[ { "title": "Caspase-activated ROCK-1 allows erythroblast terminal maturation independently of cytokine-induced Rho signaling.", "journal": "Cell death and differentiation", "date": "2011", "authors": "Gabet AS, Coulon S, Fricot A, Vandekerckhove J, Chang Y, Ribeil JA, Lordier L, Zermati Y, Asnafi V, Belaid Z, Debili N, Vainchenker W, Varet B, Hermine O, Courtois G", "reference": { "type": "PubMed", "id": "21072057", "url": "https://pubmed.ncbi.nlm.nih.gov/21072057" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q13464-1", "protein_name": "Rho-associated protein kinase 1", "gene_name": "ROCK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P24844-1", "protein_name": "Myosin regulatory light polypeptide 9", "gene_name": "MYL9", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q13464", "url": "https://www.uniprot.org/uniprotkb/Q13464" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 20, "end_pos": 20, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by CDC42BP, CIT, MLCK, PAK1, ROCK1, ROCK2, DAPK1, DAPK2 and ZIPK/DAPK3", "evidence": [ { "database": "UniProtKB", "id": "P24844", "url": "https://www.uniprot.org/uniprotkb/P24844" }, { "database": "iPTMnet", "id": "P24844", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P24844" }, { "database": "PubMed", "id": "18491316", "url": "https://pubmed.ncbi.nlm.nih.gov/18491316" }, { "database": "PubMed", "id": "18669648", "url": "https://pubmed.ncbi.nlm.nih.gov/18669648" }, { "database": "PubMed", "id": "18707149", "url": "https://pubmed.ncbi.nlm.nih.gov/18707149" }, { "database": "PubMed", "id": "20068231", "url": "https://pubmed.ncbi.nlm.nih.gov/20068231" }, { "database": "PubMed", "id": "20166139", "url": "https://pubmed.ncbi.nlm.nih.gov/20166139" }, { "database": "IntAct", "id": "P24844", "url": "https://www.ebi.ac.uk/intact/interactors/id:P24844*" }, { "database": "PubMed", "id": "20956536", "url": "https://pubmed.ncbi.nlm.nih.gov/20956536" }, { "database": "PubMed", "id": "15723050", "url": "https://pubmed.ncbi.nlm.nih.gov/15723050" }, { "database": "PRO", "id": "P24844", "url": "https://proconsortium.org/cgi-bin/entry_pro?id=P24844" }, { "database": "PubMed", "id": "18854160", "url": "https://pubmed.ncbi.nlm.nih.gov/18854160" }, { "database": "PubMed", "id": "21072057", "url": "https://pubmed.ncbi.nlm.nih.gov/21072057" }, { "database": "PubMed", "id": "21408167", "url": "https://pubmed.ncbi.nlm.nih.gov/21408167" }, { "database": "PubMed", "id": "21457715", "url": "https://pubmed.ncbi.nlm.nih.gov/21457715" }, { "database": "PubMed", "id": "11942626", "url": "https://pubmed.ncbi.nlm.nih.gov/11942626" } ], "site_lbl": "Ser20", "uniprot_canonical_ac": "P24844-1" } ], "record_id": "pubmed.21072057", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Willin and Par3 cooperatively regulate epithelial apical constriction through aPKC-mediated ROCK phosphorylation.", "journal": "Nature cell biology", "date": "2011", "authors": "Ishiuchi T, Takeichi M", "reference": { "type": "PubMed", "id": "21685893", "url": "https://pubmed.ncbi.nlm.nih.gov/21685893" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q13464-1", "protein_name": "Rho-associated protein kinase 1", "gene_name": "ROCK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8C0V9-1", "protein_name": "FERM domain-containing protein 6", "gene_name": "Frmd6", "tax_name": "Mouse" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q13464", "url": "https://www.uniprot.org/uniprotkb/Q13464" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 1024, "end_pos": 