan_ac": "G82020ZR", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "15557177", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/15557177" }, { "id": "1943", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1943" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0100000.1100000000.010100100001111100.00001.01000", "uniprot_canonical_ac": "P01880-2" }, { "glytoucan_ac": "G84452RH", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "15557177", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/15557177" }, { "id": "1943", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1943" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0010000.1110100000.010111000011111101.00100.01000", "uniprot_canonical_ac": "P01880-2" }, { "glytoucan_ac": "G91473PK", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "15557177", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/15557177" }, { "id": "1943", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1943" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0010000.1110100000.000110000001101100.00100.01000", "uniprot_canonical_ac": "P01880-2" }, { "glytoucan_ac": "G91636VS", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "15557177", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/15557177" }, { "id": "1943", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1943" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0100000.1110000000.010111000001111101.00010.01000", "uniprot_canonical_ac": "P01880-2" }, { "glytoucan_ac": "G02030ZB", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "15557177", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/15557177" }, { "id": "765", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/765" }, { "id": "24698316", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24698316" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0010000.1110100000.000111000001111101.00100.01000", "uniprot_canonical_ac": "P01854-2" }, { "glytoucan_ac": "G03127AL", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "15557177", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/15557177" }, { "id": "765", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/765" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0100000.1110000000.000000100011111100.00001.01000", "uniprot_canonical_ac": "P01854-2" }, { "glytoucan_ac": "G05724UK", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "24698316", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24698316" }, { "id": "765", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/765" }, { "id": "15557177", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/15557177" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0100000.1100000000.110111100011111110.00010.01000", "uniprot_canonical_ac": "P01854-2" }, { "glytoucan_ac": "G06110VR", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "15557177", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/15557177" }, { "id": "765", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/765" }, { "id": "24698316", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24698316" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0100000.1100000000.110111100011111111.00010.01000", "uniprot_canonical_ac": "P01854-2" }, { "glytoucan_ac": "G06356OH", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "24698316", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24698316" }, { "id": "765", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/765" }, { "id": "15557177", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/15557177" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0100000.1100100000.010111000011111101.00100.01000", "uniprot_canonical_ac": "P01854-2" }, { "glytoucan_ac": "G12708JQ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "15557177", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/15557177" }, { "id": "765", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/765" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0010000.1110100000.010100000001011000.00001.01000", "uniprot_canonical_ac": "P01854-2" }, { "glytoucan_ac": "G22140GZ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "15557177", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/15557177" }, { "id": "765", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/765" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0100000.1100000000.010100000001111100.00001.01000", "uniprot_canonical_ac": "P01854-2" }, { "glytoucan_ac": "G22310AV", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "4361831", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/4361831" }, { "id": "765", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/765" }, { "id": "15557177", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/15557177" }, { "id": "24698316", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24698316" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0010000.1110100000.010111000011111101.00100.01000", "uniprot_canonical_ac": "P01854-2" }, { "glytoucan_ac": "G23453IV", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "15557177", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/15557177" }, { "id": "765", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/765" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0100000.1100000000.010111100011111101.00010.01000", "uniprot_canonical_ac": "P01854-2" }, { "glytoucan_ac": "G23863VK", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "15557177", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/15557177" }, { "id": "765", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/765" }, { "id": "24698316", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24698316" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0100000.1110000000.010111100011111101.00010.01000", "uniprot_canonical_ac": "P01854-2" }, { "glytoucan_ac": "G27993JQ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "15557177", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/15557177" }, { "id": "765", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/765" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0100000.1100000000.010100000001101000.00001.01000", "uniprot_canonical_ac": "P01854-2" }, { "glytoucan_ac": "G29880MM", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "15557177", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/15557177" }, { "id": "765", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/765" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0100000.1110000000.010111100001111100.00010.01000", "uniprot_canonical_ac": "P01854-2" }, { "glytoucan_ac": "G33609NS", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "15557177", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/15557177" }, { "id": "765", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/765" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0100000.1100000000.010111100011111101.00010.01000", "uniprot_canonical_ac": "P01854-2" }, { "glytoucan_ac": "G39188ZX", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "4361830", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/4361830" }, { "id": "765", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/765" }, { "id": "24698316", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24698316" }, { "id": "15557177", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/15557177" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0100000.1100000000.111111100011111110.00010.01000", "uniprot_canonical_ac": "P01854-2" }, { "glytoucan_ac": "G43157UW", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "15557177", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/15557177" }, { "id": "765", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/765" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0100000.1100000000.010100000001111100.00001.01000", "uniprot_canonical_ac": "P01854-2" }, { "glytoucan_ac": "G46687AB", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "15557177", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/15557177" }, { "id": "765", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/765" }, { "id": "24698316", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24698316" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0100000.1110000000.010111100011111101.00010.01000", "uniprot_canonical_ac": "P01854-2" }, { "glytoucan_ac": "G47909JD", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "15557177", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/15557177" }, { "id": "765", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/765" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0100000.1100000000.110100100011111101.00001.01000", "uniprot_canonical_ac": "P01854-2" }, { "glytoucan_ac": "G48414YA", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "24698316", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24698316" }, { "id": "765", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/765" }, { "id": "15557177", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/15557177" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0010000.1100100000.010111000011111100.00100.01000", "uniprot_canonical_ac": "P01854-2" }, { "glytoucan_ac": "G50045TK", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "15557177", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/15557177" }, { "id": "765", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/765" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0100000.1100000000.010111100011111101.00010.01000", "uniprot_canonical_ac": "P01854-2" }, { "glytoucan_ac": "G55220VL", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "15557177", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/15557177" }, { "id": "765", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/765" }, { "id": "24698316", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24698316" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0100000.1100000000.110100100011111110.10000.01000", "uniprot_canonical_ac": "P01854-2" }, { "glytoucan_ac": "G57818FI", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "15557177", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/15557177" }, { "id": "765", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/765" }, { "id": "24698316", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24698316" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0100000.1110000000.010100000001111100.00001.01000", "uniprot_canonical_ac": "P01854-2" }, { "glytoucan_ac": "G60145BJ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "15557177", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/15557177" }, { "id": "765", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/765" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0100000.1100000000.010111100011111100.00010.01000", "uniprot_canonical_ac": "P01854-2" }, { "glytoucan_ac": "G61627IG", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "24698316", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24698316" }, { "id": "765", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/765" }, { "id": "15557177", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/15557177" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0100000.1110000000.010100000001111100.00001.01000", "uniprot_canonical_ac": "P01854-2" }, { "glytoucan_ac": "G61937QU", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "15557177", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/15557177" }, { "id": "765", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/765" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0100000.1110000000.010100000001111100.00001.01000", "uniprot_canonical_ac": "P01854-2" }, { "glytoucan_ac": "G64527OM", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "15557177", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/15557177" }, { "id": "765", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/765" }, { "id": "24698316", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24698316" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0100000.1100000000.110111100011111111.00010.01000", "uniprot_canonical_ac": "P01854-2" }, { "glytoucan_ac": "G66538GV", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "15557177", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/15557177" }, { "id": "765", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/765" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0100000.1100000000.110111100011111101.00010.01000", "uniprot_canonical_ac": "P01854-2" }, { "glytoucan_ac": "G66676MI", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "15557177", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/15557177" }, { "id": "765", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/765" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0100000.1100000000.110100100001111110.00001.01000", "uniprot_canonical_ac": "P01854-2" }, { "glytoucan_ac": "G66760KM", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "15557177", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/15557177" }, { "id": "765", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/765" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0010000.1100100000.000111000001100100.00100.01000", "uniprot_canonical_ac": "P01854-2" }, { "glytoucan_ac": "G68698AP", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "15557177", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/15557177" }, { "id": "765", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/765" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0100000.1110000000.000100000001110100.00001.01000", "uniprot_canonical_ac": "P01854-2" }, { "glytoucan_ac": "G75798PH", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "15557177", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/15557177" }, { "id": "765", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/765" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0100000.1100000000.010000000001101000.00001.01000", "uniprot_canonical_ac": "P01854-2" }, { "glytoucan_ac": "G79568CQ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "15557177", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/15557177" }, { "id": "765", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/765" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0100000.1100000000.010111000001111100.00010.01000", "uniprot_canonical_ac": "P01854-2" }, { "glytoucan_ac": "G80966KZ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "15557177", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/15557177" }, { "id": "765", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/765" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0100000.1100000000.110100100001111100.10000.01000", "uniprot_canonical_ac": "P01854-2" }, { "glytoucan_ac": "G81295CK", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "15557177", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/15557177" }, { "id": "765", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/765" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0100000.1100000000.010111100011111101.00010.01000", "uniprot_canonical_ac": "P01854-2" }, { "glytoucan_ac": "G82020ZR", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "15557177", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/15557177" }, { "id": "765", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/765" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0100000.1100000000.010100100001111100.00001.01000", "uniprot_canonical_ac": "P01854-2" }, { "glytoucan_ac": "G84452RH", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "4361831", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/4361831" }, { "id": "765", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/765" }, { "id": "15557177", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/15557177" }, { "id": "24698316", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24698316" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0010000.1110100000.010111000011111101.00100.01000", "uniprot_canonical_ac": "P01854-2" }, { "glytoucan_ac": "G91636VS", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "24698316", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24698316" }, { "id": "765", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/765" }, { "id": "15557177", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/15557177" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0100000.1110000000.010111000001111101.00010.01000", "uniprot_canonical_ac": "P01854-2" }, { "glytoucan_ac": "G94854LT", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "15557177", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/15557177" }, { "id": "765", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/765" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0100000.1110000000.010011100011111101.00010.01000", "uniprot_canonical_ac": "P01854-2" }, { "glytoucan_ac": "G95368PR", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "15557177", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/15557177" }, { "id": "765", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/765" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0100000.1100000000.010100100001101100.00001.01000", "uniprot_canonical_ac": "P01854-2" } ], "glycan_expression": [ { "glytoucan_ac": "G00031MO", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01880-2" }, { "glytoucan_ac": "G79568CQ", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01880-2" }, { "glytoucan_ac": "G79568CQ", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01854-2" }, { "glytoucan_ac": "G82020ZR", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01880-2" }, { "glytoucan_ac": "G82020ZR", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01854-2" }, { "glytoucan_ac": "G43157UW", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01880-2" }, { "glytoucan_ac": "G43157UW", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01854-2" }, { "glytoucan_ac": "G26403SG", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01880-2" }, { "glytoucan_ac": "G72667IM", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01880-2" }, { "glytoucan_ac": "G95368PR", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01854-2" }, { "glytoucan_ac": "G65562ZE", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01880-2" }, { "glytoucan_ac": "G66538GV", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01854-2" }, { "glytoucan_ac": "G24835MQ", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01880-2" }, { "glytoucan_ac": "G12708JQ", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01880-2" }, { "glytoucan_ac": "G12708JQ", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01854-2" }, { "glytoucan_ac": "G74722FL", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01880-2" }, { "glytoucan_ac": "G66676MI", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01880-2" }, { "glytoucan_ac": "G66676MI", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01854-2" }, { "glytoucan_ac": "G66760KM", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01880-2" }, { "glytoucan_ac": "G66760KM", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01854-2" }, { "glytoucan_ac": "G60145BJ", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01854-2" }, { "glytoucan_ac": "G61627IG", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01854-2" }, { "glytoucan_ac": "G61627IG", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01880-2" }, { "glytoucan_ac": "G91473PK", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01880-2" }, { "glytoucan_ac": "G91636VS", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01854-2" }, { "glytoucan_ac": "G91636VS", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01880-2" }, { "glytoucan_ac": "G80966KZ", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01880-2" }, { "glytoucan_ac": "G80966KZ", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01854-2" }, { "glytoucan_ac": "G81006GJ", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01880-2" }, { "glytoucan_ac": "G81295CK", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01880-2" }, { "glytoucan_ac": "G81295CK", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01854-2" }, { "glytoucan_ac": "G05724UK", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01880-2" }, { "glytoucan_ac": "G05724UK", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01854-2" }, { "glytoucan_ac": "G06110VR", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01880-2" }, { "glytoucan_ac": "G06110VR", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01854-2" }, { "glytoucan_ac": "G06356OH", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01854-2" }, { "glytoucan_ac": "G06356OH", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01880-2" }, { "glytoucan_ac": "G84452RH", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01880-2" }, { "glytoucan_ac": "G84452RH", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01854-2" }, { "glytoucan_ac": "G22140GZ", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01854-2" }, { "glytoucan_ac": "G22140GZ", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01880-2" }, { "glytoucan_ac": "G22310AV", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01880-2" }, { "glytoucan_ac": "G22310AV", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01854-2" }, { "glytoucan_ac": "G33609NS", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01854-2" }, { "glytoucan_ac": "G70101JE", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01880-2" }, { "glytoucan_ac": "G64527OM", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01880-2" }, { "glytoucan_ac": "G64527OM", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01854-2" }, { "glytoucan_ac": "G56682BC", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01880-2" }, { "glytoucan_ac": "G56903ZB", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01880-2" }, { "glytoucan_ac": "G57818FI", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01880-2" }, { "glytoucan_ac": "G57818FI", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01854-2" }, { "glytoucan_ac": "G01614ZM", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01880-2" }, { "glytoucan_ac": "G02030ZB", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01880-2" }, { "glytoucan_ac": "G02030ZB", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01854-2" }, { "glytoucan_ac": "G03127AL", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01854-2" }, { "glytoucan_ac": "G94854LT", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01854-2" }, { "glytoucan_ac": "G50045TK", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01854-2" }, { "glytoucan_ac": "G50045TK", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01880-2" }, { "glytoucan_ac": "G27993JQ", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01880-2" }, { "glytoucan_ac": "G27993JQ", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01854-2" }, { "glytoucan_ac": "G46687AB", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01880-2" }, { "glytoucan_ac": "G46687AB", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01854-2" }, { "glytoucan_ac": "G47909JD", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01854-2" }, { "glytoucan_ac": "G03382KH", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01880-2" }, { "glytoucan_ac": "G55052CN", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01880-2" }, { "glytoucan_ac": "G55220VL", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01880-2" }, { "glytoucan_ac": "G55220VL", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01854-2" }, { "glytoucan_ac": "G48414YA", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01880-2" }, { "glytoucan_ac": "G48414YA", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01854-2" }, { "glytoucan_ac": "G49874UX", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01880-2" }, { "glytoucan_ac": "G29880MM", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01880-2" }, { "glytoucan_ac": "G29880MM", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01854-2" }, { "glytoucan_ac": "G29931IJ", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01880-2" }, { "glytoucan_ac": "G39188ZX", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01880-2" }, { "glytoucan_ac": "G39188ZX", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01854-2" }, { "glytoucan_ac": "G23432EQ", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01880-2" }, { "glytoucan_ac": "G23453IV", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01880-2" }, { "glytoucan_ac": "G23453IV", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01854-2" }, { "glytoucan_ac": "G23863VK", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01880-2" }, { "glytoucan_ac": "G23863VK", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01854-2" }, { "glytoucan_ac": "G75798PH", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01880-2" }, { "glytoucan_ac": "G75798PH", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01854-2" }, { "glytoucan_ac": "G68698AP", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01880-2" }, { "glytoucan_ac": "G68698AP", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01854-2" }, { "glytoucan_ac": "G61937QU", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01880-2" }, { "glytoucan_ac": "G61937QU", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01854-2" } ], "record_id": "pubmed.15557177", "abstract": "", "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 55 } ], "sort_fields": [ "glytoucan_ac" ] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 86 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_sites", "count": 1 }, { "field": "o_linked_sites", "count": 1 }, { "field": "n_linked_glycan_sites", "count": 1 }, { "field": "o_linked_glycan_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 48 }, { "field": "o_linked_glycans", "count": 7 }, { "field": "exact_sites", "count": 0 }, { "field": "fuzzy_sites", "count": 1 }, { "field": "fuzzy_o_linked_sites", "count": 1 }, { "field": "fuzzy_o_linked_glycan_sites", "count": 1 }, { "field": "fuzzy_o_linked_glycans", "count": 7 }, { "field": "fuzzy_n_linked_sites", "count": 1 }, { "field": "fuzzy_n_linked_glycan_sites", "count": 1 }, { "field": "fuzzy_n_linked_glycans", "count": 48 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "filter_code", "uniprot_canonical_ac" ] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 86 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_sites", "count": 1 }, { "field": "o_linked_sites", "count": 1 }, { "field": "n_linked_glycan_sites", "count": 1 }, { "field": "o_linked_glycan_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 48 }, { "field": "o_linked_glycans", "count": 7 }, { "field": "exact_sites", "count": 0 }, { "field": "fuzzy_sites", "count": 1 }, { "field": "fuzzy_o_linked_sites", "count": 1 }, { "field": "fuzzy_o_linked_glycan_sites", "count": 1 }, { "field": "fuzzy_o_linked_glycans", "count": 7 }, { "field": "fuzzy_n_linked_sites", "count": 1 }, { "field": "fuzzy_n_linked_glycan_sites", "count": 1 }, { "field": "fuzzy_n_linked_glycans", "count": 48 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "filter_code", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The human immunoglobulin C mu-C delta locus: complete nucleotide sequence and structural analysis.", "journal": "Int. Immunol.", "date": "1989", "authors": "Word C J, White M B, Kuziel W A, Shen A L, Blattner F R, Tucker P W", "reference": { "type": "PubMed", "id": "2518659", "url": "https://pubmed.ncbi.nlm.nih.gov/2518659" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P01880-2", "protein_name": "Immunoglobulin heavy constant delta", "gene_name": "IGHD", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P01880", "url": "https://www.uniprot.org/uniprotkb/P01880" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.2518659", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Human immunoglobulin D: genomic sequence of the delta heavy chain.", "journal": "Science", "date": "1985", "authors": "White M B, Shen A L, Word C J, Tucker P W, Blattner F R", "reference": { "type": "PubMed", "id": "3922054", "url": "https://pubmed.ncbi.nlm.nih.gov/3922054" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P01880-2", "protein_name": "Immunoglobulin heavy constant delta", "gene_name": "IGHD", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P01880", "url": "https://www.uniprot.org/uniprotkb/P01880" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.3922054", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Structures of the O-glycosidically linked oligosaccharides of human IgD.", "journal": "The Journal of biological chemistry", "date": "1983", "authors": "Mellis SJ, Baenziger JU", "reference": { "type": "PubMed", "id": "6619128", "url": "https://pubmed.ncbi.nlm.nih.gov/6619128" }, "referenced_glycans": [ { "glytoucan_ac": "G00031MO" }, { "glytoucan_ac": "G79763SM" }, { "glytoucan_ac": "G65562ZE" }, { "glytoucan_ac": "G74722FL" }, { "glytoucan_ac": "G81006GJ" }, { "glytoucan_ac": "G99365LP" }, { "glytoucan_ac": "G56682BC" }, { "glytoucan_ac": "G01614ZM" }, { "glytoucan_ac": "G86656HK" }, { "glytoucan_ac": "G29931IJ" } ], "referenced_proteins": [ { "uniprot_canonical_ac": "P01880-2", "protein_name": "Immunoglobulin heavy constant delta", "gene_name": "IGHD", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01824-1", "protein_name": "Immunoglobulin heavy variable 4-39", "gene_name": "IGHV4-39", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P01880", "url": "https://www.uniprot.org/uniprotkb/P01880" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "glycosylation": [ { "glytoucan_ac": "", "type": "O-linked", "subtype": "O-GalNAcylation", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "S", "relation": "attached", "comment": "O-linked (GalNAc...) serine;O-GalNAcylation", "icn3d_view": {}, "start_pos": 109, "start_aa": "Ser", "end_pos": 109, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser109", "evidence": [ { "id": "P01880", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P01880#ptm_processing" }, { "id": "7092891", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/7092891" }, { "id": "6619128", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/6619128" } ], "filter_code": "000000000000000100000.00000010000000.00.01000", "uniprot_canonical_ac": "P01880-2" }, { "glytoucan_ac": "", "type": "O-linked", "subtype": "O-GalNAcylation", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "T", "relation": "attached", "comment": "O-linked (GalNAc...) threonine;O-GalNAcylation", "icn3d_view": {}, "start_pos": 126, "start_aa": "Thr", "end_pos": 126, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr126", "evidence": [ { "id": "P01880", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P01880#ptm_processing" }, { "id": "7092891", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/7092891" }, { "id": "6619128", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/6619128" } ], "filter_code": "000000000000000010000.00000010000000.00.01000", "uniprot_canonical_ac": "P01880-2" }, { "glytoucan_ac": "", "type": "O-linked", "subtype": "O-GalNAcylation", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "T", "relation": "attached", "comment": "O-linked (GalNAc...) threonine;O-GalNAcylation", "icn3d_view": {}, "start_pos": 127, "start_aa": "Thr", "end_pos": 127, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr127", "evidence": [ { "id": "P01880", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P01880#ptm_processing" }, { "id": "7092891", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/7092891" }, { "id": "6619128", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/6619128" } ], "filter_code": "000000000000000010000.00000010000000.00.01000", "uniprot_canonical_ac": "P01880-2" }, { "glytoucan_ac": "", "type": "O-linked", "subtype": "O-GalNAcylation", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "T", "relation": "attached", "comment": "O-linked (GalNAc...) threonine;O-GalNAcylation", "icn3d_view": {}, "start_pos": 131, "start_aa": "Thr", "end_pos": 131, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr131", "evidence": [ { "id": "P01880", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P01880#ptm_processing" }, { "id": "7092891", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/7092891" }, { "id": "6619128", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/6619128" } ], "filter_code": "000000000000000010000.00000010000000.00.01000", "uniprot_canonical_ac": "P01880-2" }, { "glytoucan_ac": "", "type": "O-linked", "subtype": "O-GalNAcylation", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "T", "relation": "attached", "comment": "O-linked (GalNAc...) threonine;O-GalNAcylation", "icn3d_view": {}, "start_pos": 