[ { "title": "PAMP and PARL, two novel putative metalloproteases interacting with the COOH-terminus of presenilin-1 and -2.", "journal": "J. Alzheimers Dis.", "date": "2001", "authors": "Pellegrini Luca, Passer Brent J., Canelles Matilde, Lefterov Ilyia, Ganjei J. Kelly, Fowlkes B.J., Koonin Eugene V., D'Adamio Luciano", "reference": { "type": "PubMed", "id": "12214059", "url": "https://pubmed.ncbi.nlm.nih.gov/12214059" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9H300-1", "protein_name": "Presenilin-associated rhomboid-like protein, mitochondrial", "gene_name": "PARL", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49810-1", "protein_name": "Presenilin-2", "gene_name": "PSEN2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49768-1", "protein_name": "Presenilin-1", "gene_name": "PSEN1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9H300", "url": "https://www.uniprot.org/uniprotkb/Q9H300" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.12214059", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Self-regulated cleavage of the mitochondrial intramembrane-cleaving protease PARL yields Pbeta, a nuclear-targeted peptide.", "journal": "The Journal of biological chemistry", "date": "2004", "authors": "Sik A, Passer BJ, Koonin EV, Pellegrini L", "reference": { "type": "PubMed", "id": "14732705", "url": "https://pubmed.ncbi.nlm.nih.gov/14732705" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9H300-1", "protein_name": "Presenilin-associated rhomboid-like protein, mitochondrial", "gene_name": "PARL", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9H300", "url": "https://www.uniprot.org/uniprotkb/Q9H300" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 76, "end_pos": 76, "sequence_org": "R", "sequence_mut": "E", "comment": "Abolishes the beta cleavage.", "evidence": [ { "database": "UniProtKB", "id": "Q9H300", "url": "https://www.uniprot.org/uniprotkb/Q9H300" }, { "database": "PubMed", "id": "14732705", "url": "https://pubmed.ncbi.nlm.nih.gov/14732705" } ], "uniprot_canonical_ac": "Q9H300-1" }, { "start_pos": 76, "end_pos": 76, "sequence_org": "R", "sequence_mut": "G", "comment": "Abolishes the beta cleavage.", "evidence": [ { "database": "UniProtKB", "id": "Q9H300", "url": "https://www.uniprot.org/uniprotkb/Q9H300" }, { "database": "PubMed", "id": "14732705", "url": "https://pubmed.ncbi.nlm.nih.gov/14732705" } ], "uniprot_canonical_ac": "Q9H300-1" }, { "start_pos": 77, "end_pos": 77, "sequence_org": "S", "sequence_mut": "E", "comment": "Abolishes the beta cleavage.", "evidence": [ { "database": "UniProtKB", "id": "Q9H300", "url": "https://www.uniprot.org/uniprotkb/Q9H300" }, { "database": "PubMed", "id": "14732705", "url": "https://pubmed.ncbi.nlm.nih.gov/14732705" } ], "uniprot_canonical_ac": "Q9H300-1" }, { "start_pos": 78, "end_pos": 78, "sequence_org": "A", "sequence_mut": "E", "comment": "Abolishes the beta cleavage.", "evidence": [ { "database": "UniProtKB", "id": "Q9H300", "url": "https://www.uniprot.org/uniprotkb/Q9H300" }, { "database": "PubMed", "id": "14732705", "url": "https://pubmed.ncbi.nlm.nih.gov/14732705" } ], "uniprot_canonical_ac": "Q9H300-1" }, { "start_pos": 79, "end_pos": 79, "sequence_org": "L", "sequence_mut": "E", "comment": "Abolishes the beta cleavage.", "evidence": [ { "database": "UniProtKB", "id": "Q9H300", "url": "https://www.uniprot.org/uniprotkb/Q9H300" }, { "database": "PubMed", "id": "14732705", "url": "https://pubmed.ncbi.nlm.nih.gov/14732705" } ], "uniprot_canonical_ac": "Q9H300-1" } ], "record_id": "pubmed.14732705", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The mitochondrial rhomboid protease PSARL is a new candidate gene for type 2 diabetes.", "journal": "Diabetologia", "date": "2005", "authors": "Walder K, Kerr-Bayles L, Civitarese A, Jowett J, Curran J, Elliott K, Trevaskis J, Bishara N, Zimmet P, Mandarino L, Ravussin E, Blangero J, Kissebah A, Collier GR", "reference": { "type": "PubMed", "id": "15729572", "url": "https://pubmed.ncbi.nlm.nih.gov/15729572" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9H300-1", "protein_name": "Presenilin-associated rhomboid-like protein, mitochondrial", "gene_name": "PARL", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9H300", "url": "https://www.uniprot.org/uniprotkb/Q9H300" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.15729572", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Phosphorylation and cleavage of presenilin-associated rhomboid-like protein (PARL) promotes changes in mitochondrial morphology.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2006", "authors": "Jeyaraju DV, Xu L, Letellier MC, Bandaru S, Zunino R, Berg EA, McBride HM, Pellegrini L", "reference": { "type": "PubMed", "id": "17116872", "url": "https://pubmed.ncbi.nlm.nih.gov/17116872" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9H300-1", "protein_name": "Presenilin-associated rhomboid-like protein, mitochondrial", "gene_name": "PARL", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9H300", "url": "https://www.uniprot.org/uniprotkb/Q9H300" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 65, "end_pos": 65, "sequence_org": "S", "sequence_mut": "D", "comment": "Strongly reduces the beta cleavage; when associated with D-69 and D-70.", "evidence": [ { "database": "UniProtKB", "id": "Q9H300", "url": "https://www.uniprot.org/uniprotkb/Q9H300" }, { "database": "PubMed", "id": "17116872", "url": "https://pubmed.ncbi.nlm.nih.gov/17116872" } ], "uniprot_canonical_ac": "Q9H300-1" }, { "start_pos": 69, "end_pos": 69, "sequence_org": "T", "sequence_mut": "D", "comment": "Strongly reduces the beta cleavage; when associated with D-65 and D-70.", "evidence": [ { "database": "UniProtKB", "id": "Q9H300", "url": "https://www.uniprot.org/uniprotkb/Q9H300" }, { "database": "PubMed", "id": "17116872", "url": "https://pubmed.ncbi.nlm.nih.gov/17116872" } ], "uniprot_canonical_ac": "Q9H300-1" }, { "start_pos": 70, "end_pos": 70, "sequence_org": "S", "sequence_mut": "D", "comment": "Strongly reduces the beta cleavage; when associated with D-65 and D-69.", "evidence": [ { "database": "UniProtKB", "id": "Q9H300", "url": "https://www.uniprot.org/uniprotkb/Q9H300" }, { "database": "PubMed", "id": "17116872", "url": "https://pubmed.ncbi.nlm.nih.gov/17116872" } ], "uniprot_canonical_ac": "Q9H300-1" } ], "phosphorylation": [ { "start_pos": 65, "end_pos": 65, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "Q9H300", "url": "https://www.uniprot.org/uniprotkb/Q9H300" }, { "database": "PubMed", "id": "17116872", "url": "https://pubmed.ncbi.nlm.nih.gov/17116872" }, { "database": "iPTMnet", "id": "Q9H300", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9H300" } ], "site_lbl": "Ser65", "uniprot_canonical_ac": "Q9H300-1" }, { "start_pos": 69, "end_pos": 69, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine", "evidence": [ { "database": "UniProtKB", "id": "Q9H300", "url": "https://www.uniprot.org/uniprotkb/Q9H300" }, { "database": "PubMed", "id": "17116872", "url": "https://pubmed.ncbi.nlm.nih.gov/17116872" }, { "database": "iPTMnet", "id": "Q9H300", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9H300" } ], "site_lbl": "Thr69", "uniprot_canonical_ac": "Q9H300-1" }, { "start_pos": 70, "end_pos": 70, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "Q9H300", "url": "https://www.uniprot.org/uniprotkb/Q9H300" }, { "database": "PubMed", "id": "17116872", "url": "https://pubmed.ncbi.nlm.nih.gov/17116872" }, { "database": "iPTMnet", "id": "Q9H300", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9H300" } ], "site_lbl": "Ser70", "uniprot_canonical_ac": "Q9H300-1" } ], "record_id": "pubmed.17116872", "abstract": "", "glycosylation": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 3 }, { "field": "total_sites", "count": 3 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Rhomboid protease PARL mediates the mitochondrial membrane potential loss-induced cleavage of PGAM5.", "journal": "The Journal of biological chemistry", "date": "2012", "authors": "Sekine S, Kanamaru Y, Koike M, Nishihara A, Okada M, Kinoshita H, Kamiyama M, Maruyama J, Uchiyama Y, Ishihara N, Takeda K, Ichijo H", "reference": { "type": "PubMed", "id": "22915595", "url": "https://pubmed.ncbi.nlm.nih.gov/22915595" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9H300-1", "protein_name": "Presenilin-associated rhomboid-like protein, mitochondrial", "gene_name": "PARL", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96HS1-1", "protein_name": "Serine/threonine-protein phosphatase PGAM5, mitochondrial", "gene_name": "PGAM5", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9H300", "url": "https://www.uniprot.org/uniprotkb/Q9H300" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 277, "end_pos": 277, "sequence_org": "S", "sequence_mut": "G", "comment": "Loss of PGAM5 cleavage.", "evidence": [ { "database": "UniProtKB", "id": "Q9H300", "url": "https://www.uniprot.org/uniprotkb/Q9H300" }, { "database": "PubMed", "id": "22915595", "url": "https://pubmed.ncbi.nlm.nih.gov/22915595" } ], "uniprot_canonical_ac": "Q9H300-1" }, { "start_pos": 335, "end_pos": 335, "sequence_org": "H", "sequence_mut": "A", "comment": "Loss of PGAM5 cleavage.", "evidence": [ { "database": "UniProtKB", "id": "Q9H300", "url": "https://www.uniprot.org/uniprotkb/Q9H300" }, { "database": "PubMed", "id": "22915595", "url": "https://pubmed.ncbi.nlm.nih.gov/22915595" } ], "uniprot_canonical_ac": "Q9H300-1" }, { "start_pos": 24, "end_pos": 24, "sequence_org": "S", "sequence_mut": "F", "comment": "Abolishes cleavage by PARL.", "evidence": [ { "database": "UniProtKB", "id": "Q96HS1", "url": "https://www.uniprot.org/uniprotkb/Q96HS1" }, { "database": "PubMed", "id": "22915595", "url": "https://pubmed.ncbi.nlm.nih.gov/22915595" } ], "uniprot_canonical_ac": "Q96HS1-1" } ], "record_id": "pubmed.22915595", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Proapoptotic Mitochondrial Carrier Homolog Protein PSAP Mediates Death Receptor 6 Induced Apoptosis.", "journal": "Journal of Alzheimer's disease : JAD", "date": "2020", "authors": "Zhang J, Zhao ZJ, Fu X, Niu H, Hu C, Dong Y, Cui MZ, Zhang F, Zeng L, Xu X", "reference": { "type": "PubMed", "id": "32144986", "url": "https://pubmed.ncbi.nlm.nih.gov/32144986" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9H300-1", "protein_name": "Presenilin-associated rhomboid-like protein, mitochondrial", "gene_name": "PARL", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9H300", "url": "https://www.uniprot.org/uniprotkb/Q9H300" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.32144986", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "PARL Protease: A Glimpse at Intramembrane Proteolysis in the Inner Mitochondrial Membrane.", "journal": "Journal of molecular biology", "date": "2020", "authors": "Lysyk L, Brassard R, Touret N, Lemieux MJ", "reference": { "type": "PubMed", "id": "32320686", "url": "https://pubmed.ncbi.nlm.nih.gov/32320686" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9H300-1", "protein_name": "Presenilin-associated rhomboid-like protein, mitochondrial", "gene_name": "PARL", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9H300", "url": "https://www.uniprot.org/uniprotkb/Q9H300" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.32320686", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Accumulation of HAX-1 and PARL in brainstem- and cortical-type Lewy bodies in Parkinson's disease and dementia with Lewy bodies.", "journal": "Journal of the neurological sciences", "date": "2020", "authors": "Kawamoto Y, Ayaki T, Urushitani M, Ito H, Takahashi R", "reference": { "type": "PubMed", "id": "32470650", "url": "https://pubmed.ncbi.nlm.nih.gov/32470650" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9H300-1", "protein_name": "Presenilin-associated rhomboid-like protein, mitochondrial", "gene_name": "PARL", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9H300", "url": "https://www.uniprot.org/uniprotkb/Q9H300" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.32470650", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Cleavage of mitochondrial homeostasis regulator PGAM5 by the intramembrane protease PARL is governed by transmembrane helix dynamics and oligomeric state.", "journal": "The Journal of biological chemistry", "date": "2022-09", "authors": "Siebert Verena, Silber Mara, Heuten Elena, Muhle-Goll Claudia, Lemberg Marius K", "reference": { "type": "PubMed", "id": "35921890", "url": "https://pubmed.ncbi.nlm.nih.gov/35921890" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9H300-1", "protein_name": "Presenilin-associated rhomboid-like protein, mitochondrial", "gene_name": "PARL", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9H300", "url": "https://www.uniprot.org/uniprotkb/Q9H300" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.35921890", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "PHF3 expression is frequently reduced in glioma.", "journal": "Cytogenet. Cell Genet.", "date": "2001", "authors": "Fischer U, Struss AK, Hemmer D, Michel A, Henn W, Steudel WI, Meese E", "reference": { "type": "PubMed", "id": "11856869", "url": "https://pubmed.ncbi.nlm.nih.gov/11856869" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q92576-1", "protein_name": "PHD finger protein 3", "gene_name": "PHF3", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q92576", "url": "https://www.uniprot.org/uniprotkb/Q92576" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.11856869", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "A novel, functional and replicable risk gene region for alcohol dependence identified by genome-wide association study.", "journal": "PloS one", "date": "2011", "authors": "Zuo L, Zhang CK, Wang F, Li CS, Zhao H, Lu L, Zhang XY, Lu L, Zhang H, Zhang F, Krystal JH, Luo X", "reference": { "type": "PubMed", "id": "22096494", "url": "https://pubmed.ncbi.nlm.nih.gov/22096494" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q92576-1", "protein_name": "PHD finger protein 3", "gene_name": "PHF3", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q92576", "url": "https://www.uniprot.org/uniprotkb/Q92576" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.22096494", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Association of rare PTP4A1-PHF3-EYS variants with alcohol dependence.", "journal": "Journal of human genetics", "date": "2013", "authors": "Zuo L, Zhang X, Deng HW, Luo X", "reference": { "type": "PubMed", "id": "23324950", "url": "https://pubmed.ncbi.nlm.nih.gov/23324950" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q92576-1", "protein_name": "PHD finger protein 3", "gene_name": "PHF3", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q92576", "url": "https://www.uniprot.org/uniprotkb/Q92576" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.23324950", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Common PTP4A1-PHF3-EYS variants are specific for alcohol dependence.", "journal": "The American journal on addictions", "date": "2014", "authors": "Zuo L, Wang K, Wang G, Pan X, Zhang X, Zhang H, Luo X", "reference": { "type": "PubMed", "id": "24961364", "url": "https://pubmed.ncbi.nlm.nih.gov/24961364" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q92576-1", "protein_name": "PHD finger protein 3", "gene_name": "PHF3", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q92576", "url": "https://www.uniprot.org/uniprotkb/Q92576" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.24961364", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "PHF3 regulates neuronal gene expression through the Pol II CTD reader domain SPOC.", "journal": "Nature communications", "date": "2021", "authors": "Appel LM, Franke V, Bruno M, Grishkovskaya I, Kasiliauskaite A, Kaufmann T, Schoeberl UE, Puchinger MG, Kostrhon S, Ebenwaldner C, Sebesta M, Beltzung E, Mechtler K, Lin G, Vlasova A, Leeb M, Pavri R, Stark A, Akalin A, Stefl R, Bernecky C, Djinovic-Carugo K, Slade D", "reference": { "type": "PubMed", "id": "34667177", "url": "https://pubmed.ncbi.nlm.nih.gov/34667177" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q92576-1", "protein_name": "PHD finger protein 3", "gene_name": "PHF3", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q92576", "url": "https://www.uniprot.org/uniprotkb/Q92576" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.34667177", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Peptidoglycan recognition proteins: a novel family of four human innate immunity pattern recognition molecules.", "journal": "J. Biol. Chem.", "date": "2001", "authors": "Liu C, Xu Z, Gupta D, Dziarski R", "reference": { "type": "PubMed", "id": "11461926", "url": "https://pubmed.ncbi.nlm.nih.gov/11461926" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q96PD5-1", "protein_name": "N-acetylmuramoyl-L-alanine amidase", "gene_name": "PGLYRP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96LB8-1", "protein_name": "Peptidoglycan recognition protein 4", "gene_name": "PGLYRP4", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75594-1", "protein_name": "Peptidoglycan recognition protein 1", "gene_name": "PGLYRP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96LB9-1", "protein_name": "Peptidoglycan recognition protein 3", "gene_name": "PGLYRP3", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q96PD5", "url": "https://www.uniprot.org/uniprotkb/Q96PD5" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.11461926", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 4 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "[Expression analysis of proteins encoded by genes of the tag7/tagL (PGRP-S,L) family in human peripheral blood cells].", "journal": "Genetika", "date": "2003", "authors": "Kibardin AV, Mirkina II, Zakeeva IR, Baranova EV, Georgiev GP, Kiselev SL", "reference": { "type": "PubMed", "id": "12669421", "url": "https://pubmed.ncbi.nlm.nih.gov/12669421" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q96PD5-1", "protein_name": "N-acetylmuramoyl-L-alanine amidase", "gene_name": "PGLYRP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75594-1", "protein_name": "Peptidoglycan recognition protein 1", "gene_name": "PGLYRP1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q96PD5", "url": "https://www.uniprot.org/uniprotkb/Q96PD5" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.12669421", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Serum sCD14, PGLYRP2 and FGA as potential biomarkers for multidrug-resistant tuberculosis based on data-independent acquisition and targeted proteomics.", "journal": "Journal of cellular and molecular medicine", "date": "2020", "authors": "Chen J, Han YS, Yi WJ, Huang H, Li ZB, Shi LY, Wei LL, Yu Y, Jiang TT, Li JC", "reference": { "type": "PubMed", "id": "32967043", "url": "https://pubmed.ncbi.nlm.nih.gov/32967043" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q96PD5-1", "protein_name": "N-acetylmuramoyl-L-alanine amidase", "gene_name": "PGLYRP2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q96PD5", "url": "https://www.uniprot.org/uniprotkb/Q96PD5" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.32967043", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Antibody to peptidoglycan recognition protein (PGLYRP)-2 as a novel biomarker in rheumatoid arthritis.", "journal": "Clinical and experimental rheumatology", "date": "2021", "authors": "Huang F, Liu X, Cheng Y, Sun X, Li Y, Zhao J, Cao D, Wu Q, Pan X, Deng H, Tian M, Li Z", "reference": { "type": "PubMed", "id": "33427621", "url": "https://pubmed.ncbi.nlm.nih.gov/33427621" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q96PD5-1", "protein_name": "N-acetylmuramoyl-L-alanine amidase", "gene_name": "PGLYRP2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q96PD5", "url": "https://www.uniprot.org/uniprotkb/Q96PD5" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.33427621", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "PGLYRP2 as a novel biomarker for the activity and lipid metabolism of systemic lupus erythematosus.", "journal": "Lipids in health and disease", "date": "2021", "authors": "Li H, Meng D, Jia J, Wei H", "reference": { "type": "PubMed", "id": "34461924", "url": "https://pubmed.ncbi.nlm.nih.gov/34461924" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q96PD5-1", "protein_name": "N-acetylmuramoyl-L-alanine amidase", "gene_name": "PGLYRP2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q96PD5", "url": "https://www.uniprot.org/uniprotkb/Q96PD5" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.34461924", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Association of PGLYRP2 gene polymorphism and sporadic Parkinson's disease in northern Chinese Han population.", "journal": "Neuroscience letters", "date": "2022", "authors": "Luan M, Jin J, Wang Y, Li X, Xie A", "reference": { "type": "PubMed", "id": "35218888", "url": "https://pubmed.ncbi.nlm.nih.gov/35218888" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q96PD5-1", "protein_name": "N-acetylmuramoyl-L-alanine amidase", "gene_name": "PGLYRP2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q96PD5", "url": "https://www.uniprot.org/uniprotkb/Q96PD5" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.35218888", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Characterization of human serum N-acetylmuramyl-L-alanine amidase purified by affinity chromatography.", "journal": "Protein Expr. Purif.", "date": "1995", "authors": "De Pauw P, Neyt C, Vanderwinkel E, Wattiez R, Falmagne P", "reference": { "type": "PubMed", "id": "7663175", "url": "https://pubmed.ncbi.nlm.nih.gov/7663175" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q96PD5-1", "protein_name": "N-acetylmuramoyl-L-alanine amidase", "gene_name": "PGLYRP2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q96PD5", "url": "https://www.uniprot.org/uniprotkb/Q96PD5" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.7663175", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The topoisomerase-related function gene TRF4 affects cellular sensitivity to the antitumor agent camptothecin.", "journal": "J. Biol. Chem.", "date": "1999", "authors": "Walowsky C, Fitzhugh DJ, Castano IB, Ju JY, Levin NA, Christman MF", "reference": { "type": "PubMed", "id": "10066793", "url": "https://pubmed.ncbi.nlm.nih.gov/10066793" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q8NDF8-1", "protein_name": "Terminal nucleotidyltransferase 4B", "gene_name": "TENT4B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5XG87-1", "protein_name": "Terminal nucleotidyltransferase 4A", "gene_name": "TENT4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P53632-1", "protein_name": "Poly(A) RNA polymerase protein 2", "gene_name": "PAP2", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q8NDF8", "url": "https://www.uniprot.org/uniprotkb/Q8NDF8" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.10066793", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "PAPD5, a noncanonical poly(A) polymerase with an unusual RNA-binding motif.", "journal": "RNA (New York, N.Y.)", "date": "2011", "authors": "Rammelt C, Bilen B, Zavolan M, Keller W", "reference": { "type": "PubMed", "id": "21788334", "url": "https://pubmed.ncbi.nlm.nih.gov/21788334" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q8NDF8-1", "protein_name": "Terminal nucleotidyltransferase 4B", "gene_name": "TENT4B", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q8NDF8", "url": "https://www.uniprot.org/uniprotkb/Q8NDF8" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.21788334", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Maturation of mammalian H/ACA box snoRNAs: PAPD5-dependent adenylation and PARN-dependent trimming.", "journal": "RNA (New York, N.Y.)", "date": "2012-05", "authors": "Berndt Heike, Harnisch Christiane, Rammelt Christiane, St\u00f6hr Nadine, Zirkel Anne, Dohm Juliane C, Himmelbauer Heinz, Tavanez Joao-Paulo, H\u00fcttelmaier Stefan, Wahle Elmar", "reference": { "type": "PubMed", "id": "22442037", "url": "https://pubmed.ncbi.nlm.nih.gov/22442037" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q8NDF8-1", "protein_name": "Terminal nucleotidyltransferase 4B", "gene_name": "TENT4B", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95453-1", "protein_name": "Poly(A)-specific ribonuclease PARN", "gene_name": "PARN", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q8NDF8", "url": "https://www.uniprot.org/uniprotkb/Q8NDF8" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.22442037", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Comparison of the yeast and human nuclear exosome complexes.", "journal": "Biochem. Soc. Trans.", "date": "2012", "authors": "Sloan Katherine E, Schneider Claudia, Watkins Nicholas J", "reference": { "type": "PubMed", "id": "22817747", "url": "https://pubmed.ncbi.nlm.nih.gov/22817747" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q8NDF8-1", "protein_name": "Terminal nucleotidyltransferase 4B", "gene_name": "TENT4B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5XG87-1", "protein_name": "Terminal nucleotidyltransferase 4A", "gene_name": "TENT4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6NZY4-1", "protein_name": "Zinc finger CCHC domain-containing protein 8", "gene_name": "ZCCHC8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42285-1", "protein_name": "Exosome RNA helicase MTR4", "gene_name": "MTREX", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N3Z6-1", "protein_name": "Zinc finger CCHC domain-containing protein 7", "gene_name": "ZCCHC7", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q8NDF8", "url": "https://www.uniprot.org/uniprotkb/Q8NDF8" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.22817747", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 5 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Molecular cloning and characterization of a novel isoform of the non-canonical poly(A) polymerase PAPD7.", "journal": "Biochem. Biophys. Res. Commun.", "date": "2013", "authors": "Ogami K, Cho R, Hoshino S", "reference": { "type": "PubMed", "id": "23376078", "url": "https://pubmed.ncbi.nlm.nih.gov/23376078" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q8NDF8-1", "protein_name": "Terminal nucleotidyltransferase 4B", "gene_name": "TENT4B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5XG87-1", "protein_name": "Terminal nucleotidyltransferase 4A", "gene_name": "TENT4A", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q8NDF8", "url": "https://www.uniprot.org/uniprotkb/Q8NDF8" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 187, "end_pos": 250, "sequence_org": "RRKRENKASTYGLNYLLSGSRAAALSGGGGPGAQAPRPGTPWKSRAYSPGIQGLHEEIIDFYNF", "sequence_mut": "", "comment": "Localizes to cytoplasm.", "evidence": [ { "database": "UniProtKB", "id": "Q5XG87", "url": "https://www.uniprot.org/uniprotkb/Q5XG87" }, { "database": "PubMed", "id": "23376078", "url": "https://pubmed.ncbi.nlm.nih.gov/23376078" } ], "uniprot_canonical_ac": "Q5XG87-1" } ], "record_id": "pubmed.23376078", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "PAPD5-mediated 3' adenylation and subsequent degradation of miR-21 is disrupted in proliferative disease.