1024, "kinase_uniprot_canonical_ac": "P41743-1", "kinase_gene_name": "PRKCI", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q13464", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q13464" }, { "database": "PubMed", "id": "21685893", "url": "https://pubmed.ncbi.nlm.nih.gov/21685893" } ], "site_lbl": "Thr1024", "uniprot_canonical_ac": "Q13464-1" }, { "start_pos": 1333, "end_pos": 1333, "kinase_uniprot_canonical_ac": "P41743-1", "kinase_gene_name": "PRKCI", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q13464", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q13464" }, { "database": "PubMed", "id": "21685893", "url": "https://pubmed.ncbi.nlm.nih.gov/21685893" } ], "site_lbl": "Ser1333", "uniprot_canonical_ac": "Q13464-1" }, { "start_pos": 1334, "end_pos": 1334, "kinase_uniprot_canonical_ac": "P41743-1", "kinase_gene_name": "PRKCI", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q13464", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q13464" }, { "database": "PubMed", "id": "21685893", "url": "https://pubmed.ncbi.nlm.nih.gov/21685893" } ], "site_lbl": "Thr1334", "uniprot_canonical_ac": "Q13464-1" }, { "start_pos": 1337, "end_pos": 1337, "kinase_uniprot_canonical_ac": "P41743-1", "kinase_gene_name": "PRKCI", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q13464", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q13464" }, { "database": "PubMed", "id": "21685893", "url": "https://pubmed.ncbi.nlm.nih.gov/21685893" } ], "site_lbl": "Thr1337", "uniprot_canonical_ac": "Q13464-1" }, { "start_pos": 1341, "end_pos": 1341, "kinase_uniprot_canonical_ac": "P41743-1", "kinase_gene_name": "PRKCI", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q13464", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q13464" }, { "database": "PubMed", "id": "21685893", "url": "https://pubmed.ncbi.nlm.nih.gov/21685893" } ], "site_lbl": "Ser1341", "uniprot_canonical_ac": "Q13464-1" } ], "record_id": "pubmed.21685893", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 5 }, { "field": "total_sites", "count": 5 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Rho-associated coiled-coil kinase (ROCK) protein controls microtubule dynamics in a novel signaling pathway that regulates cell migration.", "journal": "The Journal of biological chemistry", "date": "2012", "authors": "Schofield AV, Steel R, Bernard O", "reference": { "type": "PubMed", "id": "23093407", "url": "https://pubmed.ncbi.nlm.nih.gov/23093407" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q13464-1", "protein_name": "Rho-associated protein kinase 1", "gene_name": "ROCK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UBN7-1", "protein_name": "Protein deacetylase HDAC6", "gene_name": "HDAC6", "tax_name": "Human" }, { "uniprot_canonical_ac": "O94811-1", "protein_name": "Tubulin polymerization-promoting protein", "gene_name": "TPPP", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q13464", "url": "https://www.uniprot.org/uniprotkb/Q13464" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 107, "end_pos": 107, "sequence_org": "S", "sequence_mut": "A", "comment": "In 3Ala; abolished phosphorylation by ROCK1, leading to delayed entry into S-phase; when associated with A-32 and A-159.", "evidence": [ { "database": "UniProtKB", "id": "O94811", "url": "https://www.uniprot.org/uniprotkb/O94811" }, { "database": "PubMed", "id": "23093407", "url": "https://pubmed.ncbi.nlm.nih.gov/23093407" }, { "database": "PubMed", "id": "23355470", "url": "https://pubmed.ncbi.nlm.nih.gov/23355470" } ], "uniprot_canonical_ac": "O94811-1" }, { "start_pos": 107, "end_pos": 107, "sequence_org": "S", "sequence_mut": "E", "comment": "In 