132, "start_aa": "Thr", "end_pos": 132, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr132", "evidence": [ { "id": "P01880", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P01880#ptm_processing" }, { "id": "7092891", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/7092891" }, { "id": "6619128", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/6619128" } ], "filter_code": "000000000000000010000.00000010000000.00.01000", "uniprot_canonical_ac": "P01880-2" }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "icn3d_view": {}, "start_pos": 225, "start_aa": "Asn", "end_pos": 225, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn225", "evidence": [ { "id": "P01880", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P01880#ptm_processing" }, { "id": "16335952", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/16335952" }, { "id": "6785754", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/6785754" }, { "id": "6619128", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/6619128" }, { "id": "7008791", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/7008791" } ], "filter_code": "001000000000000000000.00010000000000.00.01000", "uniprot_canonical_ac": "P01880-2" }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "icn3d_view": {}, "start_pos": 316, "start_aa": "Asn", "end_pos": 316, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn316", "evidence": [ { "id": "P01880", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P01880#ptm_processing" }, { "id": "19159218", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19159218" }, { "id": "16335952", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/16335952" }, { "id": "6785754", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/6785754" }, { "id": "6619128", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/6619128" }, { "id": "7008791", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/7008791" }, { "id": "24190977", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24190977" }, { "id": "GLY_000143", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000143" } ], "filter_code": "001000000000000000000.00010000000000.00.01000", "uniprot_canonical_ac": "P01880-2" }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "icn3d_view": { "label": "iCn3D", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?bcifid=9FMB&bu=0&command=select+.D:496;+center+selection;+zoom+selection" }, "start_pos": 367, "start_aa": "Asn", "end_pos": 367, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn367", "evidence": [ { "id": "P01880", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P01880#ptm_processing" }, { "id": "6785754", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/6785754" }, { "id": "6619128", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/6619128" }, { "id": "7008791", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/7008791" }, { "id": "24190977", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24190977" }, { "id": "GLY_000143", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000143" }, { "id": "9FMB", "database": "PDB", "url": "https://www.rcsb.org/structure/9FMB" } ], "filter_code": "001000000000000000000.00010000000000.00.01000", "uniprot_canonical_ac": "P01880-2" }, { "glytoucan_ac": "G00031MO", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "6619128", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/6619128" }, { "id": "276", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/276" } ], "filter_code": "000000000000000000000.0000000.00000000001000.1000000.1100000000.010100100011111100.10000.01000", "uniprot_canonical_ac": "P01824-1" }, { "glytoucan_ac": "G01614ZM", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "6619128", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/6619128" }, { "id": "276", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/276" } ], "filter_code": "000000000000000000000.0000000.00000000001000.1000000.1100100000.010000000011111001.10000.01000", "uniprot_canonical_ac": "P01824-1" }, { "glytoucan_ac": "G29931IJ", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "6619128", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/6619128" }, { "id": "276", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/276" } ], "filter_code": "000000000000000000000.0000000.00000000001000.1000000.1100000000.110100100011111100.00010.01000", "uniprot_canonical_ac": "P01824-1" }, { "glytoucan_ac": "G56682BC", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "6619128", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/6619128" }, { "id": "276", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/276" } ], "filter_code": "000000000000000000000.0000000.00000000001000.1000000.1100100000.010100000011111001.10000.01000", "uniprot_canonical_ac": "P01824-1" }, { "glytoucan_ac": "G65562ZE", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "6619128", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/6619128" }, { "id": "276", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/276" } ], "filter_code": "000000000000000000000.0000000.00000000001000.1000000.1100100000.010100000011111011.10000.01000", "uniprot_canonical_ac": "P01824-1" }, { "glytoucan_ac": "G74722FL", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "6619128", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/6619128" }, { "id": "276", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/276" } ], "filter_code": "000000000000000000000.0000000.00000000001000.1000000.1100100000.010100000011111111.00100.01000", "uniprot_canonical_ac": "P01824-1" }, { "glytoucan_ac": "G81006GJ", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "6619128", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/6619128" }, { "id": "276", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/276" } ], "filter_code": "000000000000000000000.0000000.00000000001000.1000000.1100100000.010000000011111101.00100.01000", "uniprot_canonical_ac": "P01824-1" } ], "glycan_expression": [ { "glytoucan_ac": "G00031MO", "abundance": "", "tissue": { "name": "blood", "namespace": "UBERON", "id": "0000178", "url": "http://purl.obolibrary.org/obo/UBERON_0000178" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01824-1" }, { "glytoucan_ac": "G65562ZE", "abundance": "", "tissue": { "name": "blood", "namespace": "UBERON", "id": "0000178", "url": "http://purl.obolibrary.org/obo/UBERON_0000178" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01824-1" }, { "glytoucan_ac": "G74722FL", "abundance": "", "tissue": { "name": "blood", "namespace": "UBERON", "id": "0000178", "url": "http://purl.obolibrary.org/obo/UBERON_0000178" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01824-1" }, { "glytoucan_ac": "G81006GJ", "abundance": "", "tissue": { "name": "blood", "namespace": "UBERON", "id": "0000178", "url": "http://purl.obolibrary.org/obo/UBERON_0000178" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01824-1" }, { "glytoucan_ac": "G56682BC", "abundance": "", "tissue": { "name": "blood", "namespace": "UBERON", "id": "0000178", "url": "http://purl.obolibrary.org/obo/UBERON_0000178" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01824-1" }, { "glytoucan_ac": "G01614ZM", "abundance": "", "tissue": { "name": "blood", "namespace": "UBERON", "id": "0000178", "url": "http://purl.obolibrary.org/obo/UBERON_0000178" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01824-1" }, { "glytoucan_ac": "G29931IJ", "abundance": "", "tissue": { "name": "blood", "namespace": "UBERON", "id": "0000178", "url": "http://purl.obolibrary.org/obo/UBERON_0000178" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01824-1" } ], "record_id": "pubmed.6619128", "abstract": "", "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 10 } ], "sort_fields": [ "glytoucan_ac" ] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 15 }, { "field": "total_sites", "count": 9 }, { "field": "n_linked_sites", "count": 3 }, { "field": "o_linked_sites", "count": 6 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 7 }, { "field": "exact_sites", "count": 8 }, { "field": "exact_o_linked_sites", "count": 5 }, { "field": "exact_n_linked_sites", "count": 3 }, { "field": "fuzzy_sites", "count": 1 }, { "field": "fuzzy_o_linked_sites", "count": 1 }, { "field": "fuzzy_o_linked_glycan_sites", "count": 1 }, { "field": "fuzzy_o_linked_glycans", "count": 7 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl", "filter_code", "uniprot_canonical_ac", "icn3d_view.label", "icn3d_view.url" ] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 8 }, { "field": "total_sites", "count": 8 }, { "field": "n_linked_sites", "count": 3 }, { "field": "o_linked_sites", "count": 5 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "exact_sites", "count": 8 }, { "field": "exact_o_linked_sites", "count": 5 }, { "field": "exact_n_linked_sites", "count": 3 }, { "field": "fuzzy_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl", "filter_code", "uniprot_canonical_ac", "icn3d_view.label", "icn3d_view.url" ] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 7 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 1 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 7 }, { "field": "exact_sites", "count": 0 }, { "field": "fuzzy_sites", "count": 1 }, { "field": "fuzzy_o_linked_sites", "count": 1 }, { "field": "fuzzy_o_linked_glycan_sites", "count": 1 }, { "field": "fuzzy_o_linked_glycans", "count": 7 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl", "filter_code", "uniprot_canonical_ac", "icn3d_view.label", "icn3d_view.url" ] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Complete amino acid sequence of the Fc region of a human delta chain.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1981", "authors": "Shinoda T, Takahashi N, Takayasu T, Okuyama T, Shimizu A", "reference": { "type": "PubMed", "id": "6785754", "url": "https://pubmed.ncbi.nlm.nih.gov/6785754" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P01880-2", "protein_name": "Immunoglobulin heavy constant delta", "gene_name": "IGHD", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P01880", "url": "https://www.uniprot.org/uniprotkb/P01880" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "glycosylation": [ { "glytoucan_ac": "", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "icn3d_view": {}, "start_pos": 225, "start_aa": "Asn", "end_pos": 225, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn225", "evidence": [ { "id": "P01880", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P01880#ptm_processing" }, { "id": "16335952", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/16335952" }, { "id": "6785754", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/6785754" }, { "id": "6619128", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/6619128" }, { "id": "7008791", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/7008791" } ], "filter_code": "001000000000000000000.00010000000000.00.01000", "uniprot_canonical_ac": "P01880-2" }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "icn3d_view": {}, "start_pos": 316, "start_aa": "Asn", "end_pos": 316, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn316", "evidence": [ { "id": "P01880", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P01880#ptm_processing" }, { "id": "19159218", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19159218" }, { "id": "16335952", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/16335952" }, { "id": "6785754", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/6785754" }, { "id": "6619128", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/6619128" }, { "id": "7008791", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/7008791" }, { "id": "24190977", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24190977" }, { "id": "GLY_000143", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000143" } ], "filter_code": "001000000000000000000.00010000000000.00.01000", "uniprot_canonical_ac": "P01880-2" }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "icn3d_view": { "label": "iCn3D", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?bcifid=9FMB&bu=0&command=select+.D:496;+center+selection;+zoom+selection" }, "start_pos": 367, "start_aa": "Asn", "end_pos": 367, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn367", "evidence": [ { "id": "P01880", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P01880#ptm_processing" }, { "id": "6785754", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/6785754" }, { "id": "6619128", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/6619128" }, { "id": "7008791", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/7008791" }, { "id": "24190977", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24190977" }, { "id": "GLY_000143", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000143" }, { "id": "9FMB", "database": "PDB", "url": "https://www.rcsb.org/structure/9FMB" } ], "filter_code": "001000000000000000000.00010000000000.00.01000", "uniprot_canonical_ac": "P01880-2" } ], "record_id": "pubmed.6785754", "abstract": "", "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 3 }, { "field": "total_sites", "count": 3 }, { "field": "n_linked_sites", "count": 3 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "exact_sites", "count": 3 }, { "field": "exact_n_linked_sites", "count": 3 }, { "field": "fuzzy_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl", "filter_code", "uniprot_canonical_ac", "icn3d_view.label", "icn3d_view.url" ] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 3 }, { "field": "total_sites", "count": 3 }, { "field": "n_linked_sites", "count": 3 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "exact_sites", "count": 3 }, { "field": "exact_n_linked_sites", "count": 3 }, { "field": "fuzzy_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl", "filter_code", "uniprot_canonical_ac", "icn3d_view.label", "icn3d_view.url" ] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Primary structure of the Fc region of human immunoglobulin D: implications for evolutionary origin and biological function.", "journal": "Proc. Natl. Acad. Sci. U.S.A.", "date": "1981", "authors": "Lin L C, Putnam F W", "reference": { "type": "PubMed", "id": "6787589", "url": "https://pubmed.ncbi.nlm.nih.gov/6787589" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P01880-2", "protein_name": "Immunoglobulin heavy constant delta", "gene_name": "IGHD", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P01880", "url": "https://www.uniprot.org/uniprotkb/P01880" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.6787589", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Amino acid sequence of the first constant region domain and the hinge region of the delta heavy chain of human IgD.