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2014-08-05", "authors": "Boele Joost, Persson Helena, Shin Jay W, Ishizu Yuri, Newie Inga S, S\u00f8kilde Rolf, Hawkins Shannon M, Coarfa Cristian, Ikeda Kazuhiro, Takayama Ken-ichi, Horie-Inoue Kuniko, Ando Yoshinari, Burroughs A Maxwell, Sasaki Chihiro, Suzuki Chizuru, Sakai Mizuho, Aoki Shintaro, Ogawa Ayumi, Hasegawa Akira, Lizio Marina, Kaida Kaoru, Teusink Bas, Carninci Piero, Suzuki Harukazu, Inoue Satoshi, Gunaratne Preethi H, Rovira Carlos, Hayashizaki Yoshihide, de Hoon Michiel J L", "reference": { "type": "PubMed", "id": "25049417", "url": "https://pubmed.ncbi.nlm.nih.gov/25049417" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q8NDF8-1", "protein_name": "Terminal nucleotidyltransferase 4B", "gene_name": "TENT4B", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95453-1", "protein_name": "Poly(A)-specific ribonuclease PARN", "gene_name": "PARN", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q8NDF8", "url": "https://www.uniprot.org/uniprotkb/Q8NDF8" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.25049417", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Essential role for non-canonical poly(A) polymerase GLD4 in cytoplasmic polyadenylation and carbohydrate metabolism.", "journal": "Nucleic acids research", "date": "2017", "authors": "Shin J, Paek KY, Ivshina M, Stackpole EE, Richter JD", "reference": { "type": "PubMed", "id": "28383716", "url": "https://pubmed.ncbi.nlm.nih.gov/28383716" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q8NDF8-1", "protein_name": "Terminal nucleotidyltransferase 4B", "gene_name": "TENT4B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BZB8-1", "protein_name": "Cytoplasmic polyadenylation element-binding protein 1", "gene_name": "CPEB1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q8NDF8", "url": "https://www.uniprot.org/uniprotkb/Q8NDF8" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.28383716", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Mixed tailing by TENT4A and TENT4B shields mRNA from rapid deadenylation.", "journal": "Science (New York, N.Y.)", "date": "2018", "authors": "Lim J, Kim D, Lee YS, Ha M, Lee M, Yeo J, Chang H, Song J, Ahn K, Kim VN", "reference": { "type": "PubMed", "id": "30026317", "url": "https://pubmed.ncbi.nlm.nih.gov/30026317" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q8NDF8-1", "protein_name": "Terminal nucleotidyltransferase 4B", "gene_name": "TENT4B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5XG87-1", "protein_name": "Terminal nucleotidyltransferase 4A", "gene_name": "TENT4A", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q8NDF8", "url": "https://www.uniprot.org/uniprotkb/Q8NDF8" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.30026317", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Disruption of Telomerase RNA Maturation Kinetics Precipitates Disease.", "journal": "Molecular cell", "date": "2019", "authors": "Roake CM, Chen L, Chakravarthy AL, Ferrell JE Jr, Raffa GD, Artandi SE", "reference": { "type": "PubMed", "id": "30930056", "url": "https://pubmed.ncbi.nlm.nih.gov/30930056" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q8NDF8-1", "protein_name": "Terminal nucleotidyltransferase 4B", "gene_name": "TENT4B", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q8NDF8", "url": "https://www.uniprot.org/uniprotkb/Q8NDF8" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.30930056", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Viral hijacking of the TENT4-ZCCHC14 complex protects viral RNAs via mixed tailing.", "journal": "Nature structural & molecular biology", "date": "2020", "authors": "Kim D, Lee YS, Jung SJ, Yeo J, Seo JJ, Lee YY, Lim J, Chang H, Song J, Yang J, Kim JS, Jung G, Ahn K, Kim VN", "reference": { "type": "PubMed", "id": "32451488", "url": "https://pubmed.ncbi.nlm.nih.gov/32451488" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q8NDF8-1", "protein_name": "Terminal nucleotidyltransferase 4B", "gene_name": "TENT4B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5XG87-1", "protein_name": "Terminal nucleotidyltransferase 4A", "gene_name": "TENT4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8WYQ9-1", "protein_name": "Zinc finger CCHC domain-containing protein 14", "gene_name": "ZCCHC14", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q8NDF8", "url": "https://www.uniprot.org/uniprotkb/Q8NDF8" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.32451488", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Chemical inhibition of PAPD5/7 rescues telomerase function and hematopoiesis in dyskeratosis congenita.", "journal": "Blood advances", "date": "2020", "authors": "Shukla S, Jeong HC, Sturgeon CM, Parker R, Batista LFZ", "reference": { "type": "PubMed", "id": "32559291", "url": "https://pubmed.ncbi.nlm.nih.gov/32559291" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q8NDF8-1", "protein_name": "Terminal nucleotidyltransferase 4B", "gene_name": "TENT4B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5XG87-1", "protein_name": "Terminal nucleotidyltransferase 4A", "gene_name": "TENT4A", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q8NDF8", "url": "https://www.uniprot.org/uniprotkb/Q8NDF8" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.32559291", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The ZCCHC14/TENT4 complex is required for hepatitis A virus RNA synthesis.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2022", "authors": "Li Y, Misumi I, Shiota T, Sun L, Lenarcic EM, Kim H, Shirasaki T, Hertel-Wulff A, Tibbs T, Mitchell JE, McKnight KL, Cameron CE, Moorman NJ, McGivern DR, Cullen JM, Whitmire JK, Lemon SM", "reference": { "type": "PubMed", "id": "35867748", "url": "https://pubmed.ncbi.nlm.nih.gov/35867748" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q8NDF8-1", "protein_name": "Terminal nucleotidyltransferase 4B", "gene_name": "TENT4B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5XG87-1", "protein_name": "Terminal nucleotidyltransferase 4A", "gene_name": "TENT4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8WYQ9-1", "protein_name": "Zinc finger CCHC domain-containing protein 14", "gene_name": "ZCCHC14", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q8NDF8", "url": "https://www.uniprot.org/uniprotkb/Q8NDF8" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.35867748", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Protocadherin-1 is a glucocorticoid-responsive critical regulator of airway epithelial barrier function.", "journal": "BMC pulmonary medicine", "date": "2015", "authors": "Kozu Y, Gon Y, Maruoka S, Kazumichi K, Sekiyama A, Kishi H, Nomura Y, Ikeda M, Hashimoto S", "reference": { "type": "PubMed", "id": "26227965", "url": "https://pubmed.ncbi.nlm.nih.gov/26227965" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q08174-1", "protein_name": "Protocadherin-1", "gene_name": "PCDH1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q08174", "url": "https://www.uniprot.org/uniprotkb/Q08174" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.26227965", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Protocadherin-1 Localization and Cell-Adhesion Function in Airway Epithelial Cells in Asthma.", "journal": "PloS one", "date": "2016", "authors": "Faura Tellez G, Willemse BW, Brouwer U, Nijboer-Brinksma S, Vandepoele K, Noordhoek JA, Heijink I, de Vries M, Smithers NP, Postma DS, Timens W, Wiffen L, van Roy F, Holloway JW, Lackie PM, Nawijn MC, Koppelman GH", "reference": { "type": "PubMed", "id": "27701444", "url": "https://pubmed.ncbi.nlm.nih.gov/27701444" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q08174-1", "protein_name": "Protocadherin-1", "gene_name": "PCDH1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q08174", "url": "https://www.uniprot.org/uniprotkb/Q08174" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.27701444", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Protocadherin-1 is essential for cell entry by New World hantaviruses.", "journal": "Nature", "date": "2018", "authors": "Jangra RK, Herbert AS, Li R, Jae LT, Kleinfelter LM, Slough MM, Barker SL, Guardado-Calvo P, Roman-Sosa G, Dieterle ME, Kuehne AI, Muena NA, Wirchnianski AS, Nyakatura EK, Fels JM, Ng M, Mittler E, Pan J, Bharrhan S, Wec AZ, Lai JR, Sidhu SS, Tischler ND, Rey FA, Moffat J, Brummelkamp TR, Wang Z, Dye JM, Chandran K", "reference": { "type": "PubMed", "id": "30464266", "url": "https://pubmed.ncbi.nlm.nih.gov/30464266" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q08174-1", "protein_name": "Protocadherin-1", "gene_name": "PCDH1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q08174", "url": "https://www.uniprot.org/uniprotkb/Q08174" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.30464266", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "PCDH1 promotes progression of pancreatic ductal adenocarcinoma via activation of NF-kappaB signalling by interacting with KPNB1.", "journal": "Cell death & disease", "date": "2022", "authors": "Ye Z, Yang Y, Wei Y, Li L, Wang X, Zhang J", "reference": { "type": "PubMed", "id": "35864095", "url": "https://pubmed.ncbi.nlm.nih.gov/35864095" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q08174-1", "protein_name": "Protocadherin-1", "gene_name": "PCDH1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q08174", "url": "https://www.uniprot.org/uniprotkb/Q08174" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.35864095", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Insight into the Interplay of Gd-IgA1, HMGB1, RAGE and PCDH1 in IgA Vasculitis (IgAV).", "journal": "International journal of molecular sciences", "date": "2024-04-16", "authors": "Held Martina, Kozmar Ana, Sestan Mario, Turudic Daniel, Kifer Nastasia, Srsen Sasa, Gagro Alenka, Frkovic Marijan, Jelusic Marija", "reference": { "type": "PubMed", "id": "38673968", "url": "https://pubmed.ncbi.nlm.nih.gov/38673968" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q08174-1", "protein_name": "Protocadherin-1", "gene_name": "PCDH1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15109-1", "protein_name": "Advanced glycation end product-specific receptor", "gene_name": "AGER", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q08174", "url": "https://www.uniprot.org/uniprotkb/Q08174" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.38673968", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The spectrum of somatic mutations in the PIG-A gene in paroxysmal nocturnal hemoglobinuria includes large deletions and small duplications.", "journal": "Blood cells, molecules & diseases", "date": "1998", "authors": "Nafa K, Bessler M, Castro-Malaspina H, Jhanwar S, Luzzatto L", "reference": { "type": "PubMed", "id": "10087994", "url": "https://pubmed.ncbi.nlm.nih.gov/10087994" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P37287-1", "protein_name": "Phosphatidylinositol N-acetylglucosaminyltransferase subunit A", "gene_name": "PIGA", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P37287", "url": "https://www.uniprot.org/uniprotkb/P37287" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.10087994", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Mutation analysis of the PIG-A gene in Korean patients with paroxysmal nocturnal haemoglobinuria.", "journal": "Journal of clinical pathology", "date": "2002", "authors": "Yoon JH, Cho HI, Park SS, Chang YH, Kim BK", "reference": { "type": "PubMed", "id": "12037021", "url": "https://pubmed.ncbi.nlm.nih.gov/12037021" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P37287-1", "protein_name": "Phosphatidylinositol N-acetylglucosaminyltransferase subunit A", "gene_name": "PIGA", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P37287", "url": "https://www.uniprot.org/uniprotkb/P37287" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.12037021", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The phenotype of a germline mutation in PIGA: the gene somatically mutated in paroxysmal nocturnal hemoglobinuria.", "journal": "American journal of human genetics", "date": "2012", "authors": "Johnston JJ, Gropman AL, Sapp JC, Teer JK, Martin JM, Liu CF, Yuan X, Ye Z, Cheng L, Brodsky RA, Biesecker LG", "reference": { "type": "PubMed", "id": "22305531", "url": "https://pubmed.ncbi.nlm.nih.gov/22305531" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P37287-1", "protein_name": "Phosphatidylinositol N-acetylglucosaminyltransferase subunit A", "gene_name": "PIGA", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P37287", "url": "https://www.uniprot.org/uniprotkb/P37287" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "snv": [ { "evidence": [ { "id": "P37287", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/P37287" }, { "id": "rs387906726", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs387906726" }, { "id": "rs387906726", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs387906726" }, { "id": "22305531", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/22305531" }, { "id": "24706016", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24706016" }, { "id": "26545172", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/26545172" }, { "id": "8599356", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/8599356" }, { "id": "rs387906726", "database": "COSMIC", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs387906726" } ], "glycoeffect": [], "start_pos": 412, "end_pos": 412, "subjects_tested": "2053", "subjects_positive": "1", "frequency": "0.0", "sequence_org": "R", "sequence_mut": "*", "comment": "Somatic mutation passed 1 filters: protein-of-interest(glycogene, glycosyltransferase).", "chr_id": "23", "chr_pos": "15321727", "ref_nt": "G", "alt_nt": "A", "minor_allelic_frequency": "", "site_lbl": "R412", "disease": [ { "disease_id": "DOID:4159", "recommended_name": { "id": "DOID:4159", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:4159", "name": "skin cancer", "description": "An integumentary system cancer located_in the skin that is the uncontrolled growth of abnormal skin cells." }, "synonyms": [ { "id": "DOID:4159", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:4159", "name": "CA - skin cancer", "description": "" }, { "id": "DOID:4159", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:4159", "name": "malignant neoplasm of skin", "description": "" }, { "id": "DOID:4159", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:4159", "name": "melanoma and Non-melanoma skin cancer", "description": "" } ], "unlinked_id_list": [ "DOID:3149", "DOID:3451" ], "evidence": [ { "id": "4159", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:4159" } ] }, { "disease_id": "DOID:2531", "recommended_name": { "id": "DOID:2531", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:2531", "name": "hematologic cancer", "description": "An organ system cancer located in the hematological system that is characterized by uncontrolled cellular proliferation in blood, bone marrow and lymph nodes." }, "synonyms": [ { "id": "DOID:2531", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:2531", "name": "Hematologic malignancy", "description": "" }, { "id": "DOID:2531", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:2531", "name": "Hematologic neoplasm", "description": "" }, { "id": "DOID:2531", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:2531", "name": "Hematological tumors", "description": "" }, { "id": "DOID:2531", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:2531", "name": "blood cancer", "description": "" }, { "id": "DOID:2531", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:2531", "name": "hematopoietic and lymphoid system tumor", "description": "" }, { "id": "DOID:2531", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:2531", "name": "hematopoietic cancer", "description": "" }, { "id": "DOID:2531", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:2531", "name": "hematopoietic neoplasm", "description": "" }, { "id": "DOID:2531", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:2531", "name": "hematopoietic tumors", "description": "" }, { "id": "DOID:2531", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:2531", "name": "malignant hematopoietic neoplasm", "description": "" } ], "unlinked_id_list": [ "DOID:0081452", "DOID:706", "DOID:1039", "DOID:5604", "DOID:6536", "DOID:0080638", "DOID:7757", "DOID:0050743", "DOID:4960", "DOID:8527", "DOID:1036", "DOID:5772" ], "evidence": [ { "id": "2531", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:2531" } ] }, { "disease_id": "DOID:0080139", "recommended_name": { "id": "DOID:0080139", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0080139", "name": "multiple congenital anomalies-hypotonia-seizures syndrome 2", "description": "A multiple congenital anomalies-hypotonia-seizures syndrome that is characterized by X-linked recessive inheritance of dysmorphic features, neonatal hypotonia, myoclonic seizures and variable abnormalities involving the central nervous, cardiac, and urinary systems that has_material_basis_in mutation in the PIGA gene on chromosome Xp22." }, "synonyms": [ { "id": "DOID:0080139", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0080139", "name": "early infantile epileptic encephalopathy 20", "description": "" }, { "id": "DOID:0080139", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0080139", "name": "glycosylphosphatidylinositol biosynthesis defect 4", "description": "" }, { "id": "DOID:0080139", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0080139", "name": "developmental and epileptic encephalopathy 20", "description": "" }, { "id": "MONDO:0010466", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010466", "name": "multiple congenital anomalies-hypotonia-seizures syndrome 2", "description": "Any multiple congenital anomalies/dysmorphic syndrome-intellectual disability in which the cause of the disease is a mutation in the PIGA gene." }, { "id": "MONDO:0010466", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010466", "name": "DEE20", "description": "" }, { "id": "MONDO:0010466", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010466", "name": "GPIBD4", "description": "" }, { "id": "MONDO:0010466", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010466", "name": "MCAHS type 2", "description": "" }, { "id": "MONDO:0010466", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010466", "name": "MCAHS2", "description": "" }, { "id": "MONDO:0010466", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010466", "name": "PIGA multiple congenital anomalies/dysmorphic syndrome-intellectual disability", "description": "" }, { "id": "MONDO:0010466", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010466", "name": "developmental and epileptic encephalopathy 20", "description": "" }, { "id": "MONDO:0010466", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010466", "name": "epileptic encephalopathy, early infantile, 20", "description": "" }, { "id": "MONDO:0010466", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010466", "name": "glycosylphosphatidylinositol biosynthesis defect 4", "description": "" }, { "id": "MONDO:0010466", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010466", "name": "multiple congenital anomalies-hypotonia-seizures syndrome 2", "description": "" }, { "id": "MONDO:0010466", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010466", "name": "multiple congenital anomalies-hypotonia-seizures syndrome 2, X-linked recessive", "description": "" }, { "id": "MONDO:0010466", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010466", "name": "multiple congenital anomalies-hypotonia-seizures syndrome type 2", "description": "" }, { "id": "MONDO:0010466", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010466", "name": "multiple congenital anomalies/dysmorphic syndrome-intellectual disability caused by mutation in PIGA", "description": "" }, { "id": "MIM:300868", "resource": "MIM", "url": "https://www.omim.org/entry/300868", "name": "Multiple congenital anomalies-hypotonia-seizures syndrome 2", "description": "Multiple congenital anomalies-hypotonia-seizures syndrome 2" } ], "unlinked_id_list": [], "evidence": [ { "id": "300868", "database": "MIM", "url": "https://www.omim.org/entry/300868" }, { "id": "PIGA", "database": "Genomics England", "url": "https://panelapp.genomicsengland.co.uk/panels/25/gene/PIGA/#!details" }, { "id": "0080139", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0080139" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease", "ebi" ], "filter_code": "010000000000000000000.00000000000000.000000000001000000.00001.11.000.000", "uniprot_canonical_ac": "P37287-1" } ], "record_id": "pubmed.22305531", "abstract": "", "glycosylation": [], "mutagenesis": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Expanding the spectrum of phenotypes associated with germline PIGA mutations: a child with developmental delay, accelerated linear growth, facial dysmorphisms, elevated alkaline phosphatase, and progressive CNS abnormalities.", "journal": "American journal of medical genetics. Part A", "date": "2014", "authors": "van der Crabben SN, Harakalova M, Brilstra EH, van Berkestijn FM, Hofstede FC, van Vught AJ, Cuppen E, Kloosterman W, Ploos van Amstel HK, van Haaften G, van