3Glu; phosphomimetic mutant, leading to decreased transition of the G1/S-phase; when associated with E-32 and E-159.", "evidence": [ { "database": "UniProtKB", "id": "O94811", "url": "https://www.uniprot.org/uniprotkb/O94811" }, { "database": "PubMed", "id": "23093407", "url": "https://pubmed.ncbi.nlm.nih.gov/23093407" }, { "database": "PubMed", "id": "23355470", "url": "https://pubmed.ncbi.nlm.nih.gov/23355470" } ], "uniprot_canonical_ac": "O94811-1" }, { "start_pos": 159, "end_pos": 159, "sequence_org": "S", "sequence_mut": "A", "comment": "In 3Ala; abolished phosphorylation by ROCK1, leading to delayed entry into S-phase; when associated with A-32 and A-107.", "evidence": [ { "database": "UniProtKB", "id": "O94811", "url": "https://www.uniprot.org/uniprotkb/O94811" }, { "database": "PubMed", "id": "23093407", "url": "https://pubmed.ncbi.nlm.nih.gov/23093407" }, { "database": "PubMed", "id": "23355470", "url": "https://pubmed.ncbi.nlm.nih.gov/23355470" } ], "uniprot_canonical_ac": "O94811-1" }, { "start_pos": 159, "end_pos": 159, "sequence_org": "S", "sequence_mut": "E", "comment": "In 3Glu; phosphomimetic mutant, leading to decreased transition of the G1/S-phase; when associated with E-32 and E-107.", "evidence": [ { "database": "UniProtKB", "id": "O94811", "url": "https://www.uniprot.org/uniprotkb/O94811" }, { "database": "PubMed", "id": "23093407", "url": "https://pubmed.ncbi.nlm.nih.gov/23093407" }, { "database": "PubMed", "id": "23355470", "url": "https://pubmed.ncbi.nlm.nih.gov/23355470" } ], "uniprot_canonical_ac": "O94811-1" }, { "start_pos": 32, "end_pos": 32, "sequence_org": "S", "sequence_mut": "A", "comment": "In 3Ala; abolished phosphorylation by ROCK1, leading to delayed entry into S-phase; when associated with A-107 and A-159.", "evidence": [ { "database": "UniProtKB", "id": "O94811", "url": "https://www.uniprot.org/uniprotkb/O94811" }, { "database": "PubMed", "id": "23093407", "url": "https://pubmed.ncbi.nlm.nih.gov/23093407" }, { "database": "PubMed", "id": "23355470", "url": "https://pubmed.ncbi.nlm.nih.gov/23355470" } ], "uniprot_canonical_ac": "O94811-1" }, { "start_pos": 32, "end_pos": 32, "sequence_org": "S", "sequence_mut": "E", "comment": "In 3Glu; phosphomimetic mutant, leading to decreased transition of the G1/S-phase; when associated with E-07 and E-159.", "evidence": [ { "database": "UniProtKB", "id": "O94811", "url": "https://www.uniprot.org/uniprotkb/O94811" }, { "database": "PubMed", "id": "23093407", "url": "https://pubmed.ncbi.nlm.nih.gov/23093407" }, { "database": "PubMed", "id": "23355470", "url": "https://pubmed.ncbi.nlm.nih.gov/23355470" } ], "uniprot_canonical_ac": "O94811-1" } ], "phosphorylation": [ { "start_pos": 107, "end_pos": 107, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by ROCK1", "evidence": [ { "database": "UniProtKB", "id": "O94811", "url": "https://www.uniprot.org/uniprotkb/O94811" }, { "database": "iPTMnet", "id": "O94811", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O94811" }, { "database": "PubMed", "id": "23093407", "url": "https://pubmed.ncbi.nlm.nih.gov/23093407" } ], "site_lbl": "Ser107", "uniprot_canonical_ac": "O94811-1" }, { "start_pos": 159, "end_pos": 159, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by ROCK1", "evidence": [ { "database": "UniProtKB", "id": "O94811", "url": "https://www.uniprot.org/uniprotkb/O94811" }, { "database": "iPTMnet", "id": "O94811", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O94811" }, { "database": "PubMed", "id": "23093407", "url": "https://pubmed.ncbi.nlm.nih.gov/23093407" }, { "database": "PubMed", "id": "24275569", "url": "https://pubmed.ncbi.nlm.nih.gov/24275569" }, { "database": "PubMed", "id": "17693641", "url": "https://pubmed.ncbi.nlm.nih.gov/17693641" } ], "site_lbl": "Ser159", "uniprot_canonical_ac": "O94811-1" }, { "start_pos": 