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1981", "authors": "Putnam FW, Takahashi N, Tetaert D, Debuire B, Lin LC", "reference": { "type": "PubMed", "id": "6947220", "url": "https://pubmed.ncbi.nlm.nih.gov/6947220" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P01880-2", "protein_name": "Immunoglobulin heavy constant delta", "gene_name": "IGHD", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P01880", "url": "https://www.uniprot.org/uniprotkb/P01880" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.6947220", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Amino acid sequence and location of the three glycopeptides in the Fc region of human immunoglobulin D.", "journal": "Biochemical and biophysical research communications", "date": "1980", "authors": "Takayasu T, Takahashi N, Shinoda T", "reference": { "type": "PubMed", "id": "7008791", "url": "https://pubmed.ncbi.nlm.nih.gov/7008791" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P01880-2", "protein_name": "Immunoglobulin heavy constant delta", "gene_name": "IGHD", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P01880", "url": "https://www.uniprot.org/uniprotkb/P01880" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "glycosylation": [ { "glytoucan_ac": "", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "icn3d_view": {}, "start_pos": 225, "start_aa": "Asn", "end_pos": 225, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn225", "evidence": [ { "id": "P01880", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P01880#ptm_processing" }, { "id": "16335952", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/16335952" }, { "id": "6785754", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/6785754" }, { "id": "6619128", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/6619128" }, { "id": "7008791", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/7008791" } ], "filter_code": "001000000000000000000.00010000000000.00.01000", "uniprot_canonical_ac": "P01880-2" }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "icn3d_view": {}, "start_pos": 316, "start_aa": "Asn", "end_pos": 316, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn316", "evidence": [ { "id": "P01880", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P01880#ptm_processing" }, { "id": "19159218", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19159218" }, { "id": "16335952", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/16335952" }, { "id": "6785754", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/6785754" }, { "id": "6619128", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/6619128" }, { "id": "7008791", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/7008791" }, { "id": "24190977", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24190977" }, { "id": "GLY_000143", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000143" } ], "filter_code": "001000000000000000000.00010000000000.00.01000", "uniprot_canonical_ac": "P01880-2" }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "icn3d_view": { "label": "iCn3D", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?bcifid=9FMB&bu=0&command=select+.D:496;+center+selection;+zoom+selection" }, "start_pos": 367, "start_aa": "Asn", "end_pos": 367, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn367", "evidence": [ { "id": "P01880", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P01880#ptm_processing" }, { "id": "6785754", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/6785754" }, { "id": "6619128", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/6619128" }, { "id": "7008791", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/7008791" }, { "id": "24190977", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24190977" }, { "id": "GLY_000143", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000143" }, { "id": "9FMB", "database": "PDB", "url": "https://www.rcsb.org/structure/9FMB" } ], "filter_code": "001000000000000000000.00010000000000.00.01000", "uniprot_canonical_ac": "P01880-2" } ], "record_id": "pubmed.7008791", "abstract": "", "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 3 }, { "field": "total_sites", "count": 3 }, { "field": "n_linked_sites", "count": 3 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "exact_sites", "count": 3 }, { "field": "exact_n_linked_sites", "count": 3 }, { "field": "fuzzy_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl", "filter_code", "uniprot_canonical_ac", "icn3d_view.label", "icn3d_view.url" ] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 3 }, { "field": "total_sites", "count": 3 }, { "field": "n_linked_sites", "count": 3 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "exact_sites", "count": 3 }, { "field": "exact_n_linked_sites", "count": 3 }, { "field": "fuzzy_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl", "filter_code", "uniprot_canonical_ac", "icn3d_view.label", "icn3d_view.url" ] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Amino acid sequence of galactosamine-containing glycopeptides in the hinge region of a human immunoglobulin D.", "journal": "Biochemical and biophysical research communications", "date": "1982", "authors": "Takayasu T, Suzuki S, Kametani F, Takahashi N, Shinoda T, Okuyama T, Munekata E", "reference": { "type": "PubMed", "id": "7092891", "url": "https://pubmed.ncbi.nlm.nih.gov/7092891" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P01880-2", "protein_name": "Immunoglobulin heavy constant delta", "gene_name": "IGHD", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P01880", "url": "https://www.uniprot.org/uniprotkb/P01880" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "glycosylation": [ { "glytoucan_ac": "", "type": "O-linked", "subtype": "O-GalNAcylation", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "S", "relation": "attached", "comment": "O-linked (GalNAc...) serine;O-GalNAcylation", "icn3d_view": {}, "start_pos": 109, "start_aa": "Ser", "end_pos": 109, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser109", "evidence": [ { "id": "P01880", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P01880#ptm_processing" }, { "id": "7092891", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/7092891" }, { "id": "6619128", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/6619128" } ], "filter_code": "000000000000000100000.00000010000000.00.01000", "uniprot_canonical_ac": "P01880-2" }, { "glytoucan_ac": "", "type": "O-linked", "subtype": "O-GalNAcylation", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "S", "relation": "attached", "comment": "O-linked (GalNAc...) serine;O-GalNAcylation", "icn3d_view": {}, "start_pos": 110, "start_aa": "Ser", "end_pos": 110, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser110", "evidence": [ { "id": "P01880", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P01880#ptm_processing" }, { "id": "7092891", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/7092891" } ], "filter_code": "000000000000000100000.00000010000000.00.01000", "uniprot_canonical_ac": "P01880-2" }, { "glytoucan_ac": "", "type": "O-linked", "subtype": "O-GalNAcylation", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "T", "relation": "attached", "comment": "O-linked (GalNAc...) threonine;O-GalNAcylation", "icn3d_view": {}, "start_pos": 113, "start_aa": "Thr", "end_pos": 113, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr113", "evidence": [ { "id": "P01880", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P01880#ptm_processing" }, { "id": "7092891", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/7092891" } ], "filter_code": "000000000000000010000.00000010000000.00.01000", "uniprot_canonical_ac": "P01880-2" }, { "glytoucan_ac": "", "type": "O-linked", "subtype": "O-GalNAcylation", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "T", "relation": "attached", "comment": "O-linked (GalNAc...) threonine;O-GalNAcylation", "icn3d_view": {}, "start_pos": 126, "start_aa": "Thr", "end_pos": 126, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr126", "evidence": [ { "id": "P01880", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P01880#ptm_processing" }, { "id": "7092891", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/7092891" }, { "id": "6619128", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/6619128" } ], "filter_code": "000000000000000010000.00000010000000.00.01000", "uniprot_canonical_ac": "P01880-2" }, { "glytoucan_ac": "", "type": "O-linked", "subtype": "O-GalNAcylation", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "T", "relation": "attached", "comment": "O-linked (GalNAc...) threonine;O-GalNAcylation", "icn3d_view": {}, "start_pos": 127, "start_aa": "Thr", "end_pos": 127, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr127", "evidence": [ { "id": "P01880", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P01880#ptm_processing" }, { "id": "7092891", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/7092891" }, { "id": "6619128", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/6619128" } ], "filter_code": "000000000000000010000.00000010000000.00.01000", "uniprot_canonical_ac": "P01880-2" }, { "glytoucan_ac": "", "type": "O-linked", "subtype": "O-GalNAcylation", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "T", "relation": "attached", "comment": "O-linked (GalNAc...) threonine;O-GalNAcylation", "icn3d_view": {}, "start_pos": 131, "start_aa": "Thr", "end_pos": 131, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr131", "evidence": [ { "id": "P01880", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P01880#ptm_processing" }, { "id": "7092891", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/7092891" }, { "id": "6619128", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/6619128" } ], "filter_code": "000000000000000010000.00000010000000.00.01000", "uniprot_canonical_ac": "P01880-2" }, { "glytoucan_ac": "", "type": "O-linked", "subtype": "O-GalNAcylation", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "T", "relation": "attached", "comment": "O-linked (GalNAc...) threonine;O-GalNAcylation", "icn3d_view": {}, "start_pos": 132, "start_aa": "Thr", "end_pos": 132, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr132", "evidence": [ { "id": "P01880", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P01880#ptm_processing" }, { "id": "7092891", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/7092891" }, { "id": "6619128", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/6619128" } ], "filter_code": "000000000000000010000.00000010000000.00.01000", "uniprot_canonical_ac": "P01880-2" } ], "record_id": "pubmed.7092891", "abstract": "", "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 7 }, { "field": "total_sites", "count": 7 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 7 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "exact_sites", "count": 7 }, { "field": "exact_o_linked_sites", "count": 7 }, { "field": "fuzzy_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl", "filter_code", "uniprot_canonical_ac" ] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 7 }, { "field": "total_sites", "count": 7 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 7 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "exact_sites", "count": 7 }, { "field": "exact_o_linked_sites", "count": 7 }, { "field": "fuzzy_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl", "filter_code", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Immunoglobulin D enhances the release of tumor necrosis factor-alpha, and interleukin-1 beta as well as interleukin-1 receptor antagonist from human mononuclear cells.", "journal": "Immunology", "date": "1996-07", "authors": "Drenth J P, G\u00f6ertz J, Daha M R, van der Meer J W", "reference": { "type": "PubMed", "id": "8774350", "url": "https://pubmed.ncbi.nlm.nih.gov/8774350" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P01880-2", "protein_name": "Immunoglobulin heavy constant delta", "gene_name": "IGHD", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P01880", "url": "https://www.uniprot.org/uniprotkb/P01880" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.8774350", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Autoreactivity against induced or upregulated abundant self-peptides in HLA-A*0201 following measles virus infection.", "journal": "Human immunology", "date": "2003-01", "authors": "Herberts Carla A, van Gaans-van den Brink Jacqueline, van der Heeft Ed, van Wijk Margot, Hoekman Jan, Jaye Assan, Poelen Martien C M, Boog Claire J P, Roholl Paul J M, Whittle Hilton, de Jong Ad P J M, van Els C\u00e9cile A C M", "reference": { "type": "PubMed", "id": "12507814", "url": "https://pubmed.ncbi.nlm.nih.gov/12507814" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P09912-1", "protein_name": "Interferon alpha-inducible protein 6", "gene_name": "IFI6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P08238-1", "protein_name": "Heat shock protein HSP 90-beta", "gene_name": "HSP90AB1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P09912", "url": "https://www.uniprot.org/uniprotkb/P09912" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.12507814", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "G1P3, an IFN-induced survival factor, antagonizes TRAIL-induced apoptosis in human myeloma cells.", "journal": "The Journal of clinical investigation", "date": "2007-10", "authors": "Cheriyath Venugopalan, Glaser Keith B, Waring Jeffrey F, Baz Rachid, Hussein Mohamad A, Borden Ernest C", "reference": { "type": "PubMed", "id": "17823654", "url": "https://pubmed.ncbi.nlm.nih.gov/17823654" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P09912-1", "protein_name": "Interferon alpha-inducible protein 6", "gene_name": "IFI6", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P09912", "url": "https://www.uniprot.org/uniprotkb/P09912" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.17823654", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Interferon-\u03b1 inducible protein 6 impairs EGFR activation by CD81 and inhibits hepatitis C virus infection.", "journal": "Scientific reports", "date": "2015-03-11", "authors": "Meyer Keith, Kwon Young-Chan, Liu Shuanghu, Hagedorn Curt H, Ray Ratna B, Ray Ranjit", "reference": { "type": "PubMed", "id": "25757571", "url": "https://pubmed.ncbi.nlm.nih.gov/25757571" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P09912-1", "protein_name": "Interferon alpha-inducible protein 6", "gene_name": "IFI6", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P09912", "url": "https://www.uniprot.org/uniprotkb/P09912" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.25757571", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "IFI6 Inhibits Apoptosis via Mitochondrial-Dependent Pathway in Dengue Virus 2 Infected Vascular Endothelial Cells.", "journal": "PloS one", "date": "2015", "authors": "Qi Yiming, Li Ying, Zhang Yingke, Zhang Lin, Wang Zilian, Zhang Xuzhi, Gui Lian, Huang Junqi", "reference": { "type": "PubMed", "id": "26244642", "url": "https://pubmed.ncbi.nlm.nih.gov/26244642" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P09912-1", "protein_name": "Interferon alpha-inducible protein 6", "gene_name": "IFI6", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P09912", "url": "https://www.uniprot.org/uniprotkb/P09912" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.26244642", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "G1P3 (IFI6), a mitochondrial localised antiapoptotic protein, promotes metastatic potential of breast cancer cells through mtROS.", "journal": "Br. J. Cancer", "date": "2018", "authors": "Cheriyath V, Kaur J, Davenport A, Khalel A, Chowdhury N, Gaddipati L", "reference": { "type": "PubMed", "id": "29899394", "url": "https://pubmed.ncbi.nlm.nih.gov/29899394" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P09912-1", "protein_name": "Interferon alpha-inducible protein 6", "gene_name": "IFI6", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P09912", "url": "https://www.uniprot.org/uniprotkb/P09912" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.29899394", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Characterization of a human gene inducible by alpha- and beta-interferons and its expression in mouse cells.", "journal": "EMBO J.", "date": "1986", "authors": "Kelly J M, Porter A C, Chernajovsky Y, Gilbert C S, Stark G R, Kerr I M", "reference": { "type": "PubMed", "id": "3017706", "url": "https://pubmed.ncbi.nlm.nih.gov/3017706" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P09912-1", "protein_name": "Interferon alpha-inducible protein 6", "gene_name": "IFI6", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P09912", "url": "https://www.uniprot.org/uniprotkb/P09912" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.3017706", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "A CRISPR Activation Screen Identifies Genes That Protect against Zika Virus Infection.", "journal": "Journal of virology", "date": "2019-08-15", "authors": "Dukhovny Anna, Lamkiewicz Kevin, Chen Qian, Fricke Markus, Jabrane-Ferrat Nabila, Marz Manja, Jung Jae U, Sklan Ella H", "reference": { "type": "PubMed", "id": "31142663", "url": "https://pubmed.ncbi.nlm.nih.gov/31142663" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P09912-1", "protein_name": "Interferon alpha-inducible protein 6", "gene_name": "IFI6", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P09912", "url": "https://www.uniprot.org/uniprotkb/P09912" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.31142663", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The Functional and Antiviral Activity of Interferon Alpha-Inducible IFI6 Against Hepatitis B Virus Replication and Gene Expression.", "journal": "Frontiers in immunology", "date": "2021", "authors": "Sajid M, Ullah H, Yan K, He M, Feng J, Shereen MA, Hao R, Li Q, Guo D, Chen Y, Zhou