Haelst MM", "reference": { "type": "PubMed", "id": "24259184", "url": "https://pubmed.ncbi.nlm.nih.gov/24259184" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P37287-1", "protein_name": "Phosphatidylinositol N-acetylglucosaminyltransferase subunit A", "gene_name": "PIGA", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P37287", "url": "https://www.uniprot.org/uniprotkb/P37287" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "snv": [ { "evidence": [ { "id": "rs587777400", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs587777400" }, { "id": "rs587777400", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs587777400" }, { "id": "24259184", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24259184" } ], "glycoeffect": [], "start_pos": 93, "end_pos": 93, "sequence_org": "P", "sequence_mut": "L", "comment": "Germline mutation passed 1 filters: glycogene of type=glycogene, glycosyltransferase.", "chr_id": "X", "chr_pos": "15331653", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "P93", "disease": [ { "disease_id": "DOID:0080139", "recommended_name": { "id": "DOID:0080139", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0080139", "name": "multiple congenital anomalies-hypotonia-seizures syndrome 2", "description": "A multiple congenital anomalies-hypotonia-seizures syndrome that is characterized by X-linked recessive inheritance of dysmorphic features, neonatal hypotonia, myoclonic seizures and variable abnormalities involving the central nervous, cardiac, and urinary systems that has_material_basis_in mutation in the PIGA gene on chromosome Xp22." }, "synonyms": [ { "id": "DOID:0080139", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0080139", "name": "early infantile epileptic encephalopathy 20", "description": "" }, { "id": "DOID:0080139", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0080139", "name": "glycosylphosphatidylinositol biosynthesis defect 4", "description": "" }, { "id": "DOID:0080139", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0080139", "name": "developmental and epileptic encephalopathy 20", "description": "" }, { "id": "MONDO:0010466", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010466", "name": "multiple congenital anomalies-hypotonia-seizures syndrome 2", "description": "Any multiple congenital anomalies/dysmorphic syndrome-intellectual disability in which the cause of the disease is a mutation in the PIGA gene." }, { "id": "MONDO:0010466", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010466", "name": "DEE20", "description": "" }, { "id": "MONDO:0010466", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010466", "name": "GPIBD4", "description": "" }, { "id": "MONDO:0010466", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010466", "name": "MCAHS type 2", "description": "" }, { "id": "MONDO:0010466", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010466", "name": "MCAHS2", "description": "" }, { "id": "MONDO:0010466", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010466", "name": "PIGA multiple congenital anomalies/dysmorphic syndrome-intellectual disability", "description": "" }, { "id": "MONDO:0010466", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010466", "name": "developmental and epileptic encephalopathy 20", "description": "" }, { "id": "MONDO:0010466", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010466", "name": "epileptic encephalopathy, early infantile, 20", "description": "" }, { "id": "MONDO:0010466", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010466", "name": "glycosylphosphatidylinositol biosynthesis defect 4", "description": "" }, { "id": "MONDO:0010466", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010466", "name": "multiple congenital anomalies-hypotonia-seizures syndrome 2", "description": "" }, { "id": "MONDO:0010466", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010466", "name": "multiple congenital anomalies-hypotonia-seizures syndrome 2, X-linked recessive", "description": "" }, { "id": "MONDO:0010466", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010466", "name": "multiple congenital anomalies-hypotonia-seizures syndrome type 2", "description": "" }, { "id": "MONDO:0010466", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010466", "name": "multiple congenital anomalies/dysmorphic syndrome-intellectual disability caused by mutation in PIGA", "description": "" }, { "id": "MIM:300868", "resource": "MIM", "url": "https://www.omim.org/entry/300868", "name": "Multiple congenital anomalies-hypotonia-seizures syndrome 2", "description": "Multiple congenital anomalies-hypotonia-seizures syndrome 2" } ], "unlinked_id_list": [], "evidence": [ { "id": "300868", "database": "MIM", "url": "https://www.omim.org/entry/300868" }, { "id": "PIGA", "database": "Genomics England", "url": "https://panelapp.genomicsengland.co.uk/panels/25/gene/PIGA/#!details" }, { "id": "0080139", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0080139" } ] } ], "keywords": [ "ebi", "germline", "disease" ], "filter_code": "000000000000001000000.00000000000000.000000000001000000.00001.10.000.000", "uniprot_canonical_ac": "P37287-1" } ], "record_id": "pubmed.24259184", "abstract": "", "glycosylation": [], "mutagenesis": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "A novel germline PIGA mutation in Ferro-Cerebro-Cutaneous syndrome: a neurodegenerative X-linked epileptic encephalopathy with systemic iron-overload.", "journal": "American journal of medical genetics. Part A", "date": "2014", "authors": "Swoboda KJ, Margraf RL, Carey JC, Zhou H, Newcomb TM, Coonrod E, Durtschi J, Mallempati K, Kumanovics A, Katz BE, Voelkerding KV, Opitz JM", "reference": { "type": "PubMed", "id": "24259288", "url": "https://pubmed.ncbi.nlm.nih.gov/24259288" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P37287-1", "protein_name": "Phosphatidylinositol N-acetylglucosaminyltransferase subunit A", "gene_name": "PIGA", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P37287", "url": "https://www.uniprot.org/uniprotkb/P37287" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "snv": [ { "evidence": [ { "id": "rs587777399", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs587777399" }, { "id": "24259288", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24259288" } ], "glycoeffect": [], "start_pos": 344, "end_pos": 344, "sequence_org": "L", "sequence_mut": "null", "comment": "Germline mutation passed 1 filters: glycogene of type=glycogene, glycosyltransferase.", "chr_id": "X", "chr_pos": "15324821_15324823", "ref_nt": "l", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "L344", "disease": [ { "disease_id": "DOID:0080139", "recommended_name": { "id": "DOID:0080139", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0080139", "name": "multiple congenital anomalies-hypotonia-seizures syndrome 2", "description": "A multiple congenital anomalies-hypotonia-seizures syndrome that is characterized by X-linked recessive inheritance of dysmorphic features, neonatal hypotonia, myoclonic seizures and variable abnormalities involving the central nervous, cardiac, and urinary systems that has_material_basis_in mutation in the PIGA gene on chromosome Xp22." }, "synonyms": [ { "id": "DOID:0080139", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0080139", "name": "early infantile epileptic encephalopathy 20", "description": "" }, { "id": "DOID:0080139", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0080139", "name": "glycosylphosphatidylinositol biosynthesis defect 4", "description": "" }, { "id": "DOID:0080139", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0080139", "name": "developmental and epileptic encephalopathy 20", "description": "" }, { "id": "MONDO:0010466", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010466", "name": "multiple congenital anomalies-hypotonia-seizures syndrome 2", "description": "Any multiple congenital anomalies/dysmorphic syndrome-intellectual disability in which the cause of the disease is a mutation in the PIGA gene." }, { "id": "MONDO:0010466", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010466", "name": "DEE20", "description": "" }, { "id": "MONDO:0010466", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010466", "name": "GPIBD4", "description": "" }, { "id": "MONDO:0010466", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010466", "name": "MCAHS type 2", "description": "" }, { "id": "MONDO:0010466", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010466", "name": "MCAHS2", "description": "" }, { "id": "MONDO:0010466", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010466", "name": "PIGA multiple congenital anomalies/dysmorphic syndrome-intellectual disability", "description": "" }, { "id": "MONDO:0010466", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010466", "name": "developmental and epileptic encephalopathy 20", "description": "" }, { "id": "MONDO:0010466", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010466", "name": "epileptic encephalopathy, early infantile, 20", "description": "" }, { "id": "MONDO:0010466", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010466", "name": "glycosylphosphatidylinositol biosynthesis defect 4", "description": "" }, { "id": "MONDO:0010466", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010466", "name": "multiple congenital anomalies-hypotonia-seizures syndrome 2", "description": "" }, { "id": "MONDO:0010466", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010466", "name": "multiple congenital anomalies-hypotonia-seizures syndrome 2, X-linked recessive", "description": "" }, { "id": "MONDO:0010466", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010466", "name": "multiple congenital anomalies-hypotonia-seizures syndrome type 2", "description": "" }, { "id": "MONDO:0010466", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010466", "name": "multiple congenital anomalies/dysmorphic syndrome-intellectual disability caused by mutation in PIGA", "description": "" }, { "id": "MIM:300868", "resource": "MIM", "url": "https://www.omim.org/entry/300868", "name": "Multiple congenital anomalies-hypotonia-seizures syndrome 2", "description": "Multiple congenital anomalies-hypotonia-seizures syndrome 2" } ], "unlinked_id_list": [], "evidence": [ { "id": "300868", "database": "MIM", "url": "https://www.omim.org/entry/300868" }, { "id": "PIGA", "database": "Genomics England", "url": "https://panelapp.genomicsengland.co.uk/panels/25/gene/PIGA/#!details" }, { "id": "0080139", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0080139" } ] } ], "keywords": [ "ebi", "germline", "disease" ], "filter_code": "000000000010000000000.00000000000000.000000000001000000.00001.11.000.000", "uniprot_canonical_ac": "P37287-1" } ], "record_id": "pubmed.24259288", "abstract": "", "glycosylation": [], "mutagenesis": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Early frameshift mutation in PIGA identified in a large XLID family without neonatal lethality.", "journal": "Human mutation", "date": "2014-03", "authors": "Belet Stefanie, Fieremans Nathalie, Yuan Xuan, Van Esch Hilde, Verbeeck Jelle, Ye Zhaohui, Cheng Linzhao, Brodsky Brett R, Hu Hao, Kalscheuer Vera M, Brodsky Robert A, Froyen Guy", "reference": { "type": "PubMed", "id": "24357517", "url": "https://pubmed.ncbi.nlm.nih.gov/24357517" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P37287-1", "protein_name": "Phosphatidylinositol N-acetylglucosaminyltransferase subunit A", "gene_name": "PIGA", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P37287", "url": "https://www.uniprot.org/uniprotkb/P37287" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "snv": [ { "evidence": [ { "id": "rs587777397", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs587777397" }, { "id": "24357517", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24357517" }, { "id": "9307258", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/9307258" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 26, "end_pos": 26, "sequence_org": "Y", "sequence_mut": "null", "comment": "Germline mutation passed 1 filters: glycogene of type=glycogene, glycosyltransferase.", "chr_id": "X", "chr_pos": "15331857", "ref_nt": "p", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "Y26", "disease": [ { "disease_id": "DOID:0080139", "recommended_name": { "id": "DOID:0080139", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0080139", "name": "multiple congenital anomalies-hypotonia-seizures syndrome 2", "description": "A multiple congenital anomalies-hypotonia-seizures syndrome that is characterized by X-linked recessive inheritance of dysmorphic features, neonatal hypotonia, myoclonic seizures and variable abnormalities involving the central nervous, cardiac, and urinary systems that has_material_basis_in mutation in the PIGA gene on chromosome Xp22." }, "synonyms": [ { "id": "DOID:0080139", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0080139", "name": "early infantile epileptic encephalopathy 20", "description": "" }, { "id": "DOID:0080139", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0080139", "name": "glycosylphosphatidylinositol biosynthesis defect 4", "description": "" }, { "id": "DOID:0080139", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0080139", "name": "developmental and epileptic encephalopathy 20", "description": "" }, { "id": "MONDO:0010466", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010466", "name": "multiple congenital anomalies-hypotonia-seizures syndrome 2", "description": "Any multiple congenital anomalies/dysmorphic syndrome-intellectual disability in which the cause of the disease is a mutation in the PIGA gene." }, { "id": "MONDO:0010466", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010466", "name": "DEE20", "description": "" }, { "id": "MONDO:0010466", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010466", "name": "GPIBD4", "description": "" }, { "id": "MONDO:0010466", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010466", "name": "MCAHS type 2", "description": "" }, { "id": "MONDO:0010466", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010466", "name": "MCAHS2", "description": "" }, { "id": "MONDO:0010466", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010466", "name": "PIGA multiple congenital anomalies/dysmorphic syndrome-intellectual disability", "description": "" }, { "id": "MONDO:0010466", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010466", "name": "developmental and epileptic encephalopathy 20", "description": "" }, { "id": "MONDO:0010466", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010466", "name": "epileptic encephalopathy, early infantile, 20", "description": "" }, { "id": "MONDO:0010466", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010466", "name": "glycosylphosphatidylinositol biosynthesis defect 4", "description": "" }, { "id": "MONDO:0010466", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010466", "name": "multiple congenital anomalies-hypotonia-seizures syndrome 2", "description": "" }, { "id": "MONDO:0010466", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010466", "name": "multiple congenital anomalies-hypotonia-seizures syndrome 2, X-linked recessive", "description": "" }, { "id": "MONDO:0010466", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010466", "name": "multiple congenital anomalies-hypotonia-seizures syndrome type 2", "description": "" }, { "id": "MONDO:0010466", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010466", "name": "multiple congenital anomalies/dysmorphic syndrome-intellectual disability caused by mutation in PIGA", "description": "" }, { "id": "MIM:300868", "resource": "MIM", "url": "https://www.omim.org/entry/300868", "name": "Multiple congenital anomalies-hypotonia-seizures syndrome 2", "description": "Multiple congenital anomalies-hypotonia-seizures syndrome 2" } ], "unlinked_id_list": [], "evidence": [ { "id": "300868", "database": "MIM", "url": "https://www.omim.org/entry/300868" }, { "id": "PIGA", "database": "Genomics England", "url": "https://panelapp.genomicsengland.co.uk/panels/25/gene/PIGA/#!details" }, { "id": "0080139", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0080139" } ] } ], "keywords": [ "ebi", "germline", "disease" ], "filter_code": "000000000000000000100.00000000000000.000000000001000000.00001.10.000.101", "uniprot_canonical_ac": "P37287-1" } ], "record_id": "pubmed.24357517", "abstract": "", "glycosylation": [], "mutagenesis": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "PIGA mutations cause early-onset epileptic encephalopathies and distinctive features.", "journal": "Neurology", "date": "2014", "authors": "Kato M, Saitsu H, Murakami Y, Kikuchi K, Watanabe S, Iai M, Miya K, Matsuura R, Takayama R, Ohba C, Nakashima M, Tsurusaki Y, Miyake N, Hamano S, Osaka H, Hayasaka K, Kinoshita T, Matsumoto N", "reference": { "type": "PubMed", "id": "24706016", "url": "https://pubmed.ncbi.nlm.nih.gov/24706016" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P37287-1", "protein_name": "Phosphatidylinositol N-acetylglucosaminyltransferase subunit A", "gene_name": "PIGA", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P37287", "url": "https://www.uniprot.org/uniprotkb/P37287" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "snv": [ { "evidence": [ { "id": "P37287", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/P37287" }, { "id": "rs587777396", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs587777396" }, { "id": "rs587777396", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs587777396" }, { "id": "24706016", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24706016" } ], "glycoeffect": [], "start_pos": 119, "end_pos": 119, "subjects_tested": "3601", "subjects_positive": "1", "frequency": "0.0", "sequence_org": "R", "sequence_mut": "W", "comment": "Somatic mutation passed 1 filters: protein-of-interest(glycogene, glycosyltransferase).", "chr_id": "23", "chr_pos": "15331576", "ref_nt": "G", "alt_nt": "A", "minor_allelic_frequency": "", "site_lbl": "R119", "disease": [ { "disease_id": "DOID:9256", "recommended_name": { "id": "DOID:9256", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:9256", "name": "colorectal cancer", "description": "A large intestine cancer that is located_in the colon and/or located_in the rectum." }, "synonyms": [ { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "A primary or metastatic malignant neoplasm that affects the colon or rectum. Representative examples include carcinoma, lymphoma, and sarcoma." }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, advanced, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer with chromosomal instability, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectum cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectum neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "CRC", "description": "" }, { "id": "MIM:114500", "resource": "MIM", "url": "https://www.omim.org/entry/114500", "name": "Colorectal cancer", "description": "Colorectal cancer" } ], "unlinked_id_list": [], "evidence": [ { "id": "9256", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:9256" } ] }, { "disease_id": "DOID:0080139", "recommended_name": { "id": "DOID:0080139", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0080139", "name": "multiple congenital anomalies-hypotonia-seizures syndrome 2", "description": "A multiple congenital anomalies-hypotonia-seizures syndrome that is characterized by X-linked recessive inheritance of dysmorphic features, neonatal hypotonia, myoclonic seizures and variable abnormalities involving the central nervous, cardiac, and urinary systems that has_material_basis_in mutation in the PIGA gene on chromosome Xp22." }, "synonyms": [ { "id": "DOID:0080139", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0080139", "name": "early infantile epileptic encephalopathy 20", "description": "" }, { "id": "DOID:0080139", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0080139", "name": "glycosylphosphatidylinositol biosynthesis defect 4", "description": "" }, { "id": "DOID:0080139", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0080139", "name": "developmental and epileptic encephalopathy 20", "description": "" }, { "id": "MONDO:0010466", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010466", "name": "multiple congenital anomalies-hypotonia-seizures syndrome 2", "description": "Any multiple congenital anomalies/dysmorphic syndrome-intellectual disability in which the cause of the disease is a mutation in the PIGA gene." }, { "id": "MONDO:0010466", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010466", "name": "DEE20", "description": "" }, { "id": "MONDO:0010466", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010466", "name": "GPIBD4", "description": "" }, { "id": "MONDO:0010466", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010466", "name": "MCAHS type 2", "description": "" }, { "id": "MONDO:0010466", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010466", "name": "MCAHS2", "description": "" }, { "id": "MONDO:0010466", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010466", "name": "PIGA multiple congenital anomalies/dysmorphic syndrome-intellectual disability", "description": "" }, { "id": "MONDO:0010466", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010466", "name": "developmental and epileptic encephalopathy 20", "description": "" }, { "id": "MONDO:0010466", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010466", "name": "epileptic encephalopathy, early infantile, 20", "description": "" }, { "id": "MONDO:0010466", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010466", "name": "glycosylphosphatidylinositol biosynthesis defect 4", "description": "" }, { "id": "MONDO:0010466", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010466", "name": "multiple congenital anomalies-hypotonia-seizures syndrome 2", "description": "" }, { "id": "MONDO:0010466", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010466", "name": "multiple congenital anomalies-hypotonia-seizures syndrome 2, X-linked recessive", "description": "" }, { "id": "MONDO:0010466", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010466", "name": "multiple congenital anomalies-hypotonia-seizures syndrome type 2", "description": "" }, { "id": "MONDO:0010466", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010466", "name": "multiple congenital anomalies/dysmorphic syndrome-intellectual disability caused by mutation in PIGA", "description": "" }, { "id": "MIM:300868", "resource": "MIM", "url": "https://www.omim.org/entry/300868", "name": "Multiple congenital anomalies-hypotonia-seizures syndrome 2", "description": "Multiple congenital anomalies-hypotonia-seizures syndrome 2" } ], "unlinked_id_list": [], "evidence": [ { "id": "300868", "database": "MIM", "url": "https://www.omim.org/entry/300868" }, { "id": "PIGA", "database": "Genomics England", "url": "https://panelapp.genomicsengland.co.uk/panels/25/gene/PIGA/#!details" }, { "id": "0080139", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0080139" } ] }, { "disease_id": "DOID:0060284", "recommended_name": { "id": "DOID:0060284", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0060284", "name": "paroxysmal nocturnal hemoglobinuria", "description": "An acquired hemolytic anemia that is characterized by abdominal pain, hematuria, esophageal dysmotility and thrombosis, has_material_basis_in defect in the cell membrane glycosyl phosphatidylinositols that protect red blood cells from the innate complement immune system." }, "synonyms": [ { "id": "MONDO:0010438", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010438", "name": "paroxysmal nocturnal hemoglobinuria 1", "description": "Any paroxysmal nocturnal hemoglobinuria in which the cause of the disease is a mutation in the PIGA gene." }, { "id": "MONDO:0010438", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010438", "name": "PIGA paroxysmal nocturnal hemoglobinuria", "description": "" }, { "id": "MONDO:0010438", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010438", "name": "pIgA paroxysmal nocturnal