32, "end_pos": 32, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by ROCK1", "evidence": [ { "database": "UniProtKB", "id": "O94811", "url": "https://www.uniprot.org/uniprotkb/O94811" }, { "database": "iPTMnet", "id": "O94811", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O94811" }, { "database": "PubMed", "id": "18669648", "url": "https://pubmed.ncbi.nlm.nih.gov/18669648" }, { "database": "PubMed", "id": "20068231", "url": "https://pubmed.ncbi.nlm.nih.gov/20068231" }, { "database": "PubMed", "id": "20166139", "url": "https://pubmed.ncbi.nlm.nih.gov/20166139" }, { "database": "PubMed", "id": "18220336", "url": "https://pubmed.ncbi.nlm.nih.gov/18220336" }, { "database": "PubMed", "id": "23093407", "url": "https://pubmed.ncbi.nlm.nih.gov/23093407" }, { "database": "PubMed", "id": "17693641", "url": "https://pubmed.ncbi.nlm.nih.gov/17693641" } ], "site_lbl": "Ser32", "uniprot_canonical_ac": "O94811-1" } ], "record_id": "pubmed.23093407", "abstract": "", "glycosylation": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 3 }, { "field": "total_sites", "count": 3 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Tubulin polymerization promoting protein 1 (Tppp1) phosphorylation by Rho-associated coiled-coil kinase (rock) and cyclin-dependent kinase 1 (Cdk1) inhibits microtubule dynamics to increase cell proliferation.", "journal": "The Journal of biological chemistry", "date": "2013", "authors": "Schofield AV, Gamell C, Suryadinata R, Sarcevic B, Bernard O", "reference": { "type": "PubMed", "id": "23355470", "url": "https://pubmed.ncbi.nlm.nih.gov/23355470" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q13464-1", "protein_name": "Rho-associated protein kinase 1", "gene_name": "ROCK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06493-1", "protein_name": "Cyclin-dependent kinase 1", "gene_name": "CDK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O94811-1", "protein_name": "Tubulin polymerization-promoting protein", "gene_name": "TPPP", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q13464", "url": "https://www.uniprot.org/uniprotkb/Q13464" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 107, "end_pos": 107, "sequence_org": "S", "sequence_mut": "A", "comment": "In 3Ala; abolished phosphorylation by ROCK1, leading to delayed entry into S-phase; when associated with A-32 and A-159.", "evidence": [ { "database": "UniProtKB", "id": "O94811", "url": "https://www.uniprot.org/uniprotkb/O94811" }, { "database": "PubMed", "id": "23093407", "url": "https://pubmed.ncbi.nlm.nih.gov/23093407" }, { "database": "PubMed", "id": "23355470", "url": "https://pubmed.ncbi.nlm.nih.gov/23355470" } ], "uniprot_canonical_ac": "O94811-1" }, { "start_pos": 107, "end_pos": 107, "sequence_org": "S", "sequence_mut": "E", "comment": "In 3Glu; phosphomimetic mutant, leading to decreased transition of the G1/S-phase; when associated with E-32 and E-159.", "evidence": [ { "database": "UniProtKB", "id": "O94811", "url": "https://www.uniprot.org/uniprotkb/O94811" }, { "database": "PubMed", "id": "23093407", "url": "https://pubmed.ncbi.nlm.nih.gov/23093407" }, { "database": "PubMed", "id": "23355470", "url": "https://pubmed.ncbi.nlm.nih.gov/23355470" } ], "uniprot_canonical_ac": "O94811-1" }, { "start_pos": 14, "end_pos": 14, "sequence_org": "T", "sequence_mut": "A", "comment": "In 