L", "reference": { "type": "PubMed", "id": "33868257", "url": "https://pubmed.ncbi.nlm.nih.gov/33868257" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P09912-1", "protein_name": "Interferon alpha-inducible protein 6", "gene_name": "IFI6", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P09912", "url": "https://www.uniprot.org/uniprotkb/P09912" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.33868257", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "IDO1, FAT10, IFI6, and GILT Are Involved in the Antiretroviral Activity of gamma-Interferon and IDO1 Restricts Retrovirus Infection by Autophagy Enhancement.", "journal": "Cells", "date": "2022", "authors": "Kubo Y, Yasui K, Izumida M, Hayashi H, Matsuyama T", "reference": { "type": "PubMed", "id": "35883685", "url": "https://pubmed.ncbi.nlm.nih.gov/35883685" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P09912-1", "protein_name": "Interferon alpha-inducible protein 6", "gene_name": "IFI6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P13284-1", "protein_name": "Gamma-interferon-inducible lysosomal thiol reductase", "gene_name": "IFI30", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P09912", "url": "https://www.uniprot.org/uniprotkb/P09912" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.35883685", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The role of glucose-dependent insulinotropic polypeptide 3 (G1P-3) and nucleolar phosphoprotein-1 (NPM1) in pathogenesis of psoriasis.", "journal": "Indian journal of dermatology, venereology and leprology", "date": "2023", "authors": "Hassan M Mohamed, ElTahlawi Samar, Shaker Olfat G, Magdy Mai", "reference": { "type": "PubMed", "id": "37067145", "url": "https://pubmed.ncbi.nlm.nih.gov/37067145" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P09912-1", "protein_name": "Interferon alpha-inducible protein 6", "gene_name": "IFI6", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P09912", "url": "https://www.uniprot.org/uniprotkb/P09912" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.37067145", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Role of interferon alpha-inducible protein 6 in modulating the proliferation, apoptosis and senescence of oesophageal squamous cell carcinoma cells.", "journal": "Journal of physiology and pharmacology : an official journal of the Polish Physiological Society", "date": "2023-06", "authors": "Gao Y, Dai J, Xu X P, Liu P F, Shi R H", "reference": { "type": "PubMed", "id": "37661181", "url": "https://pubmed.ncbi.nlm.nih.gov/37661181" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P09912-1", "protein_name": "Interferon alpha-inducible protein 6", "gene_name": "IFI6", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P09912", "url": "https://www.uniprot.org/uniprotkb/P09912" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.37661181", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "BM-MSCs display altered gene expression profiles in B-cell acute lymphoblastic leukemia niches and exert pro-proliferative effects via overexpression of IFI6.", "journal": "Journal of translational medicine", "date": "2023-09-05", "authors": "Pan Chengyun, Hu Tianzhen, Liu Ping, Ma Dan, Cao Shuyun, Shang Qin, Zhang Luxin, Chen Qingzhen, Fang Qin, Wang Jishi", "reference": { "type": "PubMed", "id": "37670388", "url": "https://pubmed.ncbi.nlm.nih.gov/37670388" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P09912-1", "protein_name": "Interferon alpha-inducible protein 6", "gene_name": "IFI6", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P09912", "url": "https://www.uniprot.org/uniprotkb/P09912" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.37670388", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Characterisation of a novel minisatellite that provides multiple splice donor sites in an interferon-induced transcript.", "journal": "Nucleic Acids Res.", "date": "1995", "authors": "Turri M G, Cuin K A, Porter A C", "reference": { "type": "PubMed", "id": "7596809", "url": "https://pubmed.ncbi.nlm.nih.gov/7596809" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P09912-1", "protein_name": "Interferon alpha-inducible protein 6", "gene_name": "IFI6", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P09912", "url": "https://www.uniprot.org/uniprotkb/P09912" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.7596809", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Human immunoglobulin C lambda 6 gene encodes the Kern+Oz-lambda chain and C lambda 4 and C lambda 5 are pseudogenes.", "journal": "Proc. Natl. Acad. Sci. U.S.A.", "date": "1987", "authors": "Dariavach P, Lefranc G, Lefranc M P", "reference": { "type": "PubMed", "id": "3122211", "url": "https://pubmed.ncbi.nlm.nih.gov/3122211" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P0CF74-1", "protein_name": "Immunoglobulin lambda constant 6", "gene_name": "IGLC6", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P0CF74", "url": "https://www.uniprot.org/uniprotkb/P0CF74" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.3122211", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "IFN-alpha and IL-12 induce IL-18 receptor gene expression in human NK and T cells.", "journal": "J. Immunol.", "date": "2000", "authors": "Sareneva T, Julkunen I, Matikainen S", "reference": { "type": "PubMed", "id": "10925275", "url": "https://pubmed.ncbi.nlm.nih.gov/10925275" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q13478-1", "protein_name": "Interleukin-18 receptor 1", "gene_name": "IL18R1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95256-1", "protein_name": "Interleukin-18 receptor accessory protein", "gene_name": "IL18RAP", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q13478", "url": "https://www.uniprot.org/uniprotkb/Q13478" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.10925275", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "IL-18 receptors, their role in ligand binding and function: anti-IL-1RAcPL antibody, a potent antagonist of IL-18.", "journal": "J. Immunol.", "date": "2000", "authors": "Debets R, Timans JC, Churakowa T, Zurawski S, de Waal Malefyt R, Moore KW, Abrams JS, O'Garra A, Bazan JF, Kastelein RA", "reference": { "type": "PubMed", "id": "11046021", "url": "https://pubmed.ncbi.nlm.nih.gov/11046021" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q13478-1", "protein_name": "Interleukin-18 receptor 1", "gene_name": "IL18R1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Z2B1-1", "protein_name": "Interleukin-18 receptor accessory protein", "gene_name": "Il18rap", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "O95256-1", "protein_name": "Interleukin-18 receptor accessory protein", "gene_name": "IL18RAP", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q13478", "url": "https://www.uniprot.org/uniprotkb/Q13478" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.11046021", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The structure and binding mode of interleukin-18.", "journal": "Nature structural biology", "date": "2003", "authors": "Kato Z, Jee J, Shikano H, Mishima M, Ohki I, Ohnishi H, Li A, Hashimoto K, Matsukuma E, Omoya K, Yamamoto Y, Yoneda T, Hara T, Kondo N, Shirakawa M", "reference": { "type": "PubMed", "id": "14528293", "url": "https://pubmed.ncbi.nlm.nih.gov/14528293" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q13478-1", "protein_name": "Interleukin-18 receptor 1", "gene_name": "IL18R1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14116-1", "protein_name": "Interleukin-18", "gene_name": "IL18", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95256-1", "protein_name": "Interleukin-18 receptor accessory protein", "gene_name": "IL18RAP", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q13478", "url": "https://www.uniprot.org/uniprotkb/Q13478" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 115, "end_pos": 115, "sequence_org": "K", "sequence_mut": "A", "comment": "Reduces binding of the preformed binary complex of IL18 and IL18R1 to IL18RAP resulting in impaired IFNG production.", "evidence": [ { "database": "UniProtKB", "id": "Q14116", "url": "https://www.uniprot.org/uniprotkb/Q14116" }, { "database": "PubMed", "id": "14528293", "url": "https://pubmed.ncbi.nlm.nih.gov/14528293" } ], "uniprot_canonical_ac": "Q14116-1" }, { "start_pos": 120, "end_pos": 120, "sequence_org": "K", "sequence_mut": "A", "comment": "Reduces binding of the preformed binary complex of IL18 and IL18R1 to IL18RAP resulting in impaired IFNG production.", "evidence": [ { "database": "UniProtKB", "id": "Q14116", "url": "https://www.uniprot.org/uniprotkb/Q14116" }, { "database": "PubMed", "id": "14528293", "url": "https://pubmed.ncbi.nlm.nih.gov/14528293" } ], "uniprot_canonical_ac": "Q14116-1" }, { "start_pos": 134, "end_pos": 134, "sequence_org": "D", "sequence_mut": "A", "comment": "Reduces binding of the preformed binary complex of IL18 and IL18R1 to IL18RAP resulting in impaired IFNG production.", "evidence": [ { "database": "UniProtKB", "id": "Q14116", "url": "https://www.uniprot.org/uniprotkb/Q14116" }, { "database": "PubMed", "id": "14528293", "url": "https://pubmed.ncbi.nlm.nih.gov/14528293" } ], "uniprot_canonical_ac": "Q14116-1" }, { "start_pos": 140, "end_pos": 140, "sequence_org": "R", "sequence_mut": "A", "comment": "Reduces binding to IL18R1 and the ability to induce IFNG production.", "evidence": [ { "database": "UniProtKB", "id": "Q14116", "url": "https://www.uniprot.org/uniprotkb/Q14116" }, { "database": "PubMed", "id": "14528293", "url": "https://pubmed.ncbi.nlm.nih.gov/14528293" } ], "uniprot_canonical_ac": "Q14116-1" }, { "start_pos": 168, "end_pos": 168, "sequence_org": "D", "sequence_mut": "A", "comment": "Reduces binding to IL18R1 and the ability to induce IFNG production.", "evidence": [ { "database": "UniProtKB", "id": "Q14116", "url": "https://www.uniprot.org/uniprotkb/Q14116" }, { "database": "PubMed", "id": "14528293", "url": "https://pubmed.ncbi.nlm.nih.gov/14528293" } ], "uniprot_canonical_ac": "Q14116-1" }, { "start_pos": 40, "end_pos": 40, "sequence_org": "K", "sequence_mut": "A", "comment": "Reduces binding to IL18R1 and the ability to induce IFNG production.", "evidence": [ { "database": "UniProtKB", "id": "Q14116", "url": "https://www.uniprot.org/uniprotkb/Q14116" }, { "database": "PubMed", "id": "14528293", "url": "https://pubmed.ncbi.nlm.nih.gov/14528293" } ], "uniprot_canonical_ac": "Q14116-1" }, { "start_pos": 41, "end_pos": 41, "sequence_org": "L", "sequence_mut": "A", "comment": "Impairs binding to IL18R1 and the ability to induce IFNG production.", "evidence": [ { "database": "UniProtKB", "id": "Q14116", "url": "https://www.uniprot.org/uniprotkb/Q14116" }, { "database": "PubMed", "id": "14528293", "url": "https://pubmed.ncbi.nlm.nih.gov/14528293" } ], "uniprot_canonical_ac": "Q14116-1" }, { "start_pos": 44, "end_pos": 44, "sequence_org": "K", "sequence_mut": "A", "comment": "Reduces binding to IL18R1 and the ability to induce IFNG production.", "evidence": [ { "database": "UniProtKB", "id": "Q14116", "url": "https://www.uniprot.org/uniprotkb/Q14116" }, { "database": "PubMed", "id": "14528293", "url": "https://pubmed.ncbi.nlm.nih.gov/14528293" } ], "uniprot_canonical_ac": "Q14116-1" }, { "start_pos": 49, "end_pos": 49, "sequence_org": "R", "sequence_mut": "A", "comment": "Reduces binding to IL18R1 and the ability to induce IFNG production.", "evidence": [ { "database": "UniProtKB", "id": "Q14116", "url": "https://www.uniprot.org/uniprotkb/Q14116" }, { "database": "PubMed", "id": "14528293", "url": "https://pubmed.ncbi.nlm.nih.gov/14528293" } ], "uniprot_canonical_ac": "Q14116-1" }, { "start_pos": 53, "end_pos": 53, "sequence_org": "D", "sequence_mut": "A", "comment": "Reduces binding to IL18R1 and the ability to induce IFNG production.", "evidence": [ { "database": "UniProtKB", "id": "Q14116", "url": "https://www.uniprot.org/uniprotkb/Q14116" }, { "database": "PubMed", "id": "14528293", "url": "https://pubmed.ncbi.nlm.nih.gov/14528293" } ], "uniprot_canonical_ac": "Q14116-1" }, { "start_pos": 69, "end_pos": 69, "sequence_org": "M", "sequence_mut": "A", "comment": "Impairs binding to IL18R1 and the ability to induce IFNG production.", "evidence": [ { "database": "UniProtKB", "id": "Q14116", "url": "https://www.uniprot.org/uniprotkb/Q14116" }, { "database": "PubMed", "id": "14528293", "url": "https://pubmed.ncbi.nlm.nih.gov/14528293" } ], "uniprot_canonical_ac": "Q14116-1" }, { "start_pos": 71, "end_pos": 71, "sequence_org": "D", "sequence_mut": "A", "comment": "Impairs binding to IL18R1 and the ability to induce IFNG production. Abolished cleavage by CASP3.", "evidence": [ { "database": "UniProtKB", "id": "Q14116", "url": "https://www.uniprot.org/uniprotkb/Q14116" }, { "database": "PubMed", "id": "37993714", "url": "https://pubmed.ncbi.nlm.nih.gov/37993714" }, { "database": "PubMed", "id": "14528293", "url": "https://pubmed.ncbi.nlm.nih.gov/14528293" } ], "uniprot_canonical_ac": "Q14116-1" }, { "start_pos": 94, "end_pos": 94, "sequence_org": "R", "sequence_mut": "A", "comment": "Impairs binding to IL18R1 and the ability to induce IFNG production.", "evidence": [ { "database": "UniProtKB", "id": "Q14116", "url": "https://www.uniprot.org/uniprotkb/Q14116" }, { "database": "PubMed", "id": "14528293", "url": "https://pubmed.ncbi.nlm.nih.gov/14528293" } ], "uniprot_canonical_ac": "Q14116-1" }, { "start_pos": 96, "end_pos": 96, "sequence_org": "M", "sequence_mut": "A", "comment": "Impairs binding to IL18R1 and the ability to induce IFNG production.", "evidence": [ { "database": "UniProtKB", "id": "Q14116", "url": "https://www.uniprot.org/uniprotkb/Q14116" }, { "database": "PubMed", "id": "14528293", "url": "https://pubmed.ncbi.nlm.nih.gov/14528293" } ], "uniprot_canonical_ac": "Q14116-1" } ], "record_id": "pubmed.14528293", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Structural basis for the specific recognition of IL-18 by its alpha receptor.", "journal": "FEBS letters", "date": "2014", "authors": "Wei H, Wang D, Qian Y, Liu X, Fan S, Yin HS, Wang X", "reference": { "type": "PubMed", "id": "25261253", "url": "https://pubmed.ncbi.nlm.nih.gov/25261253" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q13478-1", "protein_name": "Interleukin-18 receptor 1", "gene_name": "IL18R1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14116-1", "protein_name": "Interleukin-18", "gene_name": "IL18", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q13478", "url": "https://www.uniprot.org/uniprotkb/Q13478" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "glycosylation": [ { "glytoucan_ac": "", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "icn3d_view": { "label": "iCn3D", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?bcifid=4R6U&bu=0&command=select+.A:197;+center+selection;+zoom+selection" }, "start_pos": 197, "start_aa": "Asn", "end_pos": 197, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn197", "evidence": [ { "id": "Q13478", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/Q13478#ptm_processing" }, { "id": "25261253", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/25261253" }, { "id": "25500532", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/25500532" }, { "id": "4R6U", "database": "PDB", "url": "https://www.rcsb.org/sequence/4R6U" }, { "id": "3WO3", "database": "PDB", "url": "https://www.rcsb.org/sequence/3WO3" }, { "id": "3WO4", "database": "PDB", "url": "https://www.rcsb.org/sequence/3WO4" } ], "filter_code": "001000000000000000000.00010000000000.00.01000", "uniprot_canonical_ac": "Q13478-1" }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "icn3d_view": { "label": "iCn3D", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?bcifid=4R6U&bu=0&command=select+.A:203;+center+selection;+zoom+selection" }, "start_pos": 203, "start_aa": "Asn", "end_pos": 203, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn203", "evidence": [ { "id": "Q13478", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/Q13478#ptm_processing" }, { "id": "25261253", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/25261253" }, { "id": "25500532", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/25500532" }, { "id": "4R6U", "database": "PDB", "url": "https://www.rcsb.org/sequence/4R6U" }, { "id": "3WO3", "database": "PDB", "url": "https://www.rcsb.org/sequence/3WO3" }, { "id": "3WO4", "database": "PDB", "url": "https://www.rcsb.org/sequence/3WO4" }, { "id": "24190977", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24190977" }, { "id": "GLY_000143", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000143" } ], "filter_code": "001000000000000000000.00010000000000.00.01001", "uniprot_canonical_ac": "Q13478-1" }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "icn3d_view": { "label": "iCn3D", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?bcifid=4R6U&bu=0&command=select+.A:236;+center+selection;+zoom+selection" }, "start_pos": 