hemoglobinuria", "description": "" }, { "id": "MONDO:0010438", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010438", "name": "paroxysmal nocturnal hemoglobinuria 1", "description": "" }, { "id": "MONDO:0010438", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010438", "name": "paroxysmal nocturnal hemoglobinuria caused by mutation in PIGA", "description": "" }, { "id": "MONDO:0010438", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010438", "name": "paroxysmal nocturnal hemoglobinuria caused by mutation in pIgA", "description": "" }, { "id": "MONDO:0010438", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010438", "name": "paroxysmal nocturnal hemoglobinuria type 1", "description": "" }, { "id": "MONDO:0010438", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010438", "name": "paroxysmal nocturnal hemoglobinuria, somatic", "description": "" }, { "id": "MONDO:0010438", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010438", "name": "PNH1", "description": "" }, { "id": "MONDO:0014166", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0014166", "name": "paroxysmal nocturnal hemoglobinuria 2", "description": "Any paroxysmal nocturnal hemoglobinuria in which the cause of the disease is a mutation in the PIGT gene." }, { "id": "MONDO:0014166", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0014166", "name": "PIGT paroxysmal nocturnal hemoglobinuria", "description": "" }, { "id": "MONDO:0014166", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0014166", "name": "paroxysmal nocturnal hemoglobinuria 2", "description": "" }, { "id": "MONDO:0014166", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0014166", "name": "paroxysmal nocturnal hemoglobinuria 2, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0014166", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0014166", "name": "paroxysmal nocturnal hemoglobinuria caused by mutation in PIGT", "description": "" }, { "id": "MONDO:0014166", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0014166", "name": "paroxysmal nocturnal hemoglobinuria type 2", "description": "" }, { "id": "MONDO:0014166", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0014166", "name": "PNH2", "description": "" }, { "id": "MIM:300818", "resource": "MIM", "url": "https://www.omim.org/entry/300818", "name": "Paroxysmal nocturnal hemoglobinuria 1", "description": "Paroxysmal nocturnal hemoglobinuria 1" }, { "id": "MIM:615399", "resource": "MIM", "url": "https://www.omim.org/entry/615399", "name": "Paroxysmal nocturnal hemoglobinuria 2", "description": "Paroxysmal nocturnal hemoglobinuria 2" } ], "unlinked_id_list": [], "evidence": [ { "id": "0060284", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0060284" }, { "id": "0060284", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0060284" }, { "id": "0060284", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0060284" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease", "ebi", "germline" ], "filter_code": "010000000000000000000.00000000000000.000000000001000000.00001.11.000.000", "uniprot_canonical_ac": "P37287-1" }, { "evidence": [ { "id": "rs201119959", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs201119959" }, { "id": "rs201119959", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs201119959" }, { "id": "rs201119959", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs201119959" }, { "id": "rs201119959", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs201119959#frequency_tab" }, { "id": "rs201119959", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs201119959" }, { "id": "24706016", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24706016" } ], "glycoeffect": [], "start_pos": 206, "end_pos": 206, "sequence_org": "I", "sequence_mut": "F", "comment": "Germline mutation passed 1 filters: glycogene of type=glycogene, glycosyltransferase.", "chr_id": "X", "chr_pos": "15331315", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "I206", "disease": [ { "disease_id": "DOID:0080139", "recommended_name": { "id": "DOID:0080139", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0080139", "name": "multiple congenital anomalies-hypotonia-seizures syndrome 2", "description": "A multiple congenital anomalies-hypotonia-seizures syndrome that is characterized by X-linked recessive inheritance of dysmorphic features, neonatal hypotonia, myoclonic seizures and variable abnormalities involving the central nervous, cardiac, and urinary systems that has_material_basis_in mutation in the PIGA gene on chromosome Xp22." }, "synonyms": [ { "id": "DOID:0080139", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0080139", "name": "early infantile epileptic encephalopathy 20", "description": "" }, { "id": "DOID:0080139", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0080139", "name": "glycosylphosphatidylinositol biosynthesis defect 4", "description": "" }, { "id": "DOID:0080139", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0080139", "name": "developmental and epileptic encephalopathy 20", "description": "" }, { "id": "MONDO:0010466", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010466", "name": "multiple congenital anomalies-hypotonia-seizures syndrome 2", "description": "Any multiple congenital anomalies/dysmorphic syndrome-intellectual disability in which the cause of the disease is a mutation in the PIGA gene." }, { "id": "MONDO:0010466", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010466", "name": "DEE20", "description": "" }, { "id": "MONDO:0010466", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010466", "name": "GPIBD4", "description": "" }, { "id": "MONDO:0010466", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010466", "name": "MCAHS type 2", "description": "" }, { "id": "MONDO:0010466", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010466", "name": "MCAHS2", "description": "" }, { "id": "MONDO:0010466", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010466", "name": "PIGA multiple congenital anomalies/dysmorphic syndrome-intellectual disability", "description": "" }, { "id": "MONDO:0010466", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010466", "name": "developmental and epileptic encephalopathy 20", "description": "" }, { "id": "MONDO:0010466", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010466", "name": "epileptic encephalopathy, early infantile, 20", "description": "" }, { "id": "MONDO:0010466", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010466", "name": "glycosylphosphatidylinositol biosynthesis defect 4", "description": "" }, { "id": "MONDO:0010466", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010466", "name": "multiple congenital anomalies-hypotonia-seizures syndrome 2", "description": "" }, { "id": "MONDO:0010466", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010466", "name": "multiple congenital anomalies-hypotonia-seizures syndrome 2, X-linked recessive", "description": "" }, { "id": "MONDO:0010466", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010466", "name": "multiple congenital anomalies-hypotonia-seizures syndrome type 2", "description": "" }, { "id": "MONDO:0010466", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010466", "name": "multiple congenital anomalies/dysmorphic syndrome-intellectual disability caused by mutation in PIGA", "description": "" }, { "id": "MIM:300868", "resource": "MIM", "url": "https://www.omim.org/entry/300868", "name": "Multiple congenital anomalies-hypotonia-seizures syndrome 2", "description": "Multiple congenital anomalies-hypotonia-seizures syndrome 2" } ], "unlinked_id_list": [], "evidence": [ { "id": "300868", "database": "MIM", "url": "https://www.omim.org/entry/300868" }, { "id": "PIGA", "database": "Genomics England", "url": "https://panelapp.genomicsengland.co.uk/panels/25/gene/PIGA/#!details" }, { "id": "0080139", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0080139" } ] } ], "keywords": [ "ebi", "germline", "disease" ], "filter_code": "000000000100000000000.00000000000000.000000000001000000.00001.10.000.000", "uniprot_canonical_ac": "P37287-1" }, { "evidence": [ { "id": "P37287", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/P37287" }, { "id": "rs387906726", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs387906726" }, { "id": "rs387906726", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs387906726" }, { "id": "22305531", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/22305531" }, { "id": "24706016", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24706016" }, { "id": "26545172", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/26545172" }, { "id": "8599356", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/8599356" }, { "id": "rs387906726", "database": "COSMIC", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs387906726" } ], "glycoeffect": [], "start_pos": 412, "end_pos": 412, "subjects_tested": "2053", "subjects_positive": "1", "frequency": "0.0", "sequence_org": "R", "sequence_mut": "*", "comment": "Somatic mutation passed 1 filters: protein-of-interest(glycogene, glycosyltransferase).", "chr_id": "23", "chr_pos": "15321727", "ref_nt": "G", "alt_nt": "A", "minor_allelic_frequency": "", "site_lbl": "R412", "disease": [ { "disease_id": "DOID:4159", "recommended_name": { "id": "DOID:4159", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:4159", "name": "skin cancer", "description": "An integumentary system cancer located_in the skin that is the uncontrolled growth of abnormal skin cells." }, "synonyms": [ { "id": "DOID:4159", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:4159", "name": "CA - skin cancer", "description": "" }, { "id": "DOID:4159", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:4159", "name": "malignant neoplasm of skin", "description": "" }, { "id": "DOID:4159", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:4159", "name": "melanoma and Non-melanoma skin cancer", "description": "" } ], "unlinked_id_list": [ "DOID:3149", "DOID:3451" ], "evidence": [ { "id": "4159", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:4159" } ] }, { "disease_id": "DOID:2531", "recommended_name": { "id": "DOID:2531", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:2531", "name": "hematologic cancer", "description": "An organ system cancer located in the hematological system that is characterized by uncontrolled cellular proliferation in blood, bone marrow and lymph nodes." }, "synonyms": [ { "id": "DOID:2531", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:2531", "name": "Hematologic malignancy", "description": "" }, { "id": "DOID:2531", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:2531", "name": "Hematologic neoplasm", "description": "" }, { "id": "DOID:2531", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:2531", "name": "Hematological tumors", "description": "" }, { "id": "DOID:2531", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:2531", "name": "blood cancer", "description": "" }, { "id": "DOID:2531", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:2531", "name": "hematopoietic and lymphoid system tumor", "description": "" }, { "id": "DOID:2531", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:2531", "name": "hematopoietic cancer", "description": "" }, { "id": "DOID:2531", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:2531", "name": "hematopoietic neoplasm", "description": "" }, { "id": "DOID:2531", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:2531", "name": "hematopoietic tumors", "description": "" }, { "id": "DOID:2531", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:2531", "name": "malignant hematopoietic neoplasm", "description": "" } ], "unlinked_id_list": [ "DOID:0081452", "DOID:706", "DOID:1039", "DOID:5604", "DOID:6536", "DOID:0080638", "DOID:7757", "DOID:0050743", "DOID:4960", "DOID:8527", "DOID:1036", "DOID:5772" ], "evidence": [ { "id": "2531", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:2531" } ] }, { "disease_id": "DOID:0080139", "recommended_name": { "id": "DOID:0080139", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0080139", "name": "multiple congenital anomalies-hypotonia-seizures syndrome 2", "description": "A multiple congenital anomalies-hypotonia-seizures syndrome that is characterized by X-linked recessive inheritance of dysmorphic features, neonatal hypotonia, myoclonic seizures and variable abnormalities involving the central nervous, cardiac, and urinary systems that has_material_basis_in mutation in the PIGA gene on chromosome Xp22." }, "synonyms": [ { "id": "DOID:0080139", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0080139", "name": "early infantile epileptic encephalopathy 20", "description": "" }, { "id": "DOID:0080139", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0080139", "name": "glycosylphosphatidylinositol biosynthesis defect 4", "description": "" }, { "id": "DOID:0080139", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0080139", "name": "developmental and epileptic encephalopathy 20", "description": "" }, { "id": "MONDO:0010466", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010466", "name": "multiple congenital anomalies-hypotonia-seizures syndrome 2", "description": "Any multiple congenital anomalies/dysmorphic syndrome-intellectual disability in which the cause of the disease is a mutation in the PIGA gene." }, { "id": "MONDO:0010466", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010466", "name": "DEE20", "description": "" }, { "id": "MONDO:0010466", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010466", "name": "GPIBD4", "description": "" }, { "id": "MONDO:0010466", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010466", "name": "MCAHS type 2", "description": "" }, { "id": "MONDO:0010466", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010466", "name": "MCAHS2", "description": "" }, { "id": "MONDO:0010466", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010466", "name": "PIGA multiple congenital anomalies/dysmorphic syndrome-intellectual disability", "description": "" }, { "id": "MONDO:0010466", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010466", "name": "developmental and epileptic encephalopathy 20", "description": "" }, { "id": "MONDO:0010466", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010466", "name": "epileptic encephalopathy, early infantile, 20", "description": "" }, { "id": "MONDO:0010466", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010466", "name": "glycosylphosphatidylinositol biosynthesis defect 4", "description": "" }, { "id": "MONDO:0010466", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010466", "name": "multiple congenital anomalies-hypotonia-seizures syndrome 2", "description": "" }, { "id": "MONDO:0010466", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010466", "name": "multiple congenital anomalies-hypotonia-seizures syndrome 2, X-linked recessive", "description": "" }, { "id": "MONDO:0010466", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010466", "name": "multiple congenital anomalies-hypotonia-seizures syndrome type 2", "description": "" }, { "id": "MONDO:0010466", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010466", "name": "multiple congenital anomalies/dysmorphic syndrome-intellectual disability caused by mutation in PIGA", "description": "" }, { "id": "MIM:300868", "resource": "MIM", "url": "https://www.omim.org/entry/300868", "name": "Multiple congenital anomalies-hypotonia-seizures syndrome 2", "description": "Multiple congenital anomalies-hypotonia-seizures syndrome 2" } ], "unlinked_id_list": [], "evidence": [ { "id": "300868", "database": "MIM", "url": "https://www.omim.org/entry/300868" }, { "id": "PIGA", "database": "Genomics England", "url": "https://panelapp.genomicsengland.co.uk/panels/25/gene/PIGA/#!details" }, { "id": "0080139", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0080139" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease", "ebi" ], "filter_code": "010000000000000000000.00000000000000.000000000001000000.00001.11.000.000", "uniprot_canonical_ac": "P37287-1" }, { "evidence": [ { "id": "rs587777398", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs587777398" }, { "id": "rs587777398", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs587777398" }, { "id": "24706016", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24706016" } ], "glycoeffect": [], "start_pos": 77, "end_pos": 77, "sequence_org": "R", "sequence_mut": "L", "comment": "Germline mutation passed 1 filters: glycogene of type=glycogene, glycosyltransferase.", "chr_id": "X", "chr_pos": "15331701", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "R77", "disease": [ { "disease_id": "DOID:0080139", "recommended_name": { "id": "DOID:0080139", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0080139", "name": "multiple congenital anomalies-hypotonia-seizures syndrome 2", "description": "A multiple congenital anomalies-hypotonia-seizures syndrome that is characterized by X-linked recessive inheritance of dysmorphic features, neonatal hypotonia, myoclonic seizures and variable abnormalities involving the central nervous, cardiac, and urinary systems that has_material_basis_in mutation in the PIGA gene on chromosome Xp22." }, "synonyms": [ { "id": "DOID:0080139", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0080139", "name": "early infantile epileptic encephalopathy 20", "description": "" }, { "id": "DOID:0080139", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0080139", "name": "glycosylphosphatidylinositol biosynthesis defect 4", "description": "" }, { "id": "DOID:0080139", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0080139", "name": "developmental and epileptic encephalopathy 20", "description": "" }, { "id": "MONDO:0010466", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010466", "name": "multiple congenital anomalies-hypotonia-seizures syndrome 2", "description": "Any multiple congenital anomalies/dysmorphic syndrome-intellectual disability in which the cause of the disease is a mutation in the PIGA gene." }, { "id": "MONDO:0010466", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010466", "name": "DEE20", "description": "" }, { "id": "MONDO:0010466", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010466", "name": "GPIBD4", "description": "" }, { "id": "MONDO:0010466", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010466", "name": "MCAHS type 2", "description": "" }, { "id": "MONDO:0010466", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010466", "name": "MCAHS2", "description": "" }, { "id": "MONDO:0010466", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010466", "name": "PIGA multiple congenital anomalies/dysmorphic syndrome-intellectual disability", "description": "" }, { "id": "MONDO:0010466", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010466", "name": "developmental and epileptic encephalopathy 20", "description": "" }, { "id": "MONDO:0010466", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010466", "name": "epileptic encephalopathy, early infantile, 20", "description": "" }, { "id": "MONDO:0010466", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010466", "name": "glycosylphosphatidylinositol biosynthesis defect 4", "description": "" }, { "id": "MONDO:0010466", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010466", "name": "multiple congenital anomalies-hypotonia-seizures syndrome 2", "description": "" }, { "id": "MONDO:0010466", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010466", "name": "multiple congenital anomalies-hypotonia-seizures syndrome 2, X-linked recessive", "description": "" }, { "id": "MONDO:0010466", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010466", "name": "multiple congenital anomalies-hypotonia-seizures syndrome type 2", "description": "" }, { "id": "MONDO:0010466", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010466", "name": "multiple congenital anomalies/dysmorphic syndrome-intellectual disability caused by mutation in PIGA", "description": "" }, { "id": "MIM:300868", "resource": "MIM", "url": "https://www.omim.org/entry/300868", "name": "Multiple congenital anomalies-hypotonia-seizures syndrome 2", "description": "Multiple congenital anomalies-hypotonia-seizures syndrome 2" } ], "unlinked_id_list": [], "evidence": [ { "id": "300868", "database": "MIM", "url": "https://www.omim.org/entry/300868" }, { "id": "PIGA", "database": "Genomics England", "url": "https://panelapp.genomicsengland.co.uk/panels/25/gene/PIGA/#!details" }, { "id": "0080139", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0080139" } ] } ], "keywords": [ "ebi", "germline", "disease" ], "filter_code": "010000000000000000000.00000000000000.000000000001000000.00001.11.000.000", "uniprot_canonical_ac": "P37287-1" } ], "record_id": "pubmed.24706016", "abstract": "", "glycosylation": [], "mutagenesis": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "A recurrent germline mutation in the PIGA gene causes Simpson-Golabi-Behmel syndrome type 2.", "journal": "American journal of medical genetics. Part A", "date": "2016", "authors": "Fauth C, Steindl K, Toutain A, Farrell S, Witsch-Baumgartner M, Karall D, Joset P, Bohm S, Baumer A, Maier O, Zschocke J, Weksberg R, Marshall CR, Rauch A", "reference": { "type": "PubMed", "id": "26545172", "url": "https://pubmed.ncbi.nlm.nih.gov/26545172" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P37287-1", "protein_name": "Phosphatidylinositol N-acetylglucosaminyltransferase subunit A", "gene_name": "PIGA", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P37287", "url": "https://www.uniprot.org/uniprotkb/P37287" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "snv": [ { "evidence": [ { "id": "P37287", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/P37287" }, { "id": "rs387906726", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs387906726" }, { "id": "rs387906726", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs387906726" }, { "id": "22305531", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/22305531" }, { "id": "24706016", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24706016" }, { "id": "26545172", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/26545172" }, { "id": "8599356", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/8599356" }, { "id": "rs387906726", "database": "COSMIC", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs387906726" } ], "glycoeffect": [], "start_pos": 412, "end_pos": 412, "subjects_tested": "2053", "subjects_positive": "1", "frequency": "0.0", "sequence_org": "R", "sequence_mut": "*", "comment": "Somatic mutation passed 1 filters: protein-of-interest(glycogene, glycosyltransferase).", "chr_id": "23", "chr_pos": "15321727", "ref_nt": "G", "alt_nt": "A", "minor_allelic_frequency": "", "site_lbl": "R412", "disease": [ { "disease_id": "DOID:4159", "recommended_name": { "id": "DOID:4159", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:4159", "name": "skin cancer", "description": "An integumentary system cancer located_in the skin that is the uncontrolled growth of abnormal skin cells." }, "synonyms": [ { "id": "DOID:4159", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:4159", "name": "CA - skin cancer", "description": "" }, { "id": "DOID:4159", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:4159", "name": "malignant neoplasm of skin", "description": "" }, { "id": "DOID:4159", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:4159", "name": "melanoma and Non-melanoma skin cancer", "description": "" } ], "unlinked_id_list": [ "DOID:3149", "DOID:3451" ], "evidence": [ { "id": "4159", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:4159" } ] }, { "disease_id": "DOID:2531", "recommended_name": { "id": "DOID:2531", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:2531", "name": "hematologic cancer", "description": "An organ system cancer located in the hematological system that is characterized by uncontrolled cellular proliferation in blood, bone marrow and lymph nodes." }, "synonyms": [ { "id": "DOID:2531", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:2531", "name": "Hematologic malignancy", "description": "" }, { "id": "DOID:2531", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:2531", "name": "Hematologic