4Ala; abolished phosphorylation by CDK1 without affecting G1/S-phase transition; when associated with A-18, A-45 and A-160.", "evidence": [ { "database": "UniProtKB", "id": "O94811", "url": "https://www.uniprot.org/uniprotkb/O94811" }, { "database": "PubMed", "id": "23355470", "url": "https://pubmed.ncbi.nlm.nih.gov/23355470" } ], "uniprot_canonical_ac": "O94811-1" }, { "start_pos": 14, "end_pos": 14, "sequence_org": "T", "sequence_mut": "E", "comment": "In 4Glu; phosphomimetic mutant, does not affect G1/S-phase transition; when associated with E-18, E-45 and E-160.", "evidence": [ { "database": "UniProtKB", "id": "O94811", "url": "https://www.uniprot.org/uniprotkb/O94811" }, { "database": "PubMed", "id": "23355470", "url": "https://pubmed.ncbi.nlm.nih.gov/23355470" } ], "uniprot_canonical_ac": "O94811-1" }, { "start_pos": 159, "end_pos": 159, "sequence_org": "S", "sequence_mut": "A", "comment": "In 3Ala; abolished phosphorylation by ROCK1, leading to delayed entry into S-phase; when associated with A-32 and A-107.", "evidence": [ { "database": "UniProtKB", "id": "O94811", "url": "https://www.uniprot.org/uniprotkb/O94811" }, { "database": "PubMed", "id": "23093407", "url": "https://pubmed.ncbi.nlm.nih.gov/23093407" }, { "database": "PubMed", "id": "23355470", "url": "https://pubmed.ncbi.nlm.nih.gov/23355470" } ], "uniprot_canonical_ac": "O94811-1" }, { "start_pos": 159, "end_pos": 159, "sequence_org": "S", "sequence_mut": "E", "comment": "In 3Glu; phosphomimetic mutant, leading to decreased transition of the G1/S-phase; when associated with E-32 and E-107.", "evidence": [ { "database": "UniProtKB", "id": "O94811", "url": "https://www.uniprot.org/uniprotkb/O94811" }, { "database": "PubMed", "id": "23093407", "url": "https://pubmed.ncbi.nlm.nih.gov/23093407" }, { "database": "PubMed", "id": "23355470", "url": "https://pubmed.ncbi.nlm.nih.gov/23355470" } ], "uniprot_canonical_ac": "O94811-1" }, { "start_pos": 160, "end_pos": 160, "sequence_org": "S", "sequence_mut": "A", "comment": "In 4Ala; abolished phosphorylation by CDK1 without affecting G1/S-phase transition; when associated with A-14, A-18 and A-45.", "evidence": [ { "database": "UniProtKB", "id": "O94811", "url": "https://www.uniprot.org/uniprotkb/O94811" }, { "database": "PubMed", "id": "23355470", "url": "https://pubmed.ncbi.nlm.nih.gov/23355470" } ], "uniprot_canonical_ac": "O94811-1" }, { "start_pos": 160, "end_pos": 160, "sequence_org": "S", "sequence_mut": "E", "comment": "In 4Glu; phosphomimetic mutant, does not affect G1/S-phase transition; when associated with E-14, E-18 and E-45.", "evidence": [ { "database": "UniProtKB", "id": "O94811", "url": "https://www.uniprot.org/uniprotkb/O94811" }, { "database": "PubMed", "id": "23355470", "url": "https://pubmed.ncbi.nlm.nih.gov/23355470" } ], "uniprot_canonical_ac": "O94811-1" }, { "start_pos": 18, "end_pos": 18, "sequence_org": "S", "sequence_mut": "A", "comment": "In 4Ala; abolished phosphorylation by CDK1 without affecting G1/S-phase transition; when associated with A-14, A-45 and A-160.", "evidence": [ { "database": "UniProtKB", "id": "O94811", "url": "https://www.uniprot.org/uniprotkb/O94811" }, { "database": "PubMed", "id": "23355470", "url": "https://pubmed.ncbi.nlm.nih.gov/23355470" } ], "uniprot_canonical_ac": "O94811-1" }, { "start_pos": 18, "end_pos": 18, "sequence_org": "S", "sequence_mut": "E", "comment": "In 4Glu; phosphomimetic mutant, does not affect G1/S-phase transition; when associated with E-14, E-45 and E-160.", "evidence": [ { "database": "UniProtKB", "id": "O94811", "url": "https://www.uniprot.org/uniprotkb/O94811" }, { "database": "PubMed", "id": "23355470", "url": "https://pubmed.ncbi.nlm.nih.gov/23355470" } ], "uniprot_canonical_ac": "O94811-1" }, { "start_pos": 32, "end_pos": 32, "sequence_org": "S", "sequence_mut": "A", "comment": "In 3Ala; abolished phosphorylation by ROCK1, leading to delayed entry into S-phase; when associated with A-107 and A-159.", "evidence": [ { "database": "UniProtKB", "id": "O94811", "url": "https://www.uniprot.org/uniprotkb/O94811" }, { "database": "PubMed", "id": "23093407", "url": "https://pubmed.ncbi.nlm.nih.gov/23093407" }, { "database": "PubMed", "id": "23355470", "url": "https://pubmed.ncbi.nlm.nih.gov/23355470" } ], "uniprot_canonical_ac": "O94811-1" }, { "start_pos": 32, "end_pos": 32, "sequence_org": "S", "sequence_mut": "E", "comment": "In 3Glu; phosphomimetic mutant, leading to decreased transition of the G1/S-phase; when associated with E-07 and E-159.", "evidence": [ { "database": "UniProtKB", "id": "O94811", "url": "https://www.uniprot.org/uniprotkb/O94811" }, { "database": "PubMed", "id": "23093407", "url": "https://pubmed.ncbi.nlm.nih.gov/23093407" }, { "database": "PubMed", "id": "23355470", "url": "https://pubmed.ncbi.nlm.nih.gov/23355470" } ], "uniprot_canonical_ac": "O94811-1" }, { "start_pos": 45, "end_pos": 45, "sequence_org": "S", "sequence_mut": "A", "comment": "In 4Ala; abolished phosphorylation by CDK1 without affecting G1/S-phase transition; when associated with A-14, A-18 and A-160.", "evidence": [ { "database": "UniProtKB", "id": "O94811", "url": "https://www.uniprot.org/uniprotkb/O94811" }, { "database": "PubMed", "id": "23355470", "url": "https://pubmed.ncbi.nlm.nih.gov/23355470" } ], "uniprot_canonical_ac": "O94811-1" }, { "start_pos": 45, "end_pos": 45, "sequence_org": "S", "sequence_mut": "E", "comment": "In 4Glu; phosphomimetic mutant, does not affect G1/S-phase transition; when associated with E-14, E-18 and E-160.", "evidence": [ { "database": "UniProtKB", "id": "O94811", "url": "https://www.uniprot.org/uniprotkb/O94811" }, { "database": "PubMed", "id": "23355470", "url": "https://pubmed.ncbi.nlm.nih.gov/23355470" } ], "uniprot_canonical_ac": "O94811-1" } ], "phosphorylation": [ { "start_pos": 14, "end_pos": 14, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine; by CDK1 and CDK5", "evidence": [ { "database": "UniProtKB", "id": "O94811", "url": "https://www.uniprot.org/uniprotkb/O94811" }, { "database": "iPTMnet", "id": "O94811", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O94811" }, { "database": "PubMed", "id": "18669648", "url": "https://pubmed.ncbi.nlm.nih.gov/18669648" }, { "database": "PubMed", "id": "17693641", "url": "https://pubmed.ncbi.nlm.nih.gov/17693641" }, { "database": "PubMed", "id": "23355470", "url": "https://pubmed.ncbi.nlm.nih.gov/23355470" }, { "database": "PubMed", "id": "24275569", "url": "https://pubmed.ncbi.nlm.nih.gov/24275569" } ], "site_lbl": "Thr14", "uniprot_canonical_ac": "O94811-1" }, { "start_pos": 160, "end_pos": 160, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by CDK1, CDK5 and MAPK1", "evidence": [ { "database": "UniProtKB", "id": "O94811", "url": "https://www.uniprot.org/uniprotkb/O94811" }, { "database": "iPTMnet", "id": "O94811", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O94811" }, { "database": "PubMed", "id": "18669648", "url": "https://pubmed.ncbi.nlm.nih.gov/18669648" }, { "database": "PubMed", "id": "19413330", "url": "https://pubmed.ncbi.nlm.nih.gov/19413330" }, { "database": "PubMed", "id": "17693641", "url": "https://pubmed.ncbi.nlm.nih.gov/17693641" }, { "database": "PubMed", "id": "23355470", "url": "https://pubmed.ncbi.nlm.nih.gov/23355470" } ], "site_lbl": "Ser160", "uniprot_canonical_ac": "O94811-1" }, { "start_pos": 