236, "start_aa": "Asn", "end_pos": 236, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn236", "evidence": [ { "id": "Q13478", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/Q13478#ptm_processing" }, { "id": "25261253", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/25261253" }, { "id": "25500532", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/25500532" }, { "id": "4R6U", "database": "PDB", "url": "https://www.rcsb.org/sequence/4R6U" }, { "id": "3WO3", "database": "PDB", "url": "https://www.rcsb.org/sequence/3WO3" }, { "id": "3WO4", "database": "PDB", "url": "https://www.rcsb.org/sequence/3WO4" } ], "filter_code": "001000000000000000000.00010000000000.00.01001", "uniprot_canonical_ac": "Q13478-1" }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "icn3d_view": { "label": "iCn3D", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?bcifid=4R6U&bu=0&command=select+.A:297;+center+selection;+zoom+selection" }, "start_pos": 297, "start_aa": "Asn", "end_pos": 297, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn297", "evidence": [ { "id": "Q13478", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/Q13478#ptm_processing" }, { "id": "3WO3", "database": "PDB", "url": "https://www.rcsb.org/sequence/3WO3" }, { "id": "25500532", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/25500532" }, { "id": "25261253", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/25261253" }, { "id": "4R6U", "database": "PDB", "url": "https://www.rcsb.org/sequence/4R6U" }, { "id": "3WO4", "database": "PDB", "url": "https://www.rcsb.org/sequence/3WO4" } ], "filter_code": "001000000000000000000.00010000000000.00.01100", "uniprot_canonical_ac": "Q13478-1" } ], "record_id": "pubmed.25261253", "abstract": "", "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 4 }, { "field": "total_sites", "count": 4 }, { "field": "n_linked_sites", "count": 4 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "exact_sites", "count": 4 }, { "field": "exact_n_linked_sites", "count": 4 }, { "field": "fuzzy_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "icn3d_view.label", "icn3d_view.url", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl", "filter_code", "uniprot_canonical_ac" ] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 4 }, { "field": "total_sites", "count": 4 }, { "field": "n_linked_sites", "count": 4 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "exact_sites", "count": 4 }, { "field": "exact_n_linked_sites", "count": 4 }, { "field": "fuzzy_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "icn3d_view.label", "icn3d_view.url", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl", "filter_code", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The structural basis for receptor recognition of human interleukin-18.", "journal": "Nature communications", "date": "2014", "authors": "Tsutsumi N, Kimura T, Arita K, Ariyoshi M, Ohnishi H, Yamamoto T, Zuo X, Maenaka K, Park EY, Kondo N, Shirakawa M, Tochio H, Kato Z", "reference": { "type": "PubMed", "id": "25500532", "url": "https://pubmed.ncbi.nlm.nih.gov/25500532" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q13478-1", "protein_name": "Interleukin-18 receptor 1", "gene_name": "IL18R1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14116-1", "protein_name": "Interleukin-18", "gene_name": "IL18", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95256-1", "protein_name": "Interleukin-18 receptor accessory protein", "gene_name": "IL18RAP", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q13478", "url": "https://www.uniprot.org/uniprotkb/Q13478" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "glycosylation": [ { "glytoucan_ac": "", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "icn3d_view": { "label": "iCn3D", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?bcifid=3WO3&bu=0&command=select+.B:102;+center+selection;+zoom+selection" }, "start_pos": 102, "start_aa": "Asn", "end_pos": 102, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn102", "evidence": [ { "id": "Q13478", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/Q13478#ptm_processing" }, { "id": "25500532", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/25500532" }, { "id": "3WO3", "database": "PDB", "url": "https://www.rcsb.org/sequence/3WO3" }, { "id": "3WO4", "database": "PDB", "url": "https://www.rcsb.org/sequence/3WO4" } ], "filter_code": "001000000000000000000.00010000000000.00.01001", "uniprot_canonical_ac": "Q13478-1" }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "icn3d_view": { "label": "iCn3D", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?bcifid=3WO3&bu=0&command=select+.H:150;+center+selection;+zoom+selection" }, "start_pos": 150, "start_aa": "Asn", "end_pos": 150, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn150", "evidence": [ { "id": "Q13478", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/Q13478#ptm_processing" }, { "id": "25500532", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/25500532" }, { "id": "3WO3", "database": "PDB", "url": "https://www.rcsb.org/sequence/3WO3" }, { "id": "3WO4", "database": "PDB", "url": "https://www.rcsb.org/sequence/3WO4" } ], "filter_code": "001000000000000000000.00010000000000.00.01001", "uniprot_canonical_ac": "Q13478-1" }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "icn3d_view": { "label": "iCn3D", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?bcifid=4R6U&bu=0&command=select+.A:197;+center+selection;+zoom+selection" }, "start_pos": 197, "start_aa": "Asn", "end_pos": 197, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn197", "evidence": [ { "id": "Q13478", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/Q13478#ptm_processing" }, { "id": "25261253", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/25261253" }, { "id": "25500532", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/25500532" }, { "id": "4R6U", "database": "PDB", "url": "https://www.rcsb.org/sequence/4R6U" }, { "id": "3WO3", "database": "PDB", "url": "https://www.rcsb.org/sequence/3WO3" }, { "id": "3WO4", "database": "PDB", "url": "https://www.rcsb.org/sequence/3WO4" } ], "filter_code": "001000000000000000000.00010000000000.00.01000", "uniprot_canonical_ac": "Q13478-1" }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "icn3d_view": { "label": "iCn3D", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?bcifid=4R6U&bu=0&command=select+.A:203;+center+selection;+zoom+selection" }, "start_pos": 203, "start_aa": "Asn", "end_pos": 203, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn203", "evidence": [ { "id": "Q13478", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/Q13478#ptm_processing" }, { "id": "25261253", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/25261253" }, { "id": "25500532", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/25500532" }, { "id": "4R6U", "database": "PDB", "url": "https://www.rcsb.org/sequence/4R6U" }, { "id": "3WO3", "database": "PDB", "url": "https://www.rcsb.org/sequence/3WO3" }, { "id": "3WO4", "database": "PDB", "url": "https://www.rcsb.org/sequence/3WO4" }, { "id": "24190977", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24190977" }, { "id": "GLY_000143", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000143" } ], "filter_code": "001000000000000000000.00010000000000.00.01001", "uniprot_canonical_ac": "Q13478-1" }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "icn3d_view": { "label": "iCn3D", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?bcifid=4R6U&bu=0&command=select+.A:236;+center+selection;+zoom+selection" }, "start_pos": 236, "start_aa": "Asn", "end_pos": 236, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn236", "evidence": [ { "id": "Q13478", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/Q13478#ptm_processing" }, { "id": "25261253", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/25261253" }, { "id": "25500532", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/25500532" }, { "id": "4R6U", "database": "PDB", "url": "https://www.rcsb.org/sequence/4R6U" }, { "id": "3WO3", "database": "PDB", "url": "https://www.rcsb.org/sequence/3WO3" }, { "id": "3WO4", "database": "PDB", "url": "https://www.rcsb.org/sequence/3WO4" } ], "filter_code": "001000000000000000000.00010000000000.00.01001", "uniprot_canonical_ac": "Q13478-1" }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "icn3d_view": { "label": "iCn3D", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?bcifid=4R6U&bu=0&command=select+.A:297;+center+selection;+zoom+selection" }, "start_pos": 297, "start_aa": "Asn", "end_pos": 297, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn297", "evidence": [ { "id": "Q13478", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/Q13478#ptm_processing" }, { "id": "3WO3", "database": "PDB", "url": "https://www.rcsb.org/sequence/3WO3" }, { "id": "25500532", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/25500532" }, { "id": "25261253", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/25261253" }, { "id": "4R6U", "database": "PDB", "url": "https://www.rcsb.org/sequence/4R6U" }, { "id": "3WO4", "database": "PDB", "url": "https://www.rcsb.org/sequence/3WO4" } ], "filter_code": "001000000000000000000.00010000000000.00.01100", "uniprot_canonical_ac": "Q13478-1" }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "icn3d_view": { "label": "iCn3D", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?bcifid=3WO3&bu=0&command=select+.B:91;+center+selection;+zoom+selection" }, "start_pos": 91, "start_aa": "Asn", "end_pos": 91, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn91", "evidence": [ { "id": "Q13478", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/Q13478#ptm_processing" }, { "id": "25500532", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/25500532" }, { "id": "3WO3", "database": "PDB", "url": "https://www.rcsb.org/sequence/3WO3" }, { "id": "3WO4", "database": "PDB", "url": "https://www.rcsb.org/sequence/3WO4" } ], "filter_code": "001000000000000000000.00010000000000.00.01000", "uniprot_canonical_ac": "Q13478-1" }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "icn3d_view": { "label": "iCn3D", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?bcifid=3WO4&bu=0&command=select+.C:119;+center+selection;+zoom+selection" }, "start_pos": 119, "start_aa": "Asn", "end_pos": 119, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn119", "evidence": [ { "id": "O95256", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/O95256#ptm_processing" }, { "id": "3WO4", "database": "PDB", "url": "https://www.rcsb.org/sequence/3WO4" }, { "id": "25500532", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/25500532" } ], "filter_code": "001000000000000000000.00010000000000.00.01000", "uniprot_canonical_ac": "O95256-1" }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "icn3d_view": {}, "start_pos": 152, "start_aa": "Asn", "end_pos": 152, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn152", "evidence": [ { "id": "O95256", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/O95256#ptm_processing" }, { "id": "3WO4", "database": "PDB", "url": "https://www.rcsb.org/sequence/3WO4" }, { "id": "25500532", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/25500532" } ], "filter_code": "001000000000000000000.00010000000000.00.01000", "uniprot_canonical_ac": "O95256-1" }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "icn3d_view": { "label": "iCn3D", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?bcifid=6KN9&bu=0&command=select+.C:345;+center+selection;+zoom+selection" }, "start_pos": 345, "start_aa": "Asn", "end_pos": 345, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn345", "evidence": [ { "id": "O95256", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/O95256#ptm_processing" }, { "id": "3WO4", "database": "PDB", "url": "https://www.rcsb.org/sequence/3WO4" }, { "id": "25500532", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/25500532" }, { "id": "6KN9", "database": "PDB", "url": "https://www.rcsb.org/structure/6KN9" } ], "filter_code": "001000000000000000000.00010000000000.00.01001", "uniprot_canonical_ac": "O95256-1" } ], "mutagenesis": [ { "start_pos": 297, "end_pos": 297, "sequence_org": "N", "sequence_mut": "Q", "comment": "Decreases the affinity for IL18 suggesting that the N-linked glycosylation contributes to ligand recognition.", "evidence": [ { "database": "UniProtKB", "id": "Q13478", "url": "https://www.uniprot.org/uniprotkb/Q13478" }, { "database": "PubMed", "id": "25500532", "url": "https://pubmed.ncbi.nlm.nih.gov/25500532" } ], "uniprot_canonical_ac": "Q13478-1" }, { "start_pos": 144, "end_pos": 144, "sequence_org": "G", "sequence_mut": "A", "comment": "Abolishes binding of the preformed binary complex of IL18 and IL18R1 to IL18RAP.", "evidence": [ { "database": "UniProtKB", "id": "Q14116", "url": "https://www.uniprot.org/uniprotkb/Q14116" }, { "database": "PubMed", "id": "25500532", "url": "https://pubmed.ncbi.nlm.nih.gov/25500532" } ], "uniprot_canonical_ac": "Q14116-1" }, { "start_pos": 145, "end_pos": 145, "sequence_org": "H", "sequence_mut": "A", "comment": "Abolishes binding of the preformed binary complex of IL18 and IL18R1 to IL18RAP.", "evidence": [ { "database": "UniProtKB", "id": "Q14116", "url": "https://www.uniprot.org/uniprotkb/Q14116" }, { "database": "PubMed", "id": "25500532", "url": "https://pubmed.ncbi.nlm.nih.gov/25500532" } ], "uniprot_canonical_ac": "Q14116-1" }, { "start_pos": 146, "end_pos": 146, "sequence_org": "D", "sequence_mut": "A", "comment": "Reduces binding of the preformed binary complex of IL18 and IL18R1 to IL18RAP.", "evidence": [ { "database": "UniProtKB", "id": "Q14116", "url": "https://www.uniprot.org/uniprotkb/Q14116" }, { "database": "PubMed", "id": "25500532", "url": "https://pubmed.ncbi.nlm.nih.gov/25500532" } ], "uniprot_canonical_ac": "Q14116-1" }, { "start_pos": 148, "end_pos": 148, "sequence_org": "K", "sequence_mut": "A", "comment": "Abolishes binding of the preformed binary complex of IL18 and IL18R1 to IL18RAP.", "evidence": [ { "database": "UniProtKB", "id": "Q14116", "url": "https://www.uniprot.org/uniprotkb/Q14116" }, { "database": "PubMed", "id": "25500532", "url": "https://pubmed.ncbi.nlm.nih.gov/25500532" } ], "uniprot_canonical_ac": "Q14116-1" }, { "start_pos": 183, "end_pos": 183, "sequence_org": "R", "sequence_mut": "A", "comment": "Reduces binding of the preformed binary complex of IL18 and IL18R1 to IL18RAP.", "evidence": [ { "database": "UniProtKB", "id": "Q14116", "url": "https://www.uniprot.org/uniprotkb/Q14116" }, { "database": "PubMed", "id": "25500532", "url": "https://pubmed.ncbi.nlm.nih.gov/25500532" } ], "uniprot_canonical_ac": "Q14116-1" }, { "start_pos": 186, "end_pos": 186, "sequence_org": "M", "sequence_mut": "A", "comment": "Reduces binding of the preformed binary complex of IL18 and IL18R1 to IL18RAP.", "evidence": [ { "database": "UniProtKB", "id": "Q14116", "url": "https://www.uniprot.org/uniprotkb/Q14116" }, { "database": "PubMed", "id": "25500532", "url": "https://pubmed.ncbi.nlm.nih.gov/25500532" } ], "uniprot_canonical_ac": "Q14116-1" }, { "start_pos": 15, "end_pos": 176, "sequence_org": "ERIKGFNISGCSTKKLLWTYSTRSEEEFVLFCDLPEPQKSHFCHRNRLSPKQVPEHLPFMGSNDLSDVQWYQQPSNGDPLEDIRKSYPHIIQDKCTLHFLTPGVNNSGSYICRPKMIKSPYDVACCVKMILEVKPQTNASCEYSASHKQDLLLGSTGSISCP", "sequence_mut": "", "comment": "Impairs IL18 receptor signaling via NF-kappa-B.", "evidence": [ { "database": "UniProtKB", "id": "O95256", "url": "https://www.uniprot.org/uniprotkb/O95256" }, { "database": "PubMed", "id": "25500532", "url": "https://pubmed.ncbi.nlm.nih.gov/25500532" } ], "uniprot_canonical_ac": "O95256-1" }, { "start_pos": 167, "end_pos": 167, "sequence_org": "L", "sequence_mut": "A", "comment": "Decreases binding to the preformed binary complex of IL18 and IL18R1.", "evidence": [ { "database": "UniProtKB", "id": "O95256", "url": "https://www.uniprot.org/uniprotkb/O95256" }, { "database": "PubMed", "id": "25500532", "url": "https://pubmed.ncbi.nlm.nih.gov/25500532" } ], "uniprot_canonical_ac": "O95256-1" }, { "start_pos": 210, "end_pos": 210, "sequence_org": "E", "sequence_mut": "A", "comment": "Decreases binding to the preformed binary complex of IL18 and IL18R1. Impairs IL18 receptor signaling via NF-kappa-B; when associated with A-212 and A-214.", "evidence": [ { "database": "UniProtKB", "id": "O95256", "url": "https://www.uniprot.org/uniprotkb/O95256" }, { "database": "PubMed", "id": "25500532", "url": "https://pubmed.ncbi.nlm.nih.gov/25500532" } ], "uniprot_canonical_ac": "O95256-1" }, { "start_pos": 212, "end_pos": 212, "sequence_org": "Y", "sequence_mut": "A", "comment": "Abolishes binding to the preformed binary complex of IL18 and IL18R1. Impairs IL18 receptor signaling via NF-kappa-B; when associated with A-210 and A-214.", "evidence": [ { "database": "UniProtKB", "id": "O95256", "url": "https://www.uniprot.org/uniprotkb/O95256" }, { "database": "PubMed", "id": "25500532", "url": "https://pubmed.ncbi.nlm.nih.gov/25500532" } ], "uniprot_canonical_ac": "O95256-1" }, { "start_pos": 214, "end_pos": 214, "sequence_org": "Y", "sequence_mut": "A", "comment": "Decreases binding to the preformed binary complex of IL18 and IL18R1. Impairs IL18 receptor signaling via NF-kappa-B; when associated with A-210 and A-212.", "evidence": [ { "database": "UniProtKB", "id": "O95256", "url": "https://www.uniprot.org/uniprotkb/O95256" }, { "database": "PubMed", "id": "25500532", "url": "https://pubmed.ncbi.nlm.nih.gov/25500532" } ], "uniprot_canonical_ac": "O95256-1" }, { "start_pos": 313, "end_pos": 313, "sequence_org": "K", "sequence_mut": "A", "comment": "Decreases binding to the preformed binary complex of IL18 and IL18R1. Decreases IL18 receptor signaling via NF-kappa-B.", "evidence": [ { "database": "UniProtKB", "id": "O95256", "url": "https://www.uniprot.org/uniprotkb/O95256" }, { "database": "PubMed", "id": "25500532", "url": "https://pubmed.ncbi.nlm.nih.gov/25500532" } ], "uniprot_canonical_ac": "O95256-1" } ], "record_id": "pubmed.25500532", "abstract": "", "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 10 }, { "field": "total_sites", "count": 10 }, { "field": "n_linked_sites", "count": 10 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "exact_sites", "count": 10 }, { "field": "exact_n_linked_sites", "count": 10 }, { "field": "fuzzy_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "icn3d_view.label", "icn3d_view.url", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl", "filter_code", "uniprot_canonical_ac" ] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 10 }, { "field": "total_sites", "count": 10 }, { "field": "n_linked_sites", "count": 10 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "exact_sites", "count": 10 }, { "field": "exact_n_linked_sites", "count": 10 }, { "field": "fuzzy_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "icn3d_view.label", "icn3d_view.url", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl", "filter_code", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "IL18-family Genes Polymorphism Is Associated with the Risk of Myocardial Infarction and IL18 Concentration in Patients with Coronary Artery Disease.", "journal": "Immunological investigations", "date": "2022", "authors": "Ponasenko AV, Tsepokina AV, Khutornaya MV, Sinitsky MY, Barbarash OL", "reference": { "type": "PubMed", "id": "33522333", "url": "https://pubmed.ncbi.nlm.nih.gov/33522333" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q13478-1", "protein_name": "Interleukin-18 receptor 1", "gene_name": "IL18R1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q13478", "url": "https://www.uniprot.org/uniprotkb/Q13478" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.33522333", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Downregulation of T-cell cytotoxic marker IL18R1 promotes cancer proliferation and migration and is associated with dismal prognosis and immunity in lung squamous cell carcinoma.", "journal": "Frontiers in immunology", "date": "2022", "authors": "Guo Qiang, Wu Chuang-Yan, Jiang Ni, Tong Song, Wan Jun-Hao, Xiao Xiao-Yue, Mei Pei-Yuan, Liu Hua-Song, Wang Si-Hua", "reference": { "type": "PubMed", "id": "36544782", "url": "https://pubmed.ncbi.nlm.nih.gov/36544782" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q13478-1", "protein_name": "Interleukin-18 receptor 1", "gene_name": "IL18R1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q13478", "url": "https://www.uniprot.org/uniprotkb/Q13478" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.36544782", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "ACSL6-activated IL-18R1-NF-\u03baB promotes IL-18-mediated tumor immune evasion and tumor progression.", "journal": "Science advances", "date": "2024-09-20", "authors": "Di Yuqin, Wang Ziyang, Xiao Jing, Zhang Xiang, Ye Lvlan, Wen Xiangqiong, Qin Jiale, Lu Ligong, Wang Xiongjun, He Weiling", "reference": { "type": "PubMed", "id": "39292786", "url": "https://pubmed.ncbi.nlm.nih.gov/39292786" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q13478-1", "protein_name": "Interleukin-18 receptor 1", "gene_name": "IL18R1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14116-1", "protein_name": "Interleukin-18", "gene_name": "IL18", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UKU0-4", "protein_name": "Long-chain-fatty-acid--CoA ligase 6", "gene_name": "ACSL6", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q13478", "url": "https://www.uniprot.org/uniprotkb/Q13478" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.39292786", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Whole exome sequencing implicates an INO80D mutation in a syndrome of aortic hypoplasia, premature atherosclerosis, and arterial stiffness.", "journal": "Circulation. Cardiovascular genetics", "date": "2014", "authors": "Shameer K, Klee EW, Dalenberg AK, Kullo IJ", "reference": { "type": "PubMed", "id": "25122053", "url": "https://pubmed.ncbi.nlm.nih.gov/25122053" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q53TQ3-1", "protein_name": "INO80 complex subunit D", "gene_name": "INO80D", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q53TQ3", "url": "https://www.uniprot.org/uniprotkb/Q53TQ3" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.25122053", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Genome-wide analysis of lncRNAs in 3'-untranslated regions: CR933609 acts as a decoy to protect the INO80D gene.", "journal": "International journal of oncology", "date": "2018", "authors": "Chang CC, Liu TY, Lee YT, Chen YC, Yeh KT, Lee CC, Chen YL, Lin PC, Chang YS, Chan WL, Liu TC, Chang JG", "reference": { "type": "PubMed", "id": "29750421", "url": "https://pubmed.ncbi.nlm.nih.gov/29750421" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q53TQ3-1", "protein_name": "INO80 complex subunit D", "gene_name": "INO80D", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q53TQ3", "url": "https://www.uniprot.org/uniprotkb/Q53TQ3" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.29750421", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Expression and imprinting status of human PEG8/IGF2AS, a paternally expressed antisense transcript from the IGF2 locus, in Wilms' tumors.", "journal": "J. Biochem.", "date": "2000", "authors": "Okutsu T, Kuroiwa Y, Kagitani F, Kai M, Aisaka K, Tsutsumi O, Kaneko Y, Yokomori K, Surani M A, Kohda T, Kaneko-Ishino T, Ishino F", "reference": { "type": "PubMed", "id": "10731720", "url": "https://pubmed.ncbi.nlm.nih.gov/10731720" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q6U949-1", "protein_name": "Putative insulin-like growth factor 2 antisense gene protein", "gene_name": "IGF2-AS", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q6U949", "url": "https://www.uniprot.org/uniprotkb/Q6U949" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.10731720", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Loss of imprinting of IGF2 sense and antisense transcripts in Wilms' tumor.", "journal": "Cancer Res.", "date": "2003", "authors": "Vu Thanh H, Chuyen Nguyen V, Li Tao, Hoffman Andrew R", "reference": { "type": "PubMed", "id": "12702581", "url": "https://pubmed.ncbi.nlm.nih.gov/12702581" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q6U949-1", "protein_name": "Putative insulin-like growth factor 2 antisense gene protein", "gene_name": "IGF2-AS", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q6U949", "url": "https://www.uniprot.org/uniprotkb/Q6U949" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.12702581", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The -G1245A IGF1 polymorphism is related with small head size and less brain sparing in small for gestational age born children.", "journal": "European journal of endocrinology", "date": "2009", "authors": "Ester WA, van Meurs JB, Arends NJ, Uitterlinden AG, de Ridder MA, Hokken-Koelega AC", "reference": { "type": "PubMed", "id": "19147602", "url": "https://pubmed.ncbi.nlm.nih.gov/19147602" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q6UW32-1", "protein_name": "Insulin growth factor-like family member 1", "gene_name": "IGFL1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q6UW32", "url": "https://www.uniprot.org/uniprotkb/Q6UW32" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.19147602", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "KLF5-induced lncRNA IGFL2-AS1 promotes basal-like breast cancer cell growth and survival by upregulating the expression of IGFL1.", "journal": "Cancer letters", "date": "2021", "authors": "Wang H, Shi Y, Chen CH, Wen Y, Zhou Z, Yang C, Sun J, Du G, Wu J, Mao X, Liu R, Chen C", "reference": { "type": "PubMed", "id": "34052325", "url": "https://pubmed.ncbi.nlm.nih.gov/34052325" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q6UW32-1", "protein_name": "Insulin growth factor-like family member 1", "gene_name": "IGFL1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q6UW32", "url": "https://www.uniprot.org/uniprotkb/Q6UW32" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.34052325", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "First evaluation of Neighbor of Punc E11 (NOPE) as a novel marker in human hepatocellular carcinoma.", "journal": "Cancer biomarkers : section A of Disease markers", "date": "2021", "authors": "Zweerink S, Mesghenna S, Mueck V, Schulte S, Kuetting F, Quaas A, Goeser T, Nierhoff D", "reference": { "type": "PubMed", "id": "32986656", "url": "https://pubmed.ncbi.nlm.nih.gov/32986656" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q8TDY8-1", "protein_name": "Immunoglobulin superfamily DCC subclass member 4", "gene_name": "IGDCC4", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q8TDY8", "url": "https://www.uniprot.org/uniprotkb/Q8TDY8" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.32986656", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Genetic basis of inosine triphosphate pyrophosphohydrolase deficiency.", "journal": "Human genetics", "date": "2002", "authors": "Sumi S, Marinaki AM, Arenas M, Fairbanks L, Shobowale-Bakre M, Rees DC, Thein SL, Ansari A, Sanderson J, De Abreu RA, Simmonds HA, Duley JA", "reference": { "type": "PubMed", "id": "12384777", "url": "https://pubmed.ncbi.nlm.nih.gov/12384777" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9BY32-1", "protein_name": "Inosine triphosphate pyrophosphatase", "gene_name": "ITPA", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9BY32", "url": "https://www.uniprot.org/uniprotkb/Q9BY32" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.12384777", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "DNA polymorphisms in ITPA including basis of inosine triphosphatase deficiency.", "journal": "Journal of human genetics", "date": "2002", "authors": "Cao H, Hegele RA", "reference": { "type": "PubMed", "id": "12436200", "url": "https://pubmed.ncbi.nlm.nih.gov/12436200" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9BY32-1", "protein_name": "Inosine triphosphate pyrophosphatase", "gene_name": "ITPA", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9BY32", "url": "https://www.uniprot.org/uniprotkb/Q9BY32" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.12436200", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Structure of the orthorhombic form of human inosine triphosphate pyrophosphatase.", "journal": "Acta Crystallogr. F", "date": "2006", "authors": "Porta Jason, Kolar Carol, Kozmin Stanislav G, Pavlov Youri I, Borgstahl Gloria E O", "reference": { "type": "PubMed", "id": "17077483", "url": "https://pubmed.ncbi.nlm.nih.gov/17077483" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9BY32-1", "protein_name": "Inosine triphosphate pyrophosphatase", "gene_name": "ITPA", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9BY32", "url": "https://www.uniprot.org/uniprotkb/Q9BY32" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.17077483", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Crystal structure of human inosine triphosphatase. Substrate binding and implication of the inosine triphosphatase deficiency mutation P32T.", "journal": "J. Biol. Chem.", "date": "2007", "authors": "Stenmark P\u00e5l, Kursula Petri, Flodin Susanne, Gr\u00e4slund Susanne, Landry Robert, Nordlund P\u00e4r, Sch\u00fcler Herwig", "reference": { "type": "PubMed", "id": "17138556", "url": "https://pubmed.ncbi.nlm.nih.gov/17138556" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9BY32-1", "protein_name": "Inosine triphosphate pyrophosphatase", "gene_name": "ITPA", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9BY32", "url": "https://www.uniprot.org/uniprotkb/Q9BY32" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.17138556", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Recessive ITPA mutations cause an early infantile encephalopathy.", "journal": "Annals of neurology", "date": "2015", "authors": "Kevelam SH, Bierau J, Salvarinova R, Agrawal S, Honzik T, Visser D, Weiss MM, Salomons GS, Abbink TE, Waisfisz Q, van der Knaap MS", "reference": { "type": "PubMed", "id": "26224535", "url": "https://pubmed.ncbi.nlm.nih.gov/26224535" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9BY32-1", "protein_name": "Inosine triphosphate pyrophosphatase", "gene_name": "ITPA", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9BY32", "url": "https://www.uniprot.org/uniprotkb/Q9BY32" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.26224535", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Investigation of the Association Between the ITPA Gene 94C>A Gene Sequence Variant and Liver Transplant Rejection in Iranian Liver Transplant Recipients.", "journal": "Experimental and clinical transplantation : official journal of the Middle East Society for Organ Transplantation", "date": "2022-12", "authors": "Heidari Mozhdeh, Khalili Marzieh, Malek Hosseini Seyed Ali, Geramizadeh Bita, Shamsaefar Ali Reza, Balouchi Fardin, Karimi Mohammad Hossein", "reference": { "type": "PubMed", "id": "36718008", "url": "https://pubmed.ncbi.nlm.nih.gov/36718008" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9BY32-1", "protein_name": "Inosine triphosphate pyrophosphatase", "gene_name": "ITPA", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9BY32", "url": "https://www.uniprot.org/uniprotkb/Q9BY32" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.36718008", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Investigation of the Association Between ITPA Gene 94C>A Sequence Variant and Kidney Transplant Rejection in Iranian Kidney Transplant Recipients.", "journal": "Experimental and clinical transplantation : official journal of the Middle East Society for Organ Transplantation", "date": "2023-08", "authors": "Heidari Mozhdeh, Khalili Marzieh, Balouchi Fardin, Roozbeh Jamshid, Shamsaefar Ali Reza, Malek Hosseini Seyed Ali, Karimi Mohammad Hossein", "reference": { "type": "PubMed", "id": "37698399", "url": "https://pubmed.ncbi.nlm.nih.gov/37698399" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9BY32-1", "protein_name": "Inosine triphosphate pyrophosphatase", "gene_name": "ITPA", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9BY32", "url": "https://www.uniprot.org/uniprotkb/Q9BY32" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.37698399", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Association