neoplasm", "description": "" }, { "id": "DOID:2531", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:2531", "name": "Hematological tumors", "description": "" }, { "id": "DOID:2531", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:2531", "name": "blood cancer", "description": "" }, { "id": "DOID:2531", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:2531", "name": "hematopoietic and lymphoid system tumor", "description": "" }, { "id": "DOID:2531", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:2531", "name": "hematopoietic cancer", "description": "" }, { "id": "DOID:2531", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:2531", "name": "hematopoietic neoplasm", "description": "" }, { "id": "DOID:2531", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:2531", "name": "hematopoietic tumors", "description": "" }, { "id": "DOID:2531", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:2531", "name": "malignant hematopoietic neoplasm", "description": "" } ], "unlinked_id_list": [ "DOID:0081452", "DOID:706", "DOID:1039", "DOID:5604", "DOID:6536", "DOID:0080638", "DOID:7757", "DOID:0050743", "DOID:4960", "DOID:8527", "DOID:1036", "DOID:5772" ], "evidence": [ { "id": "2531", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:2531" } ] }, { "disease_id": "DOID:0080139", "recommended_name": { "id": "DOID:0080139", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0080139", "name": "multiple congenital anomalies-hypotonia-seizures syndrome 2", "description": "A multiple congenital anomalies-hypotonia-seizures syndrome that is characterized by X-linked recessive inheritance of dysmorphic features, neonatal hypotonia, myoclonic seizures and variable abnormalities involving the central nervous, cardiac, and urinary systems that has_material_basis_in mutation in the PIGA gene on chromosome Xp22." }, "synonyms": [ { "id": "DOID:0080139", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0080139", "name": "early infantile epileptic encephalopathy 20", "description": "" }, { "id": "DOID:0080139", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0080139", "name": "glycosylphosphatidylinositol biosynthesis defect 4", "description": "" }, { "id": "DOID:0080139", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0080139", "name": "developmental and epileptic encephalopathy 20", "description": "" }, { "id": "MONDO:0010466", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010466", "name": "multiple congenital anomalies-hypotonia-seizures syndrome 2", "description": "Any multiple congenital anomalies/dysmorphic syndrome-intellectual disability in which the cause of the disease is a mutation in the PIGA gene." }, { "id": "MONDO:0010466", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010466", "name": "DEE20", "description": "" }, { "id": "MONDO:0010466", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010466", "name": "GPIBD4", "description": "" }, { "id": "MONDO:0010466", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010466", "name": "MCAHS type 2", "description": "" }, { "id": "MONDO:0010466", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010466", "name": "MCAHS2", "description": "" }, { "id": "MONDO:0010466", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010466", "name": "PIGA multiple congenital anomalies/dysmorphic syndrome-intellectual disability", "description": "" }, { "id": "MONDO:0010466", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010466", "name": "developmental and epileptic encephalopathy 20", "description": "" }, { "id": "MONDO:0010466", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010466", "name": "epileptic encephalopathy, early infantile, 20", "description": "" }, { "id": "MONDO:0010466", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010466", "name": "glycosylphosphatidylinositol biosynthesis defect 4", "description": "" }, { "id": "MONDO:0010466", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010466", "name": "multiple congenital anomalies-hypotonia-seizures syndrome 2", "description": "" }, { "id": "MONDO:0010466", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010466", "name": "multiple congenital anomalies-hypotonia-seizures syndrome 2, X-linked recessive", "description": "" }, { "id": "MONDO:0010466", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010466", "name": "multiple congenital anomalies-hypotonia-seizures syndrome type 2", "description": "" }, { "id": "MONDO:0010466", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010466", "name": "multiple congenital anomalies/dysmorphic syndrome-intellectual disability caused by mutation in PIGA", "description": "" }, { "id": "MIM:300868", "resource": "MIM", "url": "https://www.omim.org/entry/300868", "name": "Multiple congenital anomalies-hypotonia-seizures syndrome 2", "description": "Multiple congenital anomalies-hypotonia-seizures syndrome 2" } ], "unlinked_id_list": [], "evidence": [ { "id": "300868", "database": "MIM", "url": "https://www.omim.org/entry/300868" }, { "id": "PIGA", "database": "Genomics England", "url": "https://panelapp.genomicsengland.co.uk/panels/25/gene/PIGA/#!details" }, { "id": "0080139", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0080139" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease", "ebi" ], "filter_code": "010000000000000000000.00000000000000.000000000001000000.00001.11.000.000", "uniprot_canonical_ac": "P37287-1" } ], "record_id": "pubmed.26545172", "abstract": "", "glycosylation": [], "mutagenesis": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Constitutional PIGA mutations cause a novel subtype of hemochromatosis in patients with neurologic dysfunction.", "journal": "Blood", "date": "2022", "authors": "Muckenthaler L, Marques O, Colucci S, Kunz J, Fabrowski P, Bast T, Altamura S, Hochsmann B, Schrezenmeier H, Langlotz M, Richter-Pechanska P, Rausch T, Hofmeister-Mielke N, Gunkel N, Hentze MW, Kulozik AE, Muckenthaler MU", "reference": { "type": "PubMed", "id": "34875027", "url": "https://pubmed.ncbi.nlm.nih.gov/34875027" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P37287-1", "protein_name": "Phosphatidylinositol N-acetylglucosaminyltransferase subunit A", "gene_name": "PIGA", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P37287", "url": "https://www.uniprot.org/uniprotkb/P37287" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "snv": [ { "evidence": [ { "id": "rs2147723740", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs2147723740" }, { "id": "rs2147723740", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs2147723740" }, { "id": "34875027", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34875027" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 127, "end_pos": 127, "sequence_org": "S", "sequence_mut": "L", "comment": "Germline mutation passed 1 filters: glycogene of type=glycogene, glycosyltransferase.", "chr_id": "X", "chr_pos": "15331551", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S127", "keywords": [ "ebi", "germline" ], "filter_code": "000000000000000100000.00000000000000.000000000001000000.00001.10.000.001", "uniprot_canonical_ac": "P37287-1" }, { "evidence": [ { "id": "rs761007687", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs761007687" }, { "id": "rs761007687", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs761007687" }, { "id": "rs761007687", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs761007687" }, { "id": "34875027", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34875027" } ], "glycoeffect": [], "start_pos": 344, "end_pos": 344, "sequence_org": "L", "sequence_mut": "P", "comment": "Germline mutation passed 1 filters: glycogene of type=glycogene, glycosyltransferase.", "chr_id": "X", "chr_pos": "15324822", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "L344", "keywords": [ "ebi", "germline" ], "filter_code": "000000000010000000000.00000000000000.000000000001000000.00001.11.000.000", "uniprot_canonical_ac": "P37287-1" }, { "evidence": [ { "id": "rs587777398", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs587777398" }, { "id": "rs587777398", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs587777398" }, { "id": "34875027", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34875027" }, { "id": "rs587777398", "database": "COSMIC", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs587777398" } ], "glycoeffect": [], "start_pos": 77, "end_pos": 77, "sequence_org": "R", "sequence_mut": "Q", "comment": "Somatic mutation passed 1 filters: glycogene of type=glycogene, glycosyltransferase.", "chr_id": "X", "chr_pos": "15331701", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "R77", "keywords": [ "ebi", "somatic" ], "filter_code": "010000000000000000000.00000000000000.000000000001000000.00001.11.000.000", "uniprot_canonical_ac": "P37287-1" } ], "record_id": "pubmed.34875027", "abstract": "", "glycosylation": [], "mutagenesis": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "PIG-A gene mutation as a mutagenicity biomarker among coke oven workers.", "journal": "Food and chemical toxicology : an international journal published for the British Industrial Biological Research Association", "date": "2023-08", "authors": "Xi Jing, Cao Yiyi, Wang Yanhua, You Xinyue, Liu Weiying, Wang Ting, Yin Jingjing, Ma Junxiang, Wang Zhenjie, Wu Nan, Zhang Xinyu, Duan Huawei, Luan Yang", "reference": { "type": "PubMed", "id": "37271276", "url": "https://pubmed.ncbi.nlm.nih.gov/37271276" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P37287-1", "protein_name": "Phosphatidylinositol N-acetylglucosaminyltransferase subunit A", "gene_name": "PIGA", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P37287", "url": "https://www.uniprot.org/uniprotkb/P37287" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.37271276", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Congenital diaphragmatic hernia in siblings with PIGA-related congenital disorder of glycosylation.", "journal": "American journal of medical genetics. Part A", "date": "2023-08-17", "authors": "Crenshaw Molly M, Thompson Lauren, Piqu\u00e9 Daniel G, Micke Kestutis, Saenz Margarita, Baker Peter R", "reference": { "type": "PubMed", "id": "37589195", "url": "https://pubmed.ncbi.nlm.nih.gov/37589195" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P37287-1", "protein_name": "Phosphatidylinositol N-acetylglucosaminyltransferase subunit A", "gene_name": "PIGA", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P37287", "url": "https://www.uniprot.org/uniprotkb/P37287" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.37589195", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "PIGA Mutations and Glycosylphosphatidylinositol Anchor Dysregulation in Polyposis-Associated Duodenal Tumorigenesis.", "journal": "Molecular cancer research : MCR", "date": "2024-06-04", "authors": "Meuser Elena, Chang Kyle, Walters Angharad, Hurley Joanna J, West Hannah D, Perry Iain, Mort Matthew, Reyes-Uribe Laura, Truscott Rebekah, Jones Nicholas, Lawrence Rachel, Jenkins Gareth, Giles Peter, Dolwani Sunil, Al-Sarireh Bilal, Hawkes Neil, Short Emma, Williams Geraint T, Taggart Melissa W, Luetchford Kim, Lynch Patrick M, Terlouw Diantha, Nielsen Maartje, Walton Sarah-Jane, Latchford Andrew, Clark Susan K, Sampson Julian R, Vilar Eduardo, Thomas Laura E", "reference": { "type": "PubMed", "id": "38546397", "url": "https://pubmed.ncbi.nlm.nih.gov/38546397" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P37287-1", "protein_name": "Phosphatidylinositol N-acetylglucosaminyltransferase subunit A", "gene_name": "PIGA", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P37287", "url": "https://www.uniprot.org/uniprotkb/P37287" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.38546397", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The cloning of PIG-A, a component in the early step of GPI-anchor biosynthesis.", "journal": "Science", "date": "1993", "authors": "Miyata T, Takeda J, Iida Y, Yamada N, Inoue N, Takahashi M, Maeda K, Kitani T, Kinoshita T", "reference": { "type": "PubMed", "id": "7680492", "url": "https://pubmed.ncbi.nlm.nih.gov/7680492" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P37287-1", "protein_name": "Phosphatidylinositol N-acetylglucosaminyltransferase subunit A", "gene_name": "PIGA", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P37287", "url": "https://www.uniprot.org/uniprotkb/P37287" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.7680492", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Characterization of alternatively spliced PIG-A transcripts in normal and paroxysmal nocturnal hemoglobinuria cells.", "journal": "Braz. J. Med. Biol. Res.", "date": "1994", "authors": "Yu J, Nagarajan S, Ueda E, Knez JJ, Petersen RB, Medof ME", "reference": { "type": "PubMed", "id": "8081230", "url": "https://pubmed.ncbi.nlm.nih.gov/8081230" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P37287-1", "protein_name": "Phosphatidylinositol N-acetylglucosaminyltransferase subunit A", "gene_name": "PIGA", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P37287", "url": "https://www.uniprot.org/uniprotkb/P37287" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.8081230", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Genomic organization of the X-linked gene (PIG-A) that is mutated in paroxysmal nocturnal haemoglobinuria and of a related autosomal pseudogene mapped to 12q21.", "journal": "Hum. Mol. Genet.", "date": "1994", "authors": "Bessler M, Hillmen P, Longo L, Luzzatto L, Mason PJ", "reference": { "type": "PubMed", "id": "8081362", "url": "https://pubmed.ncbi.nlm.nih.gov/8081362" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P37287-1", "protein_name": "Phosphatidylinositol N-acetylglucosaminyltransferase subunit A", "gene_name": "PIGA", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P37287", "url": "https://www.uniprot.org/uniprotkb/P37287" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.8081362", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Mutations within the Piga gene in patients with paroxysmal nocturnal hemoglobinuria.", "journal": "Blood", "date": "1994", "authors": "Ware RE, Rosse WF, Howard TA", "reference": { "type": "PubMed", "id": "8167330", "url": "https://pubmed.ncbi.nlm.nih.gov/8167330" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P37287-1", "protein_name": "Phosphatidylinositol N-acetylglucosaminyltransferase subunit A", "gene_name": "PIGA", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P37287", "url": "https://www.uniprot.org/uniprotkb/P37287" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.8167330", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Characterization of genomic PIG-A gene: a gene for glycosylphosphatidylinositol-anchor biosynthesis and paroxysmal nocturnal hemoglobinuria.", "journal": "Blood", "date": "1994", "authors": "Iida Y, Takeda J, Miyata T, Inoue N, Nishimura J, Kitani T, Maeda K, Kinoshita T", "reference": { "type": "PubMed", "id": "8193350", "url": "https://pubmed.ncbi.nlm.nih.gov/8193350" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P37287-1", "protein_name": "Phosphatidylinositol N-acetylglucosaminyltransferase subunit A", "gene_name": "PIGA", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P37287", "url": "https://www.uniprot.org/uniprotkb/P37287" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.8193350", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Paroxysmal nocturnal haemoglobinuria (PNH) is caused by somatic mutations in the PIG-A gene.", "journal": "The EMBO journal", "date": "1994", "authors": "Bessler M, Mason PJ, Hillmen P, Miyata T, Yamada N, Takeda J, Luzzatto L, Kinoshita T", "reference": { "type": "PubMed", "id": "8306954", "url": "https://pubmed.ncbi.nlm.nih.gov/8306954" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P37287-1", "protein_name": "Phosphatidylinositol N-acetylglucosaminyltransferase subunit A", "gene_name": "PIGA", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P37287", "url": "https://www.uniprot.org/uniprotkb/P37287" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.8306954", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Deficiency of the GPI anchor caused by a somatic mutation of the PIG-A gene in paroxysmal nocturnal hemoglobinuria.", "journal": "Cell", "date": "1993", "authors": "Takeda J, Miyata T, Kawagoe K, Iida Y, Endo Y, Fujita T, Takahashi M, Kitani T, Kinoshita T", "reference": { "type": "PubMed", "id": "8500164", "url": "https://pubmed.ncbi.nlm.nih.gov/8500164" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P37287-1", "protein_name": "Phosphatidylinositol N-acetylglucosaminyltransferase subunit A", "gene_name": "PIGA", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P37287", "url": "https://www.uniprot.org/uniprotkb/P37287" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.8500164", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Infantile lethal variant of Simpson-Golabi-Behmel syndrome associated with hydrops fetalis.", "journal": "American journal of medical genetics", "date": "1995-11-20", "authors": "Terespolsky D, Farrell S A, Siegel-Bartelt J, Weksberg R", "reference": { "type": "PubMed", "id": "8599356", "url": "https://pubmed.ncbi.nlm.nih.gov/8599356" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P37287-1", "protein_name": "Phosphatidylinositol N-acetylglucosaminyltransferase subunit A", "gene_name": "PIGA", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P37287", "url": "https://www.uniprot.org/uniprotkb/P37287" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "snv": [ { "evidence": [ { "id": "P37287", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/P37287" }, { "id": "rs387906726", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs387906726" }, { "id": "rs387906726", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs387906726" }, { "id": "22305531", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/22305531" }, { "id": "24706016", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24706016" }, { "id": "26545172", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/26545172" }, { "id": "8599356", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/8599356" }, { "id": "rs387906726", "database": "COSMIC", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs387906726" } ], "glycoeffect": [], "start_pos": 412, "end_pos": 412, "subjects_tested": "2053", "subjects_positive": "1", "frequency": "0.0", "sequence_org": "R", "sequence_mut": "*", "comment": "Somatic mutation passed 1 filters: protein-of-interest(glycogene, glycosyltransferase).", "chr_id": "23", "chr_pos": "15321727", "ref_nt": "G", "alt_nt": "A", "minor_allelic_frequency": "", "site_lbl": "R412", "disease": [ { "disease_id": "DOID:4159", "recommended_name": { "id": "DOID:4159", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:4159", "name": "skin cancer", "description": "An integumentary system cancer located_in the skin that is the uncontrolled growth of abnormal skin cells." }, "synonyms": [ { "id": "DOID:4159", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:4159", "name": "CA - skin cancer", "description": "" }, { "id": "DOID:4159", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:4159", "name": "malignant neoplasm of skin", "description": "" }, { "id": "DOID:4159", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:4159", "name": "melanoma and Non-melanoma skin cancer", "description": "" } ], "unlinked_id_list": [ "DOID:3149", "DOID:3451" ], "evidence": [ { "id": "4159", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:4159" } ] }, { "disease_id": "DOID:2531", "recommended_name": { "id": "DOID:2531", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:2531", "name": "hematologic cancer", "description": "An organ system cancer located in the hematological system that is characterized by uncontrolled cellular proliferation in blood, bone marrow and lymph nodes." }, "synonyms": [ { "id": "DOID:2531", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:2531", "name": "Hematologic malignancy", "description": "" }, { "id": "DOID:2531", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:2531", "name": "Hematologic neoplasm", "description": "" }, { "id": "DOID:2531", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:2531", "name": "Hematological tumors", "description": "" }, { "id": "DOID:2531", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:2531", "name": "blood cancer", "description": "" }, { "id": "DOID:2531", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:2531", "name": "hematopoietic and lymphoid system tumor", "description": "" }, { "id": "DOID:2531", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:2531", "name": "hematopoietic cancer", "description": "" }, { "id": "DOID:2531", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:2531", "name": "hematopoietic neoplasm", "description": "" }, { "id": "DOID:2531", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:2531", "name": "hematopoietic tumors", "description": "" }, { "id": "DOID:2531", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:2531", "name": "malignant hematopoietic neoplasm", "description": "" } ], "unlinked_id_list": [ "DOID:0081452", "DOID:706", "DOID:1039", "DOID:5604", "DOID:6536", "DOID:0080638", "DOID:7757", "DOID:0050743", "DOID:4960", "DOID:8527", "DOID:1036", "DOID:5772" ], "evidence": [ { "id": "2531", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:2531" } ] }, { "disease_id": "DOID:0080139", "recommended_name": { "id": "DOID:0080139", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0080139", "name": "multiple congenital anomalies-hypotonia-seizures syndrome 2", "description": "A multiple congenital anomalies-hypotonia-seizures syndrome that is characterized by X-linked recessive inheritance of dysmorphic features, neonatal hypotonia, myoclonic seizures and variable abnormalities involving the central nervous, cardiac, and urinary systems that has_material_basis_in mutation in the PIGA gene on chromosome Xp22." }, "synonyms": [ { "id": "DOID:0080139", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0080139", "name": "early infantile epileptic encephalopathy 20", "description": "" }, { "id": "DOID:0080139", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0080139", "name": "glycosylphosphatidylinositol biosynthesis defect 4", "description": "" }, { "id": "DOID:0080139", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0080139", "name": "developmental and epileptic encephalopathy 20", "description": "" }, { "id": "MONDO:0010466", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010466", "name": "multiple congenital anomalies-hypotonia-seizures syndrome 2", "description": "Any multiple congenital anomalies/dysmorphic syndrome-intellectual disability in which the cause of the disease is a mutation in the PIGA gene." }, { "id": "MONDO:0010466", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010466", "name": "DEE20", "description": "" }, { "id": "MONDO:0010466", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010466", "name": "GPIBD4", "description": "" }, { "id": "MONDO:0010466", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010466", "name": "MCAHS type 2", "description": "" }, { "id": "MONDO:0010466", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010466", "name": "MCAHS2", "description": "" }, { "id": "MONDO:0010466", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010466", "name": "PIGA multiple congenital anomalies/dysmorphic syndrome-intellectual disability", "description": "" }, { "id": "MONDO:0010466", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010466", "name": "developmental and epileptic encephalopathy 20", "description": "" }, { "id": "MONDO:0010466", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010466", "name": "epileptic encephalopathy, early infantile, 20", "description": "" }, { "id": "MONDO:0010466", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010466", "name": "glycosylphosphatidylinositol biosynthesis defect 4", "description": "" }, { "id": "MONDO:0010466", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010466", "name": "multiple congenital anomalies-hypotonia-seizures