18, "end_pos": 18, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by CDK1, CDK5 and MAPK1", "evidence": [ { "database": "UniProtKB", "id": "O94811", "url": "https://www.uniprot.org/uniprotkb/O94811" }, { "database": "iPTMnet", "id": "O94811", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O94811" }, { "database": "PubMed", "id": "18669648", "url": "https://pubmed.ncbi.nlm.nih.gov/18669648" }, { "database": "PubMed", "id": "17693641", "url": "https://pubmed.ncbi.nlm.nih.gov/17693641" }, { "database": "PubMed", "id": "23355470", "url": "https://pubmed.ncbi.nlm.nih.gov/23355470" } ], "site_lbl": "Ser18", "uniprot_canonical_ac": "O94811-1" }, { "start_pos": 45, "end_pos": 45, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by CDK1", "evidence": [ { "database": "UniProtKB", "id": "O94811", "url": "https://www.uniprot.org/uniprotkb/O94811" }, { "database": "iPTMnet", "id": "O94811", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O94811" }, { "database": "PubMed", "id": "18669648", "url": "https://pubmed.ncbi.nlm.nih.gov/18669648" }, { "database": "PubMed", "id": "20068231", "url": "https://pubmed.ncbi.nlm.nih.gov/20068231" }, { "database": "PubMed", "id": "23355470", "url": "https://pubmed.ncbi.nlm.nih.gov/23355470" } ], "site_lbl": "Ser45", "uniprot_canonical_ac": "O94811-1" } ], "record_id": "pubmed.23355470", "abstract": "", "glycosylation": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 4 }, { "field": "total_sites", "count": 4 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Ser1333 phosphorylation indicates ROCKI activation.", "journal": "Journal of biomedical science", "date": "2013", "authors": "Chuang HH, Liang SW, Chang ZF, Lee HH", "reference": { "type": "PubMed", "id": "24168723", "url": "https://pubmed.ncbi.nlm.nih.gov/24168723" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q13464-1", "protein_name": "Rho-associated protein kinase 1", "gene_name": "ROCK1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q13464", "url": "https://www.uniprot.org/uniprotkb/Q13464" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 1333, "end_pos": 1333, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q13464", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q13464" }, { "database": "PubMed", "id": "24168723", "url": "https://pubmed.ncbi.nlm.nih.gov/24168723" } ], "site_lbl": "Ser1333", "uniprot_canonical_ac": "Q13464-1" } ], "record_id": "pubmed.24168723", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "A novel FOXM1 isoform, FOXM1D, promotes epithelial-mesenchymal transition and metastasis through ROCKs activation in colorectal cancer.", "journal": "Oncogene", "date": "2017", "authors": "Zhang X, Zhang L, Du Y, Zheng H, Zhang P, Sun Y, Wang Y, Chen J, Ding P, Wang N, Yang C, Huang T, Yao X, Qiao Q, Gu H, Cai G, Cai S, Zhou X, Hu W", "reference": { "type": "PubMed", "id": "27399334", "url": "https://pubmed.ncbi.nlm.nih.gov/27399334" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q13464-1", "protein_name": "Rho-associated protein kinase 1", "gene_name": "ROCK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75116-1", "protein_name": "Rho-associated protein kinase 2", "gene_name": "ROCK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q08050-1", "protein_name": "Forkhead box protein