of ITPA 94C>A genetic polymorphisms with azathioprine induced adverse effects in the South Indian population.", "journal": "Drug metabolism and personalized therapy", "date": "2024-03-01", "authors": "Deva Reka, Rajendran Priyadharsini, Ramasamy Sivaranjini, Selvan Senthamizh, Ramasamy Kesavan", "reference": { "type": "PubMed", "id": "38097396", "url": "https://pubmed.ncbi.nlm.nih.gov/38097396" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9BY32-1", "protein_name": "Inosine triphosphate pyrophosphatase", "gene_name": "ITPA", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9BY32", "url": "https://www.uniprot.org/uniprotkb/Q9BY32" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.38097396", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Predictive role of ITPA genetic variants in thiopurine-related myelotoxicity in Crohn's disease patients.", "journal": "The pharmacogenomics journal", "date": "2024-06-21", "authors": "Salazar Juliana, Riera Pau, Gordillo Jordi, Alt\u00e8s Albert, Mart\u00ednez Miguel, Ser\u00e8s Montserrat, Lla\u00f3 Jordina, Giordano Antonio, Garcia-Planella Esther", "reference": { "type": "PubMed", "id": "38906864", "url": "https://pubmed.ncbi.nlm.nih.gov/38906864" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9BY32-1", "protein_name": "Inosine triphosphate pyrophosphatase", "gene_name": "ITPA", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9BY32", "url": "https://www.uniprot.org/uniprotkb/Q9BY32" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.38906864", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Identification of cDNAs encoding two novel nuclear proteins, IMUP-1 and IMUP-2, upregulated in SV40-immortalized human fibroblasts.", "journal": "Gene", "date": "2000", "authors": "Kim JK, Ryll R, Ishizuka Y, Kato S", "reference": { "type": "PubMed", "id": "11080599", "url": "https://pubmed.ncbi.nlm.nih.gov/11080599" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9GZP8-1", "protein_name": "Immortalization up-regulated protein", "gene_name": "IMUP", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9GZP8", "url": "https://www.uniprot.org/uniprotkb/Q9GZP8" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.11080599", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Identification of hepatocyte growth factor activator inhibitor type 2 (HAI-2)-related small peptide (H2RSP): its nuclear localization and generation of chimeric mRNA transcribed from both HAI-2 and H2RSP genes.", "journal": "Biochem. Biophys. Res. Commun.", "date": "2001", "authors": "Itoh H, Kataoka H, Yamauchi M, Naganuma S, Akiyama Y, Nuki Y, Shimomura T, Miyazawa K, Kitamura N, Koono M", "reference": { "type": "PubMed", "id": "11606055", "url": "https://pubmed.ncbi.nlm.nih.gov/11606055" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9GZP8-1", "protein_name": "Immortalization up-regulated protein", "gene_name": "IMUP", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9GZP8", "url": "https://www.uniprot.org/uniprotkb/Q9GZP8" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.11606055", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "IMUP-1 and IMUP-2 genes are up-regulated in human ovarian epithelial tumors.", "journal": "Anticancer research", "date": "2003", "authors": "Kim JK, An HJ, Kim NK, Ahn JY, Kim KS, Kang YJ, Ko JJ, Oh D, Lee C, Kim SJ, Cha KY", "reference": { "type": "PubMed", "id": "14981917", "url": "https://pubmed.ncbi.nlm.nih.gov/14981917" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9GZP8-1", "protein_name": "Immortalization up-regulated protein", "gene_name": "IMUP", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9GZP8", "url": "https://www.uniprot.org/uniprotkb/Q9GZP8" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.14981917", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Nuclear translocation of H2RSP is impaired in regenerating intestinal epithelial cells of murine colitis model.", "journal": "Virchows Archiv : an international journal of pathology", "date": "2006", "authors": "Naganuma S, Itoh H, Uchiyama S, Nagaike K, Tanaka H, Akiyama Y, Chijiiwa K, Kataoka H", "reference": { "type": "PubMed", "id": "16189703", "url": "https://pubmed.ncbi.nlm.nih.gov/16189703" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9GZP8-1", "protein_name": "Immortalization up-regulated protein", "gene_name": "IMUP", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9GZP8", "url": "https://www.uniprot.org/uniprotkb/Q9GZP8" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.16189703", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Imup-1 and imup-2 overexpression in endometrial carcinoma in Korean and Japanese populations.", "journal": "Anticancer research", "date": "2008", "authors": "Kim SJ, An HJ, Kim HJ, Jungs HM, Lee S, Ko JJ, Kim IH, Sakuragi N, Kim JK", "reference": { "type": "PubMed", "id": "18507030", "url": "https://pubmed.ncbi.nlm.nih.gov/18507030" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9GZP8-1", "protein_name": "Immortalization up-regulated protein", "gene_name": "IMUP", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9GZP8", "url": "https://www.uniprot.org/uniprotkb/Q9GZP8" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.18507030", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Increased immortalization-upregulated protein 2 (IMUP-2) by hypoxia induces apoptosis of the trophoblast and pre-eclampsia.", "journal": "Journal of cellular biochemistry", "date": "2010", "authors": "Jeon SY, Lee HJ, Park JM, Jung HM, Yoo JK, Lee HJ, Lee JS, Cha DH, Kim JK, Kim GJ", "reference": { "type": "PubMed", "id": "20432246", "url": "https://pubmed.ncbi.nlm.nih.gov/20432246" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9GZP8-1", "protein_name": "Immortalization up-regulated protein", "gene_name": "IMUP", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9GZP8", "url": "https://www.uniprot.org/uniprotkb/Q9GZP8" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.20432246", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Hypoxia-induced downregulation of XIAP in trophoblasts mediates apoptosis via interaction with IMUP-2: implications for placental development during pre-eclampsia.", "journal": "Journal of cellular biochemistry", "date": "2013", "authors": "Jeon SY, Lee HJ, Na KH, Cha DH, Kim JK, Park JW, Yoon TK, Kim GJ", "reference": { "type": "PubMed", "id": "22886722", "url": "https://pubmed.ncbi.nlm.nih.gov/22886722" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9GZP8-1", "protein_name": "Immortalization up-regulated protein", "gene_name": "IMUP", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9GZP8", "url": "https://www.uniprot.org/uniprotkb/Q9GZP8" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.22886722", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Immortalization-upregulated protein promotes pancreatic cancer progression by regulating NPM1/FHL1-mediated cell-cycle-checkpoint protein activity.", "journal": "Cell biology and toxicology", "date": "2023-10", "authors": "Luo Qiankun, Pan Yanfeng, Fu Qiang, Zhang Xu, Zhou Shuai, Yu Pengfei, Tian Huiyuan, Liu Pan, Chen Song, Zhang Hongwei, Qin Tao", "reference": { "type": "PubMed", "id": "35142956", "url": "https://pubmed.ncbi.nlm.nih.gov/35142956" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9GZP8-1", "protein_name": "Immortalization up-regulated protein", "gene_name": "IMUP", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9GZP8", "url": "https://www.uniprot.org/uniprotkb/Q9GZP8" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.35142956", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Unraveling dedifferentiation and metastasis traces in pancreatic ductal adenocarcinoma ductal cells: Insights from single-cell RNA sequencing analysis of ITGB4 and C19orf33.", "journal": "Pathology, research and practice", "date": "2024-01", "authors": "Asadzadeh Zahra, Hemmat Nima, Hassanian Hamidreza, Alizadeh Nazila, Mokhtarzadeh Ahad, Jafarlou Mahdi, Baradaran Behzad", "reference": { "type": "PubMed", "id": "38071887", "url": "https://pubmed.ncbi.nlm.nih.gov/38071887" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9GZP8-1", "protein_name": "Immortalization up-regulated protein", "gene_name": "IMUP", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9GZP8", "url": "https://www.uniprot.org/uniprotkb/Q9GZP8" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.38071887", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Induction of a novel cellular homolog of interleukin-10, AK155, by transformation of T lymphocytes with herpesvirus saimiri.", "journal": "J. Virol.", "date": "2000", "authors": "Knappe A, H\u00f6r S, Wittmann S, Fickenscher H", "reference": { "type": "PubMed", "id": "10729163", "url": "https://pubmed.ncbi.nlm.nih.gov/10729163" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9NPH9-1", "protein_name": "Interleukin-26", "gene_name": "IL26", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9NPH9", "url": "https://www.uniprot.org/uniprotkb/Q9NPH9" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.10729163", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Polymorphisms in the interferon-gamma/interleukin-26 gene region contribute to sex bias in susceptibility to rheumatoid arthritis.", "journal": "Arthritis and rheumatism", "date": "2003", "authors": "Vandenbroeck K, Cunningham S, Goris A, Alloza I, Heggarty S, Graham C, Bell A, Rooney M", "reference": { "type": "PubMed", "id": "14558082", "url": "https://pubmed.ncbi.nlm.nih.gov/14558082" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9NPH9-1", "protein_name": "Interleukin-26", "gene_name": "IL26", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9NPH9", "url": "https://www.uniprot.org/uniprotkb/Q9NPH9" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.14558082", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The role of the novel Th17 cytokine IL-26 in intestinal inflammation.", "journal": "Gut", "date": "2009-09", "authors": "Dambacher J, Beigel F, Zitzmann K, De Toni E N, G\u00f6ke B, Diepolder H M, Auernhammer C J, Brand S", "reference": { "type": "PubMed", "id": "18483078", "url": "https://pubmed.ncbi.nlm.nih.gov/18483078" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9NPH9-1", "protein_name": "Interleukin-26", "gene_name": "IL26", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9NPH9", "url": "https://www.uniprot.org/uniprotkb/Q9NPH9" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.18483078", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Interleukin-26-DNA complexes promote inflammation and dermal-epidermal separation in a modified human cryosection model of bullous pemphigoid.", "journal": "Frontiers in immunology", "date": "2022", "authors": "Mizuno Yuka, Shibata Sayaka, Ito Yukiko, Taira Haruka, Sugimoto Eiki, Awaji Kentaro, Sato Shinichi", "reference": { "type": "PubMed", "id": "36311716", "url": "https://pubmed.ncbi.nlm.nih.gov/36311716" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9NPH9-1", "protein_name": "Interleukin-26", "gene_name": "IL26", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9NPH9", "url": "https://www.uniprot.org/uniprotkb/Q9NPH9" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.36311716", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "IL-26 modulates T cell function in autoimmune hepatitis.", "journal": "Journal of digestive diseases", "date": "2023-03", "authors": "He Wei, Qian Qi Wei, Liu Qiao Yan, Li Yi Kang, Miao Qi, Wang Qi Xia, Ma Xiong, You Zheng Rui, Tang Ru Qi", "reference": { "type": "PubMed", "id": "37155188", "url": "https://pubmed.ncbi.nlm.nih.gov/37155188" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9NPH9-1", "protein_name": "Interleukin-26", "gene_name": "IL26", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9NPH9", "url": "https://www.uniprot.org/uniprotkb/Q9NPH9" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.37155188", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Systemic IL-26 correlates with improved asthma control in children sensitized to dog allergen.", "journal": "Respiratory research", "date": "2024-04-15", "authors": "Kovach Melissa A, K\u00e4ck Ulrika, Che Karlhans F, Brundin Bettina, Konradsen Jon R, Lind\u00e9n Anders", "reference": { "type": "PubMed", "id": "38622712", "url": "https://pubmed.ncbi.nlm.nih.gov/38622712" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9NPH9-1", "protein_name": "Interleukin-26", "gene_name": "IL26", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9NPH9", "url": "https://www.uniprot.org/uniprotkb/Q9NPH9" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.38622712", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Increased interleukin-26 in the peripheral joints of patients with axial spondyloarthritis and psoriatic arthritis, co-localizing with CD68-positive synoviocytes.", "journal": "Frontiers in immunology", "date": "2024", "authors": "Hammitzsch Ariane, Ossadnik Andreas, Bachmann Quirin, Merwald-Fraenk Helga, Lorenz Georg, Witt Matthias, Wiesent Franziska, M\u00fchlhofer Heinrich, Simone Davide, Bowness Paul, Heemann Uwe, Arbogast Martin, Moog Philipp, Schmaderer Christoph", "reference": { "type": "PubMed", "id": "38799447", "url": "https://pubmed.ncbi.nlm.nih.gov/38799447" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9NPH9-1", "protein_name": "Interleukin-26", "gene_name": "IL26", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9NPH9", "url": "https://www.uniprot.org/uniprotkb/Q9NPH9" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.38799447", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The evolving landscape of IL-10, IL-22 and IL-26 in pleurisy especially in tuberculous pleurisy.", "journal": "Respiratory research", "date": "2024-07-13", "authors": "Niu Qian, Wang Meng, Liu Xian-Sheng", "reference": { "type": "PubMed", "id": "39003443", "url": "https://pubmed.ncbi.nlm.nih.gov/39003443" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9NPH9-1", "protein_name": "Interleukin-26", "gene_name": "IL26", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9GZX6-1", "protein_name": "Interleukin-22", "gene_name": "IL22", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9NPH9", "url": "https://www.uniprot.org/uniprotkb/Q9NPH9" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.39003443", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The role of alpha and beta chains in ligand recognition by beta 7 integrins.", "journal": "The Journal of biological chemistry", "date": "2000", "authors": "Higgins JM, Cernadas M, Tan K, Irie A, Wang J, Takada Y, Brenner MB", "reference": { "type": "PubMed", "id": "10837471", "url": "https://pubmed.ncbi.nlm.nih.gov/10837471" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P38570-1", "protein_name": "Integrin alpha-E", "gene_name": "ITGAE", "tax_name": "Human" }, { "uniprot_canonical_ac": "P26010-1", "protein_name": "Integrin beta-7", "gene_name": "ITGB7", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P38570", "url": "https://www.uniprot.org/uniprotkb/P38570" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 208, "end_pos": 208, "sequence_org": "D", "sequence_mut": "A", "comment": "Loss of E-cadherin binding.", "evidence": [ { "database": "UniProtKB", "id": "P38570", "url": "https://www.uniprot.org/uniprotkb/P38570" }, { "database": "PubMed", "id": "10837471", "url": "https://pubmed.ncbi.nlm.nih.gov/10837471" } ], "uniprot_canonical_ac": "P38570-1" }, { "start_pos": 316, "end_pos": 316, "sequence_org": "F", "sequence_mut": "A", "comment": "Loss of E-cadherin binding.", "evidence": [ { "database": "UniProtKB", "id": "P38570", "url": "https://www.uniprot.org/uniprotkb/P38570" }, { "database": "PubMed", "id": "10837471", "url": "https://pubmed.ncbi.nlm.nih.gov/10837471" } ], "uniprot_canonical_ac": "P38570-1" }, { "start_pos": 159, "end_pos": 159, "sequence_org": "D", "sequence_mut": "A", "comment": "Loss of integrin alpha-E/beta-7 binding to E-cadherin and of integrin alpha-4/beta-7 binding to MADCAM1.", "evidence": [ { "database": "UniProtKB", "id": "P26010", "url": "https://www.uniprot.org/uniprotkb/P26010" }, { "database": "PubMed", "id": "10837471", "url": "https://pubmed.ncbi.nlm.nih.gov/10837471" } ], "uniprot_canonical_ac": "P26010-1" } ], "record_id": "pubmed.10837471", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] } ]