syndrome 2", "description": "" }, { "id": "MONDO:0010466", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010466", "name": "multiple congenital anomalies-hypotonia-seizures syndrome 2, X-linked recessive", "description": "" }, { "id": "MONDO:0010466", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010466", "name": "multiple congenital anomalies-hypotonia-seizures syndrome type 2", "description": "" }, { "id": "MONDO:0010466", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010466", "name": "multiple congenital anomalies/dysmorphic syndrome-intellectual disability caused by mutation in PIGA", "description": "" }, { "id": "MIM:300868", "resource": "MIM", "url": "https://www.omim.org/entry/300868", "name": "Multiple congenital anomalies-hypotonia-seizures syndrome 2", "description": "Multiple congenital anomalies-hypotonia-seizures syndrome 2" } ], "unlinked_id_list": [], "evidence": [ { "id": "300868", "database": "MIM", "url": "https://www.omim.org/entry/300868" }, { "id": "PIGA", "database": "Genomics England", "url": "https://panelapp.genomicsengland.co.uk/panels/25/gene/PIGA/#!details" }, { "id": "0080139", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0080139" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease", "ebi" ], "filter_code": "010000000000000000000.00000000000000.000000000001000000.00001.11.000.000", "uniprot_canonical_ac": "P37287-1" } ], "record_id": "pubmed.8599356", "abstract": "", "glycosylation": [], "mutagenesis": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The X-linked infantile spasms syndrome (MIM 308350) maps to Xp11.4-Xpter in two pedigrees.", "journal": "Annals of neurology", "date": "1997-09", "authors": "Claes S, Devriendt K, Lagae L, Ceulemans B, Dom L, Casaer P, Raeymaekers P, Cassiman J J, Fryns J P", "reference": { "type": "PubMed", "id": "9307258", "url": "https://pubmed.ncbi.nlm.nih.gov/9307258" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P37287-1", "protein_name": "Phosphatidylinositol N-acetylglucosaminyltransferase subunit A", "gene_name": "PIGA", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P37287", "url": "https://www.uniprot.org/uniprotkb/P37287" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "snv": [ { "evidence": [ { "id": "rs587777397", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs587777397" }, { "id": "24357517", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24357517" }, { "id": "9307258", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/9307258" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 26, "end_pos": 26, "sequence_org": "Y", "sequence_mut": "null", "comment": "Germline mutation passed 1 filters: glycogene of type=glycogene, glycosyltransferase.", "chr_id": "X", "chr_pos": "15331857", "ref_nt": "p", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "Y26", "disease": [ { "disease_id": "DOID:0080139", "recommended_name": { "id": "DOID:0080139", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0080139", "name": "multiple congenital anomalies-hypotonia-seizures syndrome 2", "description": "A multiple congenital anomalies-hypotonia-seizures syndrome that is characterized by X-linked recessive inheritance of dysmorphic features, neonatal hypotonia, myoclonic seizures and variable abnormalities involving the central nervous, cardiac, and urinary systems that has_material_basis_in mutation in the PIGA gene on chromosome Xp22." }, "synonyms": [ { "id": "DOID:0080139", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0080139", "name": "early infantile epileptic encephalopathy 20", "description": "" }, { "id": "DOID:0080139", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0080139", "name": "glycosylphosphatidylinositol biosynthesis defect 4", "description": "" }, { "id": "DOID:0080139", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0080139", "name": "developmental and epileptic encephalopathy 20", "description": "" }, { "id": "MONDO:0010466", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010466", "name": "multiple congenital anomalies-hypotonia-seizures syndrome 2", "description": "Any multiple congenital anomalies/dysmorphic syndrome-intellectual disability in which the cause of the disease is a mutation in the PIGA gene." }, { "id": "MONDO:0010466", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010466", "name": "DEE20", "description": "" }, { "id": "MONDO:0010466", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010466", "name": "GPIBD4", "description": "" }, { "id": "MONDO:0010466", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010466", "name": "MCAHS type 2", "description": "" }, { "id": "MONDO:0010466", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010466", "name": "MCAHS2", "description": "" }, { "id": "MONDO:0010466", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010466", "name": "PIGA multiple congenital anomalies/dysmorphic syndrome-intellectual disability", "description": "" }, { "id": "MONDO:0010466", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010466", "name": "developmental and epileptic encephalopathy 20", "description": "" }, { "id": "MONDO:0010466", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010466", "name": "epileptic encephalopathy, early infantile, 20", "description": "" }, { "id": "MONDO:0010466", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010466", "name": "glycosylphosphatidylinositol biosynthesis defect 4", "description": "" }, { "id": "MONDO:0010466", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010466", "name": "multiple congenital anomalies-hypotonia-seizures syndrome 2", "description": "" }, { "id": "MONDO:0010466", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010466", "name": "multiple congenital anomalies-hypotonia-seizures syndrome 2, X-linked recessive", "description": "" }, { "id": "MONDO:0010466", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010466", "name": "multiple congenital anomalies-hypotonia-seizures syndrome type 2", "description": "" }, { "id": "MONDO:0010466", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010466", "name": "multiple congenital anomalies/dysmorphic syndrome-intellectual disability caused by mutation in PIGA", "description": "" }, { "id": "MIM:300868", "resource": "MIM", "url": "https://www.omim.org/entry/300868", "name": "Multiple congenital anomalies-hypotonia-seizures syndrome 2", "description": "Multiple congenital anomalies-hypotonia-seizures syndrome 2" } ], "unlinked_id_list": [], "evidence": [ { "id": "300868", "database": "MIM", "url": "https://www.omim.org/entry/300868" }, { "id": "PIGA", "database": "Genomics England", "url": "https://panelapp.genomicsengland.co.uk/panels/25/gene/PIGA/#!details" }, { "id": "0080139", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0080139" } ] } ], "keywords": [ "ebi", "germline", "disease" ], "filter_code": "000000000000000000100.00000000000000.000000000001000000.00001.10.000.101", "uniprot_canonical_ac": "P37287-1" } ], "record_id": "pubmed.9307258", "abstract": "", "glycosylation": [], "mutagenesis": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Increased expression of OCIA domain containing 2 during stepwise progression of ovarian mucinous tumor.", "journal": "Pathology international", "date": "2012", "authors": "Nagata C, Kobayashi H, Sakata A, Satomi K, Minami Y, Morishita Y, Ohara R, Yoshikawa H, Arai Y, Nishida M, Noguchi M", "reference": { "type": "PubMed", "id": "22726067", "url": "https://pubmed.ncbi.nlm.nih.gov/22726067" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q56VL3-1", "protein_name": "OCIA domain-containing protein 2", "gene_name": "OCIAD2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q56VL3", "url": "https://www.uniprot.org/uniprotkb/Q56VL3" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.22726067", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "OCIAD2 activates gamma-secretase to enhance amyloid beta production by interacting with nicastrin.", "journal": "Cellular and molecular life sciences : CMLS", "date": "2014", "authors": "Han J, Jung S, Jang J, Kam TI, Choi H, Kim BJ, Nah J, Jo DG, Nakagawa T, Nishimura M, Jung YK", "reference": { "type": "PubMed", "id": "24270855", "url": "https://pubmed.ncbi.nlm.nih.gov/24270855" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q56VL3-1", "protein_name": "OCIA domain-containing protein 2", "gene_name": "OCIAD2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q56VL3", "url": "https://www.uniprot.org/uniprotkb/Q56VL3" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.24270855", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Pathway bridge based multiobjective optimization approach for lurking pathway prediction.", "journal": "BioMed research international", "date": "2014", "authors": "Zhang R, Zhao C, Xiong Z, Zhou X", "reference": { "type": "PubMed", "id": "24949437", "url": "https://pubmed.ncbi.nlm.nih.gov/24949437" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q56VL3-1", "protein_name": "OCIA domain-containing protein 2", "gene_name": "OCIAD2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q56VL3", "url": "https://www.uniprot.org/uniprotkb/Q56VL3" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.24949437", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Ovarian carcinoma immunoreactive antigen domain 2 controls mitochondrial apoptosis in lung adenocarcinoma.", "journal": "Cancer science", "date": "2021", "authors": "Hong J, Shiba-Ishii A, Kim Y, Noguchi M, Sakamoto N", "reference": { "type": "PubMed", "id": "34628698", "url": "https://pubmed.ncbi.nlm.nih.gov/34628698" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q56VL3-1", "protein_name": "OCIA domain-containing protein 2", "gene_name": "OCIAD2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q56VL3", "url": "https://www.uniprot.org/uniprotkb/Q56VL3" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.34628698", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Ovarian carcinoma immunoreactive antigen-like protein 2 (OCIAD2) is a novel complex III-specific assembly factor in mitochondria.", "journal": "Molecular biology of the cell", "date": "2022", "authors": "Chojnacka KJ, Elancheliyan P, Mussulini BHM, Mohanraj K, Callegari S, Gosk A, Banach T, Goral T, Szczepanowska K, Rehling P, Serwa RA, Chacinska A", "reference": { "type": "PubMed", "id": "35080992", "url": "https://pubmed.ncbi.nlm.nih.gov/35080992" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q56VL3-1", "protein_name": "OCIA domain-containing protein 2", "gene_name": "OCIAD2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q56VL3", "url": "https://www.uniprot.org/uniprotkb/Q56VL3" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.35080992", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Aberrant OCIAD2 demethylation in lung adenocarcinoma is associated with outcome.", "journal": "Pathology international", "date": "2022-10", "authors": "Maki Masahiro, JeongMin Hong, Nakagawa Tomoki, Kawai Hitomi, Sakamoto Noriaki, Sato Yukio, Noguchi Masayuki", "reference": { "type": "PubMed", "id": "35920378", "url": "https://pubmed.ncbi.nlm.nih.gov/35920378" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q56VL3-1", "protein_name": "OCIA domain-containing protein 2", "gene_name": "OCIAD2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q56VL3", "url": "https://www.uniprot.org/uniprotkb/Q56VL3" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.35920378", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "OCIAD2 promotes pancreatic cancer progression through the AKT signaling pathway.", "journal": "Gene", "date": "2024-11-15", "authors": "Yin Yi-Fan, Jia Qin-Yuan, Yao Hong-Fei, Zhu Yu-Heng, Zheng Jia-Hao, Duan Zong-Hao, Hu Cheng-Yu, Sun Yong-Wei, Liu De-Jun, Huo Yan-Miao, Liu Wei", "reference": { "type": "PubMed", "id": "38944166", "url": "https://pubmed.ncbi.nlm.nih.gov/38944166" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q56VL3-1", "protein_name": "OCIA domain-containing protein 2", "gene_name": "OCIAD2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q56VL3", "url": "https://www.uniprot.org/uniprotkb/Q56VL3" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.38944166", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The human neuregulin 2 (NRG2) gene: cloning, mapping and evaluation as a candidate for the autosomal recessive form of Charcot-Marie-Tooth disease linked to 5q.", "journal": "Hum. Genet.", "date": "1999", "authors": "Ring HZ, Chang H, Guilbot A, Brice A, LeGuern E, Francke U", "reference": { "type": "PubMed", "id": "10369162", "url": "https://pubmed.ncbi.nlm.nih.gov/10369162" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O14511-1", "protein_name": "Pro-neuregulin-2, membrane-bound isoform", "gene_name": "NRG2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "O14511", "url": "https://www.uniprot.org/uniprotkb/O14511" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.10369162", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Stimulation of acetylcholine receptor transcription by neuregulin-2 requires an N-box response element and is regulated by alternative splicing.", "journal": "Neuroscience", "date": "2005", "authors": "Ponomareva ON, Ma H, Dakour R, Raabe TD, Lai C, Rimer M", "reference": { "type": "PubMed", "id": "15961242", "url": "https://pubmed.ncbi.nlm.nih.gov/15961242" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O14511-1", "protein_name": "Pro-neuregulin-2, membrane-bound isoform", "gene_name": "NRG2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "O14511", "url": "https://www.uniprot.org/uniprotkb/O14511" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.15961242", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "NRG1 and NRG2 fusion positive solid tumor malignancies: a paradigm of ligand-fusion oncogenesis.", "journal": "Trends in cancer", "date": "2022", "authors": "Nagasaka M, Ou SI", "reference": { "type": "PubMed", "id": "34996744", "url": "https://pubmed.ncbi.nlm.nih.gov/34996744" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O14511-1", "protein_name": "Pro-neuregulin-2, membrane-bound isoform", "gene_name": "NRG2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "O14511", "url": "https://www.uniprot.org/uniprotkb/O14511" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.34996744", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The relevance of EGFR, ErbB receptors and neuregulins in human adipocytes and adipose tissue in obesity.", "journal": "Biomedicine & pharmacotherapy = Biomedecine & pharmacotherapie", "date": "2022-12", "authors": "Latorre J\u00e8ssica, Mart\u00ednez Cristina, Ortega Francisco, Oliveras-Ca\u00f1ellas N\u00faria, D\u00edaz-S\u00e1ez Francisco, Aragon\u00e9s Julian, Camps Marta, Gum\u00e0 Anna, Ricart Wifredo, Fern\u00e1ndez-Real Jos\u00e9 Manuel, Moreno-Navarrete Jos\u00e9 Mar\u00eda", "reference": { "type": "PubMed", "id": "36411648", "url": "https://pubmed.ncbi.nlm.nih.gov/36411648" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O14511-1", "protein_name": "Pro-neuregulin-2, membrane-bound isoform", "gene_name": "NRG2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "O14511", "url": "https://www.uniprot.org/uniprotkb/O14511" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.36411648", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Neuregulin 2 Is a Candidate Gene for Autism Spectrum Disorder.", "journal": "International journal of molecular sciences", "date": "2024-05-19", "authors": "Chien Wei-Hsien, Chen Chia-Hsiang, Cheng Min-Chih, Wu Yu-Yu, Gau Susan Shur-Fen", "reference": { "type": "PubMed", "id": "38791584", "url": "https://pubmed.ncbi.nlm.nih.gov/38791584" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O14511-1", "protein_name": "Pro-neuregulin-2, membrane-bound isoform", "gene_name": "NRG2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "O14511", "url": "https://www.uniprot.org/uniprotkb/O14511" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.38791584", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Characterization of a neuregulin-related gene, Don-1, that is highly expressed in restricted regions of the cerebellum and hippocampus.", "journal": "Mol. Cell. Biol.", "date": "1997", "authors": "Busfield SJ, Michnick DA, Chickering TW, Revett TL, Ma J, Woolf EA, Comrack CA, Dussault BJ, Woolf J, Goodearl AD, Gearing DP", "reference": { "type": "PubMed", "id": "9199335", "url": "https://pubmed.ncbi.nlm.nih.gov/9199335" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O14511-1", "protein_name": "Pro-neuregulin-2, membrane-bound isoform", "gene_name": "NRG2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P56974-1", "protein_name": "Pro-neuregulin-2, membrane-bound isoform", "gene_name": "Nrg2", "tax_name": "Mouse" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "O14511", "url": "https://www.uniprot.org/uniprotkb/O14511" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.9199335", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "A novel brain-derived member of the epidermal growth factor family that interacts with ErbB3 and ErbB4.", "journal": "J. Biochem.", "date": "1997", "authors": "Higashiyama S, Horikawa M, Yamada K, Ichino N, Nakano N, Nakagawa T, Miyagawa J, Matsushita N, Nagatsu T, Taniguchi N, Ishiguro H", "reference": { "type": "PubMed", "id": "9348101", "url": "https://pubmed.ncbi.nlm.nih.gov/9348101" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O14511-1", "protein_name": "Pro-neuregulin-2, membrane-bound isoform", "gene_name": "NRG2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O35569-1", "protein_name": "Pro-neuregulin-2, membrane-bound isoform", "gene_name": "Nrg2", "tax_name": "Rat" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "O14511", "url": "https://www.uniprot.org/uniprotkb/O14511" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.9348101", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Implication of the lymphocyte-specific nuclear body protein Sp140 in an innate response to human immunodeficiency virus type 1.", "journal": "Journal of virology", "date": "2002", "authors": "Madani N, Millette R, Platt EJ, Marin M, Kozak SL, Bloch DB, Kabat D", "reference": { "type": "PubMed", "id": "12368356", "url": "https://pubmed.ncbi.nlm.nih.gov/12368356" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q13342-1", "protein_name": "Nuclear body protein SP140", "gene_name": "SP140", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q13342", "url": "https://www.uniprot.org/uniprotkb/Q13342" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.12368356", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Structure of human Sp140 PHD finger: an atypical fold interacting with Pin1.", "journal": "The FEBS journal", "date": "2014", "authors": "Zucchelli C, Tamburri S, Quilici G, Palagano E, Berardi A, Saare M, Peterson P, Bachi A, Musco G", "reference": { "type": "PubMed", "id": "24267382", "url": "https://pubmed.ncbi.nlm.nih.gov/24267382" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q13342-1", "protein_name": "Nuclear body protein SP140", "gene_name": "SP140", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q13342", "url": "https://www.uniprot.org/uniprotkb/Q13342" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 726, "end_pos": 726, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine", "evidence": [ { "database": "UniProtKB", "id": "Q13342", "url": "https://www.uniprot.org/uniprotkb/Q13342" }, { "database": "PubMed", "id": "24267382", "url": "https://pubmed.ncbi.nlm.nih.gov/24267382" }, { "database": "IntAct", "id": "Q13342", "url": "https://www.ebi.ac.uk/intact/interactors/id:Q13342*" }, { "database": "iPTMnet", "id": "Q13342", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q13342" } ], "site_lbl": "Thr726", "uniprot_canonical_ac": "Q13342-1" } ], "record_id": "pubmed.24267382", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Epigenetic reader SP140 loss of function drives Crohn's disease due to uncontrolled macrophage topoisomerases.", "journal": "Cell", "date": "2022", "authors": "Amatullah H, Fraschilla I, Digumarthi S, Huang J, Adiliaghdam F, Bonilla G, Wong LP, Rivard ME, Beauchamp C, Mercier V, Goyette P, Sadreyev RI, Anthony RM, Rioux JD, Jeffrey KL", "reference": { "type": "PubMed", "id": "35952671", "url": "https://pubmed.ncbi.nlm.nih.gov/35952671" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q13342-1", "protein_name": "Nuclear body protein SP140", "gene_name": "SP140", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q13342", "url": "https://www.uniprot.org/uniprotkb/Q13342" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.35952671", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Immune chromatin reader SP140 regulates microbiota and risk for inflammatory bowel disease.", "journal": "Cell host & microbe", "date": "2022-10-12", "authors": "Fraschilla Isabella, Amatullah Hajera, Rahman Raza-Ur, Jeffrey Kate L", "reference": { "type": "PubMed", "id": "36130593", "url": "https://pubmed.ncbi.nlm.nih.gov/36130593" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q13342-1", "protein_name": "Nuclear body protein SP140", "gene_name": "SP140", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q13342", "url": "https://www.uniprot.org/uniprotkb/Q13342" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.36130593", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "SP140 inhibits STAT1 signaling, induces IFN-\u03b3 in tumor-associated macrophages, and is a predictive biomarker of immunotherapy response.", "journal": "Journal for immunotherapy of cancer", "date": "2022-12", "authors": "Tanagala Kranthi Kiran Kishore, Morin-Baxter Joshua, Carvajal Richard, Cheema Maryum, Dubey Sunil, Nakagawa Hiroshi, Yoon Angela, Cheng Yi-Shing L, Taylor Alison, Nickerson Jeffrey, Mintz Akiva, Momen-Heravi Fatemeh", "reference": { "type": "PubMed", "id": "36600652", "url": "https://pubmed.ncbi.nlm.nih.gov/36600652" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q13342-1", "protein_name": "Nuclear body protein SP140", "gene_name": "SP140", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q13342", "url": "https://www.uniprot.org/uniprotkb/Q13342" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.36600652", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Transcriptional regulators SP110 and SP140 modulate inflammatory response genes in Mycobacterium tuberculosis-infected human macrophages.", "journal": "Microbiology spectrum", "date": "2024-10-03", "authors": "Nakamura Hajime, Hikichi Haruka, Seto Shintaro, Hijikata Minako, Keicho Naoto", "reference": { "type": "PubMed", "id": "39162523", "url": "https://pubmed.ncbi.nlm.nih.gov/39162523" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q13342-1", "protein_name": "Nuclear body protein SP140", "gene_name": "SP140", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HB58-1", "protein_name": "Sp110 nuclear body protein", "gene_name": "SP110", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q13342", "url": "https://www.uniprot.org/uniprotkb/Q13342" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.39162523", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "LYSP100-associated nuclear domains (LANDs): description of a new class of subnuclear structures and their relationship to PML nuclear bodies.", "journal": "Blood", "date": "1996", "authors": "Dent A L, Yewdell J, Puvion-Dutilleul F, Koken M H, de The H, Staudt L M", "reference": { "type": "PubMed", "id": "8695863", "url": "https://pubmed.ncbi.nlm.nih.gov/8695863" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q13342-1", "protein_name": "Nuclear body protein SP140", "gene_name": "SP140", "tax_name": "Human" }, { "uniprot_canonical_ac": "P23497-1", "protein_name": "Nuclear autoantigen Sp-100", "gene_name": "SP100", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q13342", "url": "https://www.uniprot.org/uniprotkb/Q13342" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.8695863", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Identification and characterization of a leukocyte-specific component of the nuclear body.", "journal": "The Journal of biological chemistry", "date": "1996", "authors": "Bloch DB, de la Monte SM, Guigaouri P, Filippov A, Bloch KD", "reference": { "type": "PubMed", "id": "8910577", "url": "https://pubmed.ncbi.nlm.nih.gov/8910577" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q13342-1", "protein_name": "Nuclear body protein SP140", "gene_name": "SP140", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q13342", "url": "https://www.uniprot.org/uniprotkb/Q13342" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.8910577", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Immune complex-induced integrin activation and L-plastin phosphorylation require protein kinase A.", "journal": "The Journal of biological chemistry", "date": "1999", "authors": "Wang J, Brown EJ", "reference": { "type": "PubMed", "id": "10446213", "url": "https://pubmed.ncbi.nlm.nih.gov/10446213" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P13796-1", "protein_name": "Plastin-2", "gene_name": "LCP1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P13796", "url": "https://www.uniprot.org/uniprotkb/P13796" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 5, "end_pos": 5, "kinase_uniprot_canonical_ac": "P17612-1", "kinase_gene_name": "PRKACA", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P13796", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P13796" }, { "database": "PubMed", "id": "10446213", "url": "https://pubmed.ncbi.nlm.nih.gov/10446213" }, { "database": "PubMed", "id": "19651622", "url": "https://pubmed.ncbi.nlm.nih.gov/19651622" }, { "database": "PubMed", "id": "20058876", "url": "https://pubmed.ncbi.nlm.nih.gov/20058876" }, { "database": "PubMed", "id": "20166139", "url": "https://pubmed.ncbi.nlm.nih.gov/20166139" }, { "database": "PubMed", "id": "20230923", "url": "https://pubmed.ncbi.nlm.nih.gov/20230923" }, { "database": "PubMed", "id": "16636079", "url": "https://pubmed.ncbi.nlm.nih.gov/16636079" } ], "site_lbl": "Ser5", "uniprot_canonical_ac": "P13796-1" }, { "start_pos": 5, "end_pos": 5, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P13796", "url": "https://www.uniprot.org/uniprotkb/P13796" }, { "database": "PubMed", "id": "17294403", "url": "https://pubmed.ncbi.nlm.nih.gov/17294403" }, { "database": "PubMed", "id": "23186163", "url": "https://pubmed.ncbi.nlm.nih.gov/23186163" }, { "database": "PubMed", "id": "16636079", "url": "https://pubmed.ncbi.nlm.nih.gov/16636079" }, { "database": "PubMed", "id": "21406692", "url": "https://pubmed.ncbi.nlm.nih.gov/21406692" }, { "database": "iPTMnet", "id": "P13796", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P13796" }, { "database": "PubMed", "id": "10446213", "url": "https://pubmed.ncbi.nlm.nih.gov/10446213" }, { "database": "PubMed", "id": "19799649", "url": "https://pubmed.ncbi.nlm.nih.gov/19799649" }, { "database": "PubMed", "id": "20169155", "url": "https://pubmed.ncbi.nlm.nih.gov/20169155" }, { "database": "PubMed", "id": "22581862", "url": "https://pubmed.ncbi.nlm.nih.gov/22581862" }, { "database": "PubMed", "id": "23001012", "url": "https://pubmed.ncbi.nlm.nih.gov/23001012" }, { "database": "PubMed", "id": "24236012", "url": "https://pubmed.ncbi.nlm.nih.gov/24236012" }, { "database": "PubMed", "id": "24438191", "url": "https://pubmed.ncbi.nlm.nih.gov/24438191" }, { "database": "PubMed", "id": "26631483", "url": "https://pubmed.ncbi.nlm.nih.gov/26631483" }, { "database": "PubMed", "id": "27551545", "url": "https://pubmed.ncbi.nlm.nih.gov/27551545" }, { "database": "PubMed", "id": "29882856", "url": "https://pubmed.ncbi.nlm.nih.gov/29882856" }, { "database": "PubMed", "id": "30244178", "url": "https://pubmed.ncbi.nlm.nih.gov/30244178" }, { "database": "PubMed", "id": "30248139", "url": "https://pubmed.ncbi.nlm.nih.gov/30248139" }, { "database": "PubMed", "id": "32859369", "url": "https://pubmed.ncbi.nlm.nih.gov/32859369" }, { "database": "PubMed", "id": "33618712", "url": "https://pubmed.ncbi.nlm.nih.gov/33618712" }, { "database": "PubMed", "id": "9689080", "url": "https://pubmed.ncbi.nlm.nih.gov/9689080" } ], "site_lbl": "Ser5", "uniprot_canonical_ac": "P13796-1" } ], "record_id": "pubmed.10446213", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Nonrandom fusion of L-plastin(LCP1) and LAZ3(BCL6) genes by t(3;13)(q27;q14) chromosome translocation in two cases of B-cell non-Hodgkin lymphoma.", "journal": "Genes Chromosomes Cancer", "date": "1999", "authors": "Gali\u00e8gue-Zouitina S, Quief S, Hildebrand M P, Denis C, Detourmignies L, La\u00ef J L, Kerckaert J P", "reference": { "type": "PubMed", "id": "10469447", "url": "https://pubmed.ncbi.nlm.nih.gov/10469447" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P13796-1", "protein_name": "Plastin-2", "gene_name": "LCP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P41182-1", "protein_name": "B-cell lymphoma 6 protein", "gene_name": "BCL6", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P13796", "url": "https://www.uniprot.org/uniprotkb/P13796" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.10469447", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Phosphorylation on Ser5 increases the F-actin-binding activity of L-plastin and promotes its targeting to sites of actin assembly in cells.", "journal": "Journal of cell science", "date": "2006", "authors": "Janji B, Giganti A, De Corte V, Catillon M, Bruyneel E, Lentz D, Plastino J, Gettemans J, Friederich E", "reference": { "type": "PubMed", "id": "16636079", "url": "https://pubmed.ncbi.nlm.nih.gov/16636079" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P13796-1", "protein_name": "Plastin-2", "gene_name": "LCP1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P13796", "url": "https://www.uniprot.org/uniprotkb/P13796" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 5, "end_pos": 5, "sequence_org": "S", "sequence_mut": "A", "comment": "Abolishes phosphorylation and reduces the cell surface expression of CD69 and IL2RA. Reduces association with the actin cytoskeleton.", "evidence": [ { "database": "UniProtKB", "id": "P13796", "url": "https://www.uniprot.org/uniprotkb/P13796" }, { "database": "PubMed", "id": "16636079", "url": "https://pubmed.ncbi.nlm.nih.gov/16636079" }, { "database": "PubMed", "id": "17294403", "url": "https://pubmed.ncbi.nlm.nih.gov/17294403" } ], "uniprot_canonical_ac": "P13796-1" }, { "start_pos": 5, "end_pos": 5, "sequence_org": "S", "sequence_mut": "E", "comment": "Promotes association with the actin cytoskeleton.", "evidence": [ { "database": "UniProtKB", "id": "P13796", "url": "https://www.uniprot.org/uniprotkb/P13796" }, { "database": "PubMed", "id": "16636079", "url": "https://pubmed.ncbi.nlm.nih.gov/16636079" }, { "database": "PubMed", "id": "17294403", "url": "https://pubmed.ncbi.nlm.nih.gov/17294403" } ], "uniprot_canonical_ac": "P13796-1" } ], "phosphorylation": [ { "start_pos": 5, "end_pos": 5, "kinase_uniprot_canonical_ac": "P17612-1", "kinase_gene_name": "PRKACA", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P13796", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P13796" }, { "database": "PubMed", "id": "10446213", "url": "https://pubmed.ncbi.nlm.nih.gov/10446213" }, { "database": "PubMed", "id": "19651622", "url": "https://pubmed.ncbi.nlm.nih.gov/19651622" }, { "database": "PubMed", "id": "20058876", "url": "https://pubmed.ncbi.nlm.nih.gov/20058876" }, { "database": "PubMed", "id": "20166139", "url": "https://pubmed.ncbi.nlm.nih.gov/20166139" }, { "database": "PubMed", "id": "20230923", "url": "https://pubmed.ncbi.nlm.nih.gov/20230923" }, { "database": "PubMed", "id": "16636079", "url": "https://pubmed.ncbi.nlm.nih.gov/16636079" } ], "site_lbl": "Ser5", "uniprot_canonical_ac": "P13796-1" }, { "start_pos": 5, "end_pos": 5, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P13796", "url": "https://www.uniprot.org/uniprotkb/P13796" }, { "database": "PubMed", "id": "17294403", "url": "https://pubmed.ncbi.nlm.nih.gov/17294403" }, { "database": "PubMed", "id": "23186163", "url": "https://pubmed.ncbi.nlm.nih.gov/23186163" }, { "database": "PubMed", "id": "16636079", "url": "https://pubmed.ncbi.nlm.nih.gov/16636079" }, { "database": "PubMed", "id": "21406692", "url": "https://pubmed.ncbi.nlm.nih.gov/21406692" }, { "database": "iPTMnet", "id": "P13796", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P13796" }, { "database": "PubMed", "id": "10446213", "url": "https://pubmed.ncbi.nlm.nih.gov/10446213" }, { "database": "PubMed", "id": "19799649", "url": "https://pubmed.ncbi.nlm.nih.gov/19799649" }, { "database": "PubMed", "id": "20169155", "url": "https://pubmed.ncbi.nlm.nih.gov/20169155" }, { "database": "PubMed", "id": "22581862", "url": "https://pubmed.ncbi.nlm.nih.gov/22581862" }, { "database": "PubMed", "id": "23001012", "url": "https://pubmed.ncbi.nlm.nih.gov/23001012" }, { "database": "PubMed", "id": "24236012", "url": "https://pubmed.ncbi.nlm.nih.gov/24236012" }, { "database": "PubMed", "id": "24438191", "url": "https://pubmed.ncbi.nlm.nih.gov/24438191" }, { "database": "PubMed", "id": "26631483", "url": "https://pubmed.ncbi.nlm.nih.gov/26631483" }, { "database": "PubMed", "id": "27551545", "url": "https://pubmed.ncbi.nlm.nih.gov/27551545" }, { "database": "PubMed", "id": "29882856", "url": "https://pubmed.ncbi.nlm.nih.gov/29882856" }, { "database": "PubMed", "id": "30244178", "url": "https://pubmed.ncbi.nlm.nih.gov/30244178" }, { "database": "PubMed", "id": "30248139", "url": "https://pubmed.ncbi.nlm.nih.gov/30248139" }, { "database": "PubMed", "id": "32859369", "url": "https://pubmed.ncbi.nlm.nih.gov/32859369" }, { "database": "PubMed", "id": "33618712", "url": "https://pubmed.ncbi.nlm.nih.gov/33618712" }, { "database": "PubMed", "id": "9689080", "url": "https://pubmed.ncbi.nlm.nih.gov/9689080" } ], "site_lbl": "Ser5", "uniprot_canonical_ac": "P13796-1" } ], "record_id": "pubmed.16636079", "abstract": "", "glycosylation": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Costimulation induced phosphorylation of L-plastin facilitates surface transport of the T cell activation molecules CD69 and CD25.", "journal": "European journal of immunology", "date": "2007", "authors": "Wabnitz GH, Kocher T, Lohneis P, Stober C, Konstandin MH, Funk B, Sester U, Wilm M, Klemke M, Samstag Y", "reference": { "type": "PubMed", "id": "17294403", "url": "https://pubmed.ncbi.nlm.nih.gov/17294403" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P13796-1", "protein_name": "Plastin-2", "gene_name": "LCP1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P13796", "url": "https://www.uniprot.org/uniprotkb/P13796" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 5, "end_pos": 5, "sequence_org": "S", "sequence_mut": "A", "comment": "Abolishes phosphorylation and reduces the cell surface expression of CD69 and IL2RA. Reduces association with the actin cytoskeleton.", "evidence": [ { "database": "UniProtKB", "id": "P13796", "url": "https://www.uniprot.org/uniprotkb/P13796" }, { "database": "PubMed", "id": "16636079", "url": "https://pubmed.ncbi.nlm.nih.gov/16636079" }, { "database": "PubMed", "id": "17294403", "url": "https://pubmed.ncbi.nlm.nih.gov/17294403" } ], "uniprot_canonical_ac": "P13796-1" }, { "start_pos": 5, "end_pos": 5, "sequence_org": "S", "sequence_mut": "E", "comment": "Promotes association with the actin cytoskeleton.", "evidence": [ { "database": "UniProtKB", "id": "P13796", "url": "https://www.uniprot.org/uniprotkb/P13796" }, { "database": "PubMed", "id": "16636079", "url": "https://pubmed.ncbi.nlm.nih.gov/16636079" }, { "database": "PubMed", "id": "17294403", "url": "https://pubmed.ncbi.nlm.nih.gov/17294403" } ], "uniprot_canonical_ac": "P13796-1" } ], "phosphorylation": [ { "start_pos": 5, "end_pos": 5, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P13796", "url": "https://www.uniprot.org/uniprotkb/P13796" }, { "database": "PubMed", "id": "17294403", "url": "https://pubmed.ncbi.nlm.nih.gov/17294403" }, { "database": "PubMed", "id": "23186163", "url": "https://pubmed.ncbi.nlm.nih.gov/23186163" }, { "database": "PubMed", "id": "16636079", "url": "https://pubmed.ncbi.nlm.nih.gov/16636079" }, { "database": "PubMed", "id": "21406692", "url": "https://pubmed.ncbi.nlm.nih.gov/21406692" }, { "database": "iPTMnet", "id": "P13796", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P13796" }, { "database": "PubMed", "id": "10446213", "url": "https://pubmed.ncbi.nlm.nih.gov/10446213" }, { "database": "PubMed", "id": "19799649", "url": "https://pubmed.ncbi.nlm.nih.gov/19799649" }, { "database": "PubMed", "id": "20169155", "url": "https://pubmed.ncbi.nlm.nih.gov/20169155" }, { "database": "PubMed", "id": "22581862", "url": "https://pubmed.ncbi.nlm.nih.gov/22581862" }, { "database": "PubMed", "id": "23001012", "url": "https://pubmed.ncbi.nlm.nih.gov/23001012" }, { "database": "PubMed", "id": "24236012", "url": "https://pubmed.ncbi.nlm.nih.gov/24236012" }, { "database": "PubMed", "id": "24438191", "url": "https://pubmed.ncbi.nlm.nih.gov/24438191" }, { "database": "PubMed", "id": "26631483", "url": "https://pubmed.ncbi.nlm.nih.gov/26631483" }, { "database": "PubMed", "id": "27551545", "url": "https://pubmed.ncbi.nlm.nih.gov/27551545" }, { "database": "PubMed", "id": "29882856", "url": "https://pubmed.ncbi.nlm.nih.gov/29882856" }, { "database": "PubMed", "id": "30244178", "url": "https://pubmed.ncbi.nlm.nih.gov/30244178" }, { "database": "PubMed", "id": "30248139", "url": "https://pubmed.ncbi.nlm.nih.gov/30248139" }, { "database": "PubMed", "id": "32859369", "url": "https://pubmed.ncbi.nlm.nih.gov/32859369" }, { "database": "PubMed", "id": "33618712", "url": "https://pubmed.ncbi.nlm.nih.gov/33618712" }, { "database": "PubMed", "id": "9689080", "url": "https://pubmed.ncbi.nlm.nih.gov/9689080" } ], "site_lbl": "Ser5", "uniprot_canonical_ac": "P13796-1" } ], "record_id": "pubmed.17294403", "abstract": "", "glycosylation": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The actin filament cross-linker L-plastin confers resistance to TNF-alpha in MCF-7 breast cancer cells in a phosphorylation-dependent manner.", "journal": "Journal of cellular and molecular medicine", "date": "2010", "authors": "Janji B, Vallar L, Al Tanoury Z, Bernardin F, Vetter G, Schaffner-Reckinger E, Berchem G, Friederich E, Chouaib S", "reference": { "type": "PubMed", "id": "19799649", "url": "https://pubmed.ncbi.nlm.nih.gov/19799649" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P13796-1", "protein_name": "Plastin-2", "gene_name": "LCP1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P13796", "url": "https://www.uniprot.org/uniprotkb/P13796" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 5, "end_pos": 5, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P13796", "url": "https://www.uniprot.org/uniprotkb/P13796" }, { "database": "PubMed", "id": "17294403", "url": "https://pubmed.ncbi.nlm.nih.gov/17294403" }, { "database": "PubMed", "id": "23186163", "url": "https://pubmed.ncbi.nlm.nih.gov/23186163" }, { "database": "PubMed", "id": "16636079", "url": "https://pubmed.ncbi.nlm.nih.gov/16636079" }, { "database": "PubMed", "id": "21406692", "url": "https://pubmed.ncbi.nlm.nih.gov/21406692" }, { "database": "iPTMnet", "id": "P13796", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P13796" }, { "database": "PubMed", "id": "10446213", "url": "https://pubmed.ncbi.nlm.nih.gov/10446213" }, { "database": "PubMed", "id": "19799649", "url": "https://pubmed.ncbi.nlm.nih.gov/19799649" }, { "database": "PubMed", "id": "20169155", "url": "https://pubmed.ncbi.nlm.nih.gov/20169155" }, { "database": "PubMed", "id": "22581862", "url": "https://pubmed.ncbi.nlm.nih.gov/22581862" }, { "database": "PubMed", "id": "23001012", "url": "https://pubmed.ncbi.nlm.nih.gov/23001012" }, { "database": "PubMed", "id": "24236012", "url": "https://pubmed.ncbi.nlm.nih.gov/24236012" }, { "database": "PubMed", "id": "24438191", "url": "https://pubmed.ncbi.nlm.nih.gov/24438191" }, { "database": "PubMed", "id": "26631483", "url": "https://pubmed.ncbi.nlm.nih.gov/26631483" }, { "database": "PubMed", "id": "27551545", "url": "https://pubmed.ncbi.nlm.nih.gov/27551545" }, { "database": "PubMed", "id": "29882856", "url": "https://pubmed.ncbi.nlm.nih.gov/29882856" }, { "database": "PubMed", "id": "30244178", "url": "https://pubmed.ncbi.nlm.nih.gov/30244178" }, { "database": "PubMed", "id": "30248139", "url": "https://pubmed.ncbi.nlm.nih.gov/30248139" }, { "database": "PubMed", "id": "32859369", "url": "https://pubmed.ncbi.nlm.nih.gov/32859369" }, { "database": "PubMed", "id": "33618712", "url": "https://pubmed.ncbi.nlm.nih.gov/33618712" }, { "database": "PubMed", "id": "9689080", "url": "https://pubmed.ncbi.nlm.nih.gov/9689080" } ], "site_lbl": "Ser5", "uniprot_canonical_ac": "P13796-1" } ], "record_id": "pubmed.19799649", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Quantitative kinetic study of the actin-bundling protein L-plastin and of its impact on actin turn-over.", "journal": "PloS one", "date": "2010", "authors": "Al Tanoury Z, Schaffner-Reckinger E, Halavatyi A, Hoffmann C, Moes M, Hadzic E, Catillon M, Yatskou M, Friederich E", "reference": { "type": "PubMed", "id": "20169155", "url": "https://pubmed.ncbi.nlm.nih.gov/20169155" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P13796-1", "protein_name": "Plastin-2", "gene_name": "LCP1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P13796", "url": "https://www.uniprot.org/uniprotkb/P13796" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 5, "end_pos": 5, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P13796", "url": "https://www.uniprot.org/uniprotkb/P13796" }, { "database": "PubMed", "id": "17294403", "url": "https://pubmed.ncbi.nlm.nih.gov/17294403" }, { "database": "PubMed", "id": "23186163", "url": "https://pubmed.ncbi.nlm.nih.gov/23186163" }, { "database": "PubMed", "id": "16636079", "url": "https://pubmed.ncbi.nlm.nih.gov/16636079" }, { "database": "PubMed", "id": "21406692", "url": "https://pubmed.ncbi.nlm.nih.gov/21406692" }, { "database": "iPTMnet", "id": "P13796", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P13796" }, { "database": "PubMed", "id": "10446213", "url": "https://pubmed.ncbi.nlm.nih.gov/10446213" }, { "database": "PubMed", "id": "19799649", "url": "https://pubmed.ncbi.nlm.nih.gov/19799649" }, { "database": "PubMed", "id": "20169155", "url": "https://pubmed.ncbi.nlm.nih.gov/20169155" }, { "database": "PubMed", "id": "22581862", "url": "https://pubmed.ncbi.nlm.nih.gov/22581862" }, { "database": "PubMed", "id": "23001012", "url": "https://pubmed.ncbi.nlm.nih.gov/23001012" }, { "database": "PubMed", "id": "24236012", "url": "https://pubmed.ncbi.nlm.nih.gov/24236012" }, { "database": "PubMed", "id": "24438191", "url": "https://pubmed.ncbi.nlm.nih.gov/24438191" }, { "database": "PubMed", "id": "26631483", "url": "https://pubmed.ncbi.nlm.nih.gov/26631483" }, { "database": "PubMed", "id": "27551545", "url": "https://pubmed.ncbi.nlm.nih.gov/27551545" }, { "database": "PubMed", "id": "29882856", "url": "https://pubmed.ncbi.nlm.nih.gov/29882856" }, { "database": "PubMed", "id": "30244178", "url": "https://pubmed.ncbi.nlm.nih.gov/30244178" }, { "database": "PubMed", "id": "30248139", "url": "https://pubmed.ncbi.nlm.nih.gov/30248139" }, { "database": "PubMed", "id": "32859369", "url": "https://pubmed.ncbi.nlm.nih.gov/32859369" }, { "database": "PubMed", "id": "33618712", "url": "https://pubmed.ncbi.nlm.nih.gov/33618712" }, { "database": "PubMed", "id": "9689080", "url": "https://pubmed.ncbi.nlm.nih.gov/9689080" } ], "site_lbl": "Ser5", "uniprot_canonical_ac": "P13796-1" } ], "record_id": "pubmed.20169155", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Characterization of interleukin 2 stimulated 65-kilodalton phosphoprotein in human T cells.", "journal": "Biochemistry", "date": "1990", "authors": "Zu Y, Kohno M, Kubota I, Nishida E, Hanaoka M, Namba Y", "reference": { "type": "PubMed", "id": "2111166", "url": "https://pubmed.ncbi.nlm.nih.gov/2111166" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P13796-1", "protein_name": "Plastin-2", "gene_name": "LCP1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P13796", "url": "https://www.uniprot.org/uniprotkb/P13796" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.2111166", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "65-kilodalton protein phosphorylated by interleukin 2 stimulation bears two putative actin-binding sites and two calcium-binding sites.", "journal": "Biochemistry", "date": "1990", "authors": "Zu YL, Shigesada K, Nishida E, Kubota I, Kohno M, Hanaoka M, Namba Y", "reference": { "type": "PubMed", "id": "2252891", "url": "https://pubmed.ncbi.nlm.nih.gov/2252891" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P13796-1", "protein_name": "Plastin-2", "gene_name": "LCP1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P13796", "url": "https://www.uniprot.org/uniprotkb/P13796" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.2252891", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "L-plastin regulates polarization and migration in chemokine-stimulated human T lymphocytes.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "2012", "authors": "Freeley M, O'Dowd F, Paul T, Kashanin D, Davies A, Kelleher D, Long A", "reference": { "type": "PubMed", "id": "22581862", "url": "https://pubmed.ncbi.nlm.nih.gov/22581862" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P13796-1", "protein_name": "Plastin-2", "gene_name": "LCP1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P13796", "url": "https://www.uniprot.org/uniprotkb/P13796" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 5, "end_pos": 5, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P13796", "url": "https://www.uniprot.org/uniprotkb/P13796" }, { "database": "PubMed", "id": "17294403", "url": "https://pubmed.ncbi.nlm.nih.gov/17294403" }, { "database": "PubMed", "id": "23186163", "url": "https://pubmed.ncbi.nlm.nih.gov/23186163" }, { "database": "PubMed", "id": "16636079", "url": "https://pubmed.ncbi.nlm.nih.gov/16636079" }, { "database": "PubMed", "id": "21406692", "url": "https://pubmed.ncbi.nlm.nih.gov/21406692" }, { "database": "iPTMnet", "id": "P13796", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P13796" }, { "database": "PubMed", "id": "10446213", "url": "https://pubmed.ncbi.nlm.nih.gov/10446213" }, { "database": "PubMed", "id": "19799649", "url": "https://pubmed.ncbi.nlm.nih.gov/19799649" }, { "database": "PubMed", "id": "20169155", "url": "https://pubmed.ncbi.nlm.nih.gov/20169155" }, { "database": "PubMed", "id": "22581862", "url": "https://pubmed.ncbi.nlm.nih.gov/22581862" }, { "database": "PubMed", "id": "23001012", "url": "https://pubmed.ncbi.nlm.nih.gov/23001012" }, { "database": "PubMed", "id": "24236012", "url": "https://pubmed.ncbi.nlm.nih.gov/24236012" }, { "database": "PubMed", "id": "24438191", "url": "https://pubmed.ncbi.nlm.nih.gov/24438191" }, { "database": "PubMed", "id": "26631483", "url": "https://pubmed.ncbi.nlm.nih.gov/26631483" }, { "database": "PubMed", "id": "27551545", "url": "https://pubmed.ncbi.nlm.nih.gov/27551545" }, { "database": "PubMed", "id": "29882856", "url": "https://pubmed.ncbi.nlm.nih.gov/29882856" }, { "database": "PubMed", "id": "30244178", "url": "https://pubmed.ncbi.nlm.nih.gov/30244178" }, { "database": "PubMed", "id": "30248139", "url": "https://pubmed.ncbi.nlm.nih.gov/30248139" }, { "database": "PubMed", "id": "32859369", "url": "https://pubmed.ncbi.nlm.nih.gov/32859369" }, { "database": "PubMed", "id": "33618712", "url": "https://pubmed.ncbi.nlm.nih.gov/33618712" }, { "database": "PubMed", "id": "9689080", "url": "https://pubmed.ncbi.nlm.nih.gov/9689080" } ], "site_lbl": "Ser5", "uniprot_canonical_ac": "P13796-1" } ], "record_id": "pubmed.22581862", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Nanobody-induced perturbation of LFA-1/L-plastin phosphorylation impairs MTOC docking, immune synapse formation and T cell activation.", "journal": "Cellular and molecular life sciences : CMLS", "date": "2013", "authors": "De Clercq S, Zwaenepoel O, Martens E, Vandekerckhove J, Guillabert A, Gettemans J", "reference": { "type": "PubMed", "id": "23001012", "url": "https://pubmed.ncbi.nlm.nih.gov/23001012" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P13796-1", "protein_name": "Plastin-2", "gene_name": "LCP1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P13796", "url": "https://www.uniprot.org/uniprotkb/P13796" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 5, "end_pos": 5, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P13796", "url": "https://www.uniprot.org/uniprotkb/P13796" }, { "database": "PubMed", "id": "17294403", "url": "https://pubmed.ncbi.nlm.nih.gov/17294403" }, { "database": "PubMed", "id": "23186163", "url": "https://pubmed.ncbi.nlm.nih.gov/23186163" }, { "database": "PubMed", "id": "16636079", "url": "https://pubmed.ncbi.nlm.nih.gov/16636079" }, { "database": "PubMed", "id": "21406692", "url": "https://pubmed.ncbi.nlm.nih.gov/21406692" }, { "database": "iPTMnet", "id": "P13796", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P13796" }, { "database": "PubMed", "id": "10446213", "url": "https://pubmed.ncbi.nlm.nih.gov/10446213" }, { "database": "PubMed", "id": "19799649", "url": "https://pubmed.ncbi.nlm.nih.gov/19799649" }, { "database": "PubMed", "id": "20169155", "url": "https://pubmed.ncbi.nlm.nih.gov/20169155" }, { "database": "PubMed", "id": "22581862", "url": "https://pubmed.ncbi.nlm.nih.gov/22581862" }, { "database": "PubMed", "id": "23001012", "url": "https://pubmed.ncbi.nlm.nih.gov/23001012" }, { "database": "PubMed", "id": "24236012", "url": "https://pubmed.ncbi.nlm.nih.gov/24236012" }, { "database": "PubMed", "id": "24438191", "url": "https://pubmed.ncbi.nlm.nih.gov/24438191" }, { "database": "PubMed", "id": "26631483", "url": "https://pubmed.ncbi.nlm.nih.gov/26631483" }, { "database": "PubMed", "id": "27551545", "url": "https://pubmed.ncbi.nlm.nih.gov/27551545" }, { "database": "PubMed", "id": "29882856", "url": "https://pubmed.ncbi.nlm.nih.gov/29882856" }, { "database": "PubMed", "id": "30244178", "url": "https://pubmed.ncbi.nlm.nih.gov/30244178" }, { "database": "PubMed", "id": "30248139", "url": "https://pubmed.ncbi.nlm.nih.gov/30248139" }, { "database": "PubMed", "id": "32859369", "url": "https://pubmed.ncbi.nlm.nih.gov/32859369" }, { "database": "PubMed", "id": "33618712", "url": "https://pubmed.ncbi.nlm.nih.gov/33618712" }, { "database": "PubMed", "id": "9689080", "url": "https://pubmed.ncbi.nlm.nih.gov/9689080" } ], "site_lbl": "Ser5", "uniprot_canonical_ac": "P13796-1" } ], "record_id": "pubmed.23001012", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Correction of the N-terminal sequences of the human plastin isoforms by using anchored polymerase chain reaction: identification of a potential calcium-binding domain.", "journal": "Mol. Cell. Biol.", "date": "1990", "authors": "Lin C S, Aebersold R H, Leavitt J", "reference": { "type": "PubMed", "id": "2378651", "url": "https://pubmed.ncbi.nlm.nih.gov/2378651" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P13796-1", "protein_name": "Plastin-2", "gene_name": "LCP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P13797-1", "protein_name": "Plastin-3", "gene_name": "PLS3", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P13796", "url": "https://www.uniprot.org/uniprotkb/P13796" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.2378651", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "L-plastin nanobodies perturb matrix degradation, podosome formation, stability and lifetime in THP-1 macrophages.", "journal": "PloS one", "date": "2013", "authors": "De Clercq S, Boucherie C, Vandekerckhove J, Gettemans J, Guillabert A", "reference": { "type": "PubMed", "id": "24236012", "url": "https://pubmed.ncbi.nlm.nih.gov/24236012" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P13796-1", "protein_name": "Plastin-2", "gene_name": "LCP1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P13796", "url": "https://www.uniprot.org/uniprotkb/P13796" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 5, "end_pos": 5, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P13796", "url": "https://www.uniprot.org/uniprotkb/P13796" }, { "database": "PubMed", "id": "17294403", "url": "https://pubmed.ncbi.nlm.nih.gov/17294403" }, { "database": "PubMed", "id": "23186163", "url": "https://pubmed.ncbi.nlm.nih.gov/23186163" }, { "database": "PubMed", "id": "16636079", "url": "https://pubmed.ncbi.nlm.nih.gov/16636079" }, { "database": "PubMed", "id": "21406692", "url": "https://pubmed.ncbi.nlm.nih.gov/21406692" }, { "database": "iPTMnet", "id": "P13796", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P13796" }, { "database": "PubMed", "id": "10446213", "url": "https://pubmed.ncbi.nlm.nih.gov/10446213" }, { "database": "PubMed", "id": "19799649", "url": "https://pubmed.ncbi.nlm.nih.gov/19799649" }, { "database": "PubMed", "id": "20169155", "url": "https://pubmed.ncbi.nlm.nih.gov/20169155" }, { "database": "PubMed", "id": "22581862", "url": "https://pubmed.ncbi.nlm.nih.gov/22581862" }, { "database": "PubMed", "id": "23001012", "url": "https://pubmed.ncbi.nlm.nih.gov/23001012" }, { "database": "PubMed", "id": "24236012", "url": "https://pubmed.ncbi.nlm.nih.gov/24236012" }, { "database": "PubMed", "id": "24438191", "url": "https://pubmed.ncbi.nlm.nih.gov/24438191" }, { "database": "PubMed", "id": "26631483", "url": "https://pubmed.ncbi.nlm.nih.gov/26631483" }, { "database": "PubMed", "id": "27551545", "url": "https://pubmed.ncbi.nlm.nih.gov/27551545" }, { "database": "PubMed", "id": "29882856", "url": "https://pubmed.ncbi.nlm.nih.gov/29882856" }, { "database": "PubMed", "id": "30244178", "url": "https://pubmed.ncbi.nlm.nih.gov/30244178" }, { "database": "PubMed", "id": "30248139", "url": "https://pubmed.ncbi.nlm.nih.gov/30248139" }, { "database": "PubMed", "id": "32859369", "url": "https://pubmed.ncbi.nlm.nih.gov/32859369" }, { "database": "PubMed", "id": "33618712", "url": "https://pubmed.ncbi.nlm.nih.gov/33618712" }, { "database": "PubMed", "id": "9689080", "url": "https://pubmed.ncbi.nlm.nih.gov/9689080" } ], "site_lbl": "Ser5", "uniprot_canonical_ac": "P13796-1" } ], "record_id": "pubmed.24236012", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Metastasis of prostate cancer and melanoma cells in a preclinical in vivo mouse model is enhanced by L-plastin expression and phosphorylation.", "journal": "Molecular cancer", "date": "2014", "authors": "Riplinger SM, Wabnitz GH, Kirchgessner H, Jahraus B, Lasitschka F, Schulte B, van der Pluijm G, van der Horst G, Hammerling GJ, Nakchbandi I, Samstag Y", "reference": { "type": "PubMed", "id": "24438191", "url": "https://pubmed.ncbi.nlm.nih.gov/24438191" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P13796-1", "protein_name": "Plastin-2", "gene_name": "LCP1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P13796", "url": "https://www.uniprot.org/uniprotkb/P13796" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 5, "end_pos": 5, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P13796", "url": "https://www.uniprot.org/uniprotkb/P13796" }, { "database": "PubMed", "id": "17294403", "url": "https://pubmed.ncbi.nlm.nih.gov/17294403" }, { "database": "PubMed", "id": "23186163", "url": "https://pubmed.ncbi.nlm.nih.gov/23186163" }, { "database": "PubMed", "id": "16636079", "url": "https://pubmed.ncbi.nlm.nih.gov/16636079" }, { "database": "PubMed", "id": "21406692", "url": "https://pubmed.ncbi.nlm.nih.gov/21406692" }, { "database": "iPTMnet", "id": "P13796", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P13796" }, { "database": "PubMed", "id": "10446213", "url": "https://pubmed.ncbi.nlm.nih.gov/10446213" }, { "database": "PubMed", "id": "19799649", "url": "https://pubmed.ncbi.nlm.nih.gov/19799649" }, { "database": "PubMed", "id": "20169155", "url": "https://pubmed.ncbi.nlm.nih.gov/20169155" }, { "database": "PubMed", "id": "22581862", "url": "https://pubmed.ncbi.nlm.nih.gov/22581862" }, { "database": "PubMed", "id": "23001012", "url": "https://pubmed.ncbi.nlm.nih.gov/23001012" }, { "database": "PubMed", "id": "24236012", "url": "https://pubmed.ncbi.nlm.nih.gov/24236012" }, { "database": "PubMed", "id": "24438191", "url": "https://pubmed.ncbi.nlm.nih.gov/24438191" }, { "database": "PubMed", "id": "26631483", "url": "https://pubmed.ncbi.nlm.nih.gov/26631483" }, { "database": "PubMed", "id": "27551545", "url": "https://pubmed.ncbi.nlm.nih.gov/27551545" }, { "database": "PubMed", "id": "29882856", "url": "https://pubmed.ncbi.nlm.nih.gov/29882856" }, { "database": "PubMed", "id": "30244178", "url": "https://pubmed.ncbi.nlm.nih.gov/30244178" }, { "database": "PubMed", "id": "30248139", "url": "https://pubmed.ncbi.nlm.nih.gov/30248139" }, { "database": "PubMed", "id": "32859369", "url": "https://pubmed.ncbi.nlm.nih.gov/32859369" }, { "database": "PubMed", "id": "33618712", "url": "https://pubmed.ncbi.nlm.nih.gov/33618712" }, { "database": "PubMed", "id": "9689080", "url": "https://pubmed.ncbi.nlm.nih.gov/9689080" } ], "site_lbl": "Ser5", "uniprot_canonical_ac": "P13796-1" } ], "record_id": "pubmed.24438191", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "L-plastin Ser5 phosphorylation in breast cancer cells and in vitro is mediated by RSK downstream of the ERK/MAPK pathway.", "journal": "FASEB journal : official publication of the Federation of American Societies for Experimental Biology", "date": "2016", "authors": "Lommel MJ, Trairatphisan P, Gabler K, Laurini C, Muller A, Kaoma T, Vallar L, Sauter T, Schaffner-Reckinger E", "reference": { "type": "PubMed", "id": "26631483", "url": "https://pubmed.ncbi.nlm.nih.gov/26631483" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P13796-1", "protein_name": "Plastin-2", "gene_name": "LCP1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P13796", "url": "https://www.uniprot.org/uniprotkb/P13796" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 5, "end_pos": 5, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P13796", "url": "https://www.uniprot.org/uniprotkb/P13796" }, { "database": "PubMed", "id": "17294403", "url": "https://pubmed.ncbi.nlm.nih.gov/17294403" }, { "database": "PubMed", "id": "23186163", "url": "https://pubmed.ncbi.nlm.nih.gov/23186163" }, { "database": "PubMed", "id": "16636079", "url": "https://pubmed.ncbi.nlm.nih.gov/16636079" }, { "database": "PubMed", "id": "21406692", "url": "https://pubmed.ncbi.nlm.nih.gov/21406692" }, { "database": "iPTMnet", "id": "P13796", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P13796" }, { "database": "PubMed", "id": "10446213", "url": "https://pubmed.ncbi.nlm.nih.gov/10446213" }, { "database": "PubMed", "id": "19799649", "url": "https://pubmed.ncbi.nlm.nih.gov/19799649" }, { "database": "PubMed", "id": "20169155", "url": "https://pubmed.ncbi.nlm.nih.gov/20169155" }, { "database": "PubMed", "id": "22581862", "url": "https://pubmed.ncbi.nlm.nih.gov/22581862" }, { "database": "PubMed", "id": "23001012", "url": "https://pubmed.ncbi.nlm.nih.gov/23001012" }, { "database": "PubMed", "id": "24236012", "url": "https://pubmed.ncbi.nlm.nih.gov/24236012" }, { "database": "PubMed", "id": "24438191", "url": "https://pubmed.ncbi.nlm.nih.gov/24438191" }, { "database": "PubMed", "id": "26631483", "url": "https://pubmed.ncbi.nlm.nih.gov/26631483" }, { "database": "PubMed", "id": "27551545", "url": "https://pubmed.ncbi.nlm.nih.gov/27551545" }, { "database": "PubMed", "id": "29882856", "url": "https://pubmed.ncbi.nlm.nih.gov/29882856" }, { "database": "PubMed", "id": "30244178", "url": "https://pubmed.ncbi.nlm.nih.gov/30244178" }, { "database": "PubMed", "id": "30248139", "url": "https://pubmed.ncbi.nlm.nih.gov/30248139" }, { "database": "PubMed", "id": "32859369", "url": "https://pubmed.ncbi.nlm.nih.gov/32859369" }, { "database": "PubMed", "id": "33618712", "url": "https://pubmed.ncbi.nlm.nih.gov/33618712" }, { "database": "PubMed", "id": "9689080", "url": "https://pubmed.ncbi.nlm.nih.gov/9689080" } ], "site_lbl": "Ser5", "uniprot_canonical_ac": "P13796-1" } ], "record_id": "pubmed.26631483", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The pro-oxidative drug WF-10 inhibits serial killing by primary human cytotoxic T-cells.", "journal": "Cell death discovery", "date": "2016", "authors": "Wabnitz GH, Balta E, Schindler S, Kirchgessner H, Jahraus B, Meuer S, Samstag Y", "reference": { "type": "PubMed", "id": "27551545", "url": "https://pubmed.ncbi.nlm.nih.gov/27551545" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P13796-1", "protein_name": "Plastin-2", "gene_name": "LCP1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P13796", "url": "https://www.uniprot.org/uniprotkb/P13796" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 5, "end_pos": 5, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P13796", "url": "https://www.uniprot.org/uniprotkb/P13796" }, { "database": "PubMed", "id": "17294403", "url": "https://pubmed.ncbi.nlm.nih.gov/17294403" }, { "database": "PubMed", "id": "23186163", "url": "https://pubmed.ncbi.nlm.nih.gov/23186163" }, { "database": "PubMed", "id": "16636079", "url": "https://pubmed.ncbi.nlm.nih.gov/16636079" }, { "database": "PubMed", "id": "21406692", "url": "https://pubmed.ncbi.nlm.nih.gov/21406692" }, { "database": "iPTMnet", "id": "P13796", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P13796" }, { "database": "PubMed", "id": "10446213", "url": "https://pubmed.ncbi.nlm.nih.gov/10446213" }, { "database": "PubMed", "id": "19799649", "url": "https://pubmed.ncbi.nlm.nih.gov/19799649" }, { "database": "PubMed", "id": "20169155", "url": "https://pubmed.ncbi.nlm.nih.gov/20169155" }, { "database": "PubMed", "id": "22581862", "url": "https://pubmed.ncbi.nlm.nih.gov/22581862" }, { "database": "PubMed", "id": "23001012", "url": "https://pubmed.ncbi.nlm.nih.gov/23001012" }, { "database": "PubMed", "id": "24236012", "url": "https://pubmed.ncbi.nlm.nih.gov/24236012" }, { "database": "PubMed", "id": "24438191", "url": "https://pubmed.ncbi.nlm.nih.gov/24438191" }, { "database": "PubMed", "id": "26631483", "url": "https://pubmed.ncbi.nlm.nih.gov/26631483" }, { "database": "PubMed", "id": "27551545", "url": "https://pubmed.ncbi.nlm.nih.gov/27551545" }, { "database": "PubMed", "id": "29882856", "url": "https://pubmed.ncbi.nlm.nih.gov/29882856" }, { "database": "PubMed", "id": "30244178", "url": "https://pubmed.ncbi.nlm.nih.gov/30244178" }, { "database": "PubMed", "id": "30248139", "url": "https://pubmed.ncbi.nlm.nih.gov/30248139" }, { "database": "PubMed", "id": "32859369", "url": "https://pubmed.ncbi.nlm.nih.gov/32859369" }, { "database": "PubMed", "id": "33618712", "url": "https://pubmed.ncbi.nlm.nih.gov/33618712" }, { "database": "PubMed", "id": "9689080", "url": "https://pubmed.ncbi.nlm.nih.gov/9689080" } ], "site_lbl": "Ser5", "uniprot_canonical_ac": "P13796-1" } ], "record_id": "pubmed.27551545", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Inhibition of HIF1alpha-Dependent Upregulation of Phospho-l-Plastin Resensitizes Multiple Myeloma Cells to Frontline Therapy.", "journal": "International journal of molecular sciences", "date": "2018", "authors": "Bosseler M, Marani V, Broukou A, Lequeux A, Kaoma T, Schlesser V, Francois JH, Palissot V, Berchem GJ, Aouali N, Janji B", "reference": { "type": "PubMed", "id": "29882856", "url": "https://pubmed.ncbi.nlm.nih.gov/29882856" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P13796-1", "protein_name": "Plastin-2", "gene_name": "LCP1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P13796", "url": "https://www.uniprot.org/uniprotkb/P13796" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 5, "end_pos": 5, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P13796", "url": "https://www.uniprot.org/uniprotkb/P13796" }, { "database": "PubMed", "id": "17294403", "url": "https://pubmed.ncbi.nlm.nih.gov/17294403" }, { "database": "PubMed", "id": "23186163", "url": "https://pubmed.ncbi.nlm.nih.gov/23186163" }, { "database": "PubMed", "id": "16636079", "url": "https://pubmed.ncbi.nlm.nih.gov/16636079" }, { "database": "PubMed", "id": "21406692", "url": "https://pubmed.ncbi.nlm.nih.gov/21406692" }, { "database": "iPTMnet", "id": "P13796", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P13796" }, { "database": "PubMed", "id": "10446213", "url": "https://pubmed.ncbi.nlm.nih.gov/10446213" }, { "database": "PubMed", "id": "19799649", "url": "https://pubmed.ncbi.nlm.nih.gov/19799649" }, { "database": "PubMed", "id": "20169155", "url": "https://pubmed.ncbi.nlm.nih.gov/20169155" }, { "database": "PubMed", "id": "22581862", "url": "https://pubmed.ncbi.nlm.nih.gov/22581862" }, { "database": "PubMed", "id": "23001012", "url": "https://pubmed.ncbi.nlm.nih.gov/23001012" }, { "database": "PubMed", "id": "24236012", "url": "https://pubmed.ncbi.nlm.nih.gov/24236012" }, { "database": "PubMed", "id": "24438191", "url": "https://pubmed.ncbi.nlm.nih.gov/24438191" }, { "database": "PubMed", "id": "26631483", "url": "https://pubmed.ncbi.nlm.nih.gov/26631483" }, { "database": "PubMed", "id": "27551545", "url": "https://pubmed.ncbi.nlm.nih.gov/27551545" }, { "database": "PubMed", "id": "29882856", "url": "https://pubmed.ncbi.nlm.nih.gov/29882856" }, { "database": "PubMed", "id": "30244178", "url": "https://pubmed.ncbi.nlm.nih.gov/30244178" }, { "database": "PubMed", "id": "30248139", "url": "https://pubmed.ncbi.nlm.nih.gov/30248139" }, { "database": "PubMed", "id": "32859369", "url": "https://pubmed.ncbi.nlm.nih.gov/32859369" }, { "database": "PubMed", "id": "33618712", "url": "https://pubmed.ncbi.nlm.nih.gov/33618712" }, { "database": "PubMed", "id": "9689080", "url": "https://pubmed.ncbi.nlm.nih.gov/9689080" } ], "site_lbl": "Ser5", "uniprot_canonical_ac": "P13796-1" } ], "record_id": "pubmed.29882856", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "L-plastin phosphorylation regulates the early phase of sealing ring formation by actin bundling process in mouse osteoclasts.", "journal": "Experimental cell research", "date": "2018", "authors": "Chellaiah MA, Ma T, Majumdar S", "reference": { "type": "PubMed", "id": "30244178", "url": "https://pubmed.ncbi.nlm.nih.gov/30244178" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P13796-1", "protein_name": "Plastin-2", "gene_name": "LCP1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P13796", "url": "https://www.uniprot.org/uniprotkb/P13796" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 5, "end_pos": 5, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P13796", "url": "https://www.uniprot.org/uniprotkb/P13796" }, { "database": "PubMed", "id": "17294403", "url": "https://pubmed.ncbi.nlm.nih.gov/17294403" }, { "database": "PubMed", "id": "23186163", "url": "https://pubmed.ncbi.nlm.nih.gov/23186163" }, { "database": "PubMed", "id": "16636079", "url": "https://pubmed.ncbi.nlm.nih.gov/16636079" }, { "database": "PubMed", "id": "21406692", "url": "https://pubmed.ncbi.nlm.nih.gov/21406692" }, { "database": "iPTMnet", "id": "P13796", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P13796" }, { "database": "PubMed", "id": "10446213", "url": "https://pubmed.ncbi.nlm.nih.gov/10446213" }, { "database": "PubMed", "id": "19799649", "url": "https://pubmed.ncbi.nlm.nih.gov/19799649" }, { "database": "PubMed", "id": "20169155", "url": "https://pubmed.ncbi.nlm.nih.gov/20169155" }, { "database": "PubMed", "id": "22581862", "url": "https://pubmed.ncbi.nlm.nih.gov/22581862" }, { "database": "PubMed", "id": "23001012", "url": "https://pubmed.ncbi.nlm.nih.gov/23001012" }, { "database": "PubMed", "id": "24236012", "url": "https://pubmed.ncbi.nlm.nih.gov/24236012" }, { "database": "PubMed", "id": "24438191", "url": "https://pubmed.ncbi.nlm.nih.gov/24438191" }, { "database": "PubMed", "id": "26631483", "url": "https://pubmed.ncbi.nlm.nih.gov/26631483" }, { "database": "PubMed", "id": "27551545", "url": "https://pubmed.ncbi.nlm.nih.gov/27551545" }, { "database": "PubMed", "id": "29882856", "url": "https://pubmed.ncbi.nlm.nih.gov/29882856" }, { "database": "PubMed", "id": "30244178", "url": "https://pubmed.ncbi.nlm.nih.gov/30244178" }, { "database": "PubMed", "id": "30248139", "url": "https://pubmed.ncbi.nlm.nih.gov/30248139" }, { "database": "PubMed", "id": "32859369", "url": "https://pubmed.ncbi.nlm.nih.gov/32859369" }, { "database": "PubMed", "id": "33618712", "url": "https://pubmed.ncbi.nlm.nih.gov/33618712" }, { "database": "PubMed", "id": "9689080", "url": "https://pubmed.ncbi.nlm.nih.gov/9689080" } ], "site_lbl": "Ser5", "uniprot_canonical_ac": "P13796-1" } ], "record_id": "pubmed.30244178", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Peptidomimetic inhibitors of L-plastin reduce the resorptive activity of osteoclast but not the bone forming activity of osteoblasts in vitro.", "journal": "PloS one", "date": "2018", "authors": "Chellaiah MA, Majumdar S, Aljohani H", "reference": { "type": "PubMed", "id": "30248139", "url": "https://pubmed.ncbi.nlm.nih.gov/30248139" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P13796-1", "protein_name": "Plastin-2", "gene_name": "LCP1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P13796", "url": "https://www.uniprot.org/uniprotkb/P13796" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 5, "end_pos": 5, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P13796", "url": "https://www.uniprot.org/uniprotkb/P13796" }, { "database": "PubMed", "id": "17294403", "url": "https://pubmed.ncbi.nlm.nih.gov/17294403" }, { "database": "PubMed", "id": "23186163", "url": "https://pubmed.ncbi.nlm.nih.gov/23186163" }, { "database": "PubMed", "id": "16636079", "url": "https://pubmed.ncbi.nlm.nih.gov/16636079" }, { "database": "PubMed", "id": "21406692", "url": "https://pubmed.ncbi.nlm.nih.gov/21406692" }, { "database": "iPTMnet", "id": "P13796", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P13796" }, { "database": "PubMed", "id": "10446213", "url": "https://pubmed.ncbi.nlm.nih.gov/10446213" }, { "database": "PubMed", "id": "19799649", "url": "https://pubmed.ncbi.nlm.nih.gov/19799649" }, { "database": "PubMed", "id": "20169155", "url": "https://pubmed.ncbi.nlm.nih.gov/20169155" }, { "database": "PubMed", "id": "22581862", "url": "https://pubmed.ncbi.nlm.nih.gov/22581862" }, { "database": "PubMed", "id": "23001012", "url": "https://pubmed.ncbi.nlm.nih.gov/23001012" }, { "database": "PubMed", "id": "24236012", "url": "https://pubmed.ncbi.nlm.nih.gov/24236012" }, { "database": "PubMed", "id": "24438191", "url": "https://pubmed.ncbi.nlm.nih.gov/24438191" }, { "database": "PubMed", "id": "26631483", "url": "https://pubmed.ncbi.nlm.nih.gov/26631483" }, { "database": "PubMed", "id": "27551545", "url": "https://pubmed.ncbi.nlm.nih.gov/27551545" }, { "database": "PubMed", "id": "29882856", "url": "https://pubmed.ncbi.nlm.nih.gov/29882856" }, { "database": "PubMed", "id": "30244178", "url": "https://pubmed.ncbi.nlm.nih.gov/30244178" }, { "database": "PubMed", "id": "30248139", "url": "https://pubmed.ncbi.nlm.nih.gov/30248139" }, { "database": "PubMed", "id": "32859369", "url": "https://pubmed.ncbi.nlm.nih.gov/32859369" }, { "database": "PubMed", "id": "33618712", "url": "https://pubmed.ncbi.nlm.nih.gov/33618712" }, { "database": "PubMed", "id": "9689080", "url": "https://pubmed.ncbi.nlm.nih.gov/9689080" } ], "site_lbl": "Ser5", "uniprot_canonical_ac": "P13796-1" }, { "start_pos": 7, "end_pos": 7, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P13796", "url": "https://www.uniprot.org/uniprotkb/P13796" }, { "database": "PubMed", "id": "19690332", "url": "https://pubmed.ncbi.nlm.nih.gov/19690332" }, { "database": "iPTMnet", "id": "P13796", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P13796" }, { "database": "PubMed", "id": "30248139", "url": "https://pubmed.ncbi.nlm.nih.gov/30248139" } ], "site_lbl": "Ser7", "uniprot_canonical_ac": "P13796-1" } ], "record_id": "pubmed.30248139", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Spatial oxidation of L-plastin downmodulates actin-based functions of tumor cells.", "journal": "Nature communications", "date": "2019", "authors": "Balta E, Hardt R, Liang J, Kirchgessner H, Orlik C, Jahraus B, Hillmer S, Meuer S, Hubner K, Wabnitz GH, Samstag Y", "reference": { "type": "PubMed", "id": "31501427", "url": "https://pubmed.ncbi.nlm.nih.gov/31501427" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P13796-1", "protein_name": "Plastin-2", "gene_name": "LCP1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P13796", "url": "https://www.uniprot.org/uniprotkb/P13796" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.31501427", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] } ]