M1", "gene_name": "FOXM1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q13464", "url": "https://www.uniprot.org/uniprotkb/Q13464" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.27399334", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "ROCK1/2 signaling contributes to corticosteroid-refractory acute graft-versus-host disease.", "journal": "Nature communications", "date": "2024-01-10", "authors": "Maas-Bauer Kristina, Stell Anna-Verena, Yan Kai-Li, de Vega Enrique, Vinnakota Janaki Manoja, Unger Susanne, N\u00fa\u00f1ez Nicolas, Norona Johana, Talvard-Balland Nana, Ko\u00dfmann Stefanie, Schwan Carsten, Miething Cornelius, Martens Uta S, Shoumariyeh Khalid, Nestor Rosa P, Duquesne Sandra, Hanke Kathrin, Rackiewicz Michal, Hu Zehan, El Khawanky Nadia, Taromi Sanaz, Andrlova Hana, Faraidun Hemin, Walter Stefanie, Pfeifer Dietmar, Follo Marie, Waldschmidt Johannes, Melchinger Wolfgang, Rassner Michael, Wehr Claudia, Schmitt-Graeff Annette, Halbach Sebastian, Liao James, H\u00e4cker Georg, Brummer Tilman, Dengjel Joern, Andrieux Geoffroy, Grosse Robert, Tugues Sonia, Blazar Bruce R, Becher Burkhard, Boerries Melanie, Zeiser Robert", "reference": { "type": "PubMed", "id": "38199985", "url": "https://pubmed.ncbi.nlm.nih.gov/38199985" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q13464-1", "protein_name": "Rho-associated protein kinase 1", "gene_name": "ROCK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75116-1", "protein_name": "Rho-associated protein kinase 2", "gene_name": "ROCK2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q13464", "url": "https://www.uniprot.org/uniprotkb/Q13464" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.38199985", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Paxillin participates in the sphingosylphosphorylcholine-induced abnormal contraction of vascular smooth muscle by regulating Rho-kinase activation.", "journal": "Cell communication and signaling : CCS", "date": "2024-01-22", "authors": "Zhang Ying, Li Nan, Kobayashi Sei", "reference": { "type": "PubMed", "id": "38254202", "url": "https://pubmed.ncbi.nlm.nih.gov/38254202" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q13464-1", "protein_name": "Rho-associated protein kinase 1", "gene_name": "ROCK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8VI36-1", "protein_name": "Paxillin", "gene_name": "Pxn", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "P49023-1", "protein_name": "Paxillin", "gene_name": "PXN", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q13464", "url": "https://www.uniprot.org/uniprotkb/Q13464" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.38254202", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "LINC00645 inhibits renal cell carcinoma progression by interacting with HNRNPA2B1 to regulate the ROCK1 mRNA stability.", "journal": "Gene", "date": "2024-02-01", "authors": "Li Hao, Han Xu, Song Liang, Li Xiang, Zhang Liwei, Jin Zhibo, Zhang Yu, Wang Tao, Huang Zhenlin, Jia Zhankui, Yang Jinjian", "reference": { "type": "PubMed", "id": "38309317", "url": "https://pubmed.ncbi.nlm.nih.gov/38309317" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q13464-1", "protein_name": "Rho-associated protein kinase 1", "gene_name": "ROCK1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q13464", "url": "https://www.uniprot.org/uniprotkb/Q13464" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.38309317", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "TRIM40 interacts with ROCK1 directly and inhibits colorectal cancer cell proliferation through the c-Myc/p21 axis.", "journal": "Biochimica et biophysica acta. Molecular cell research", "date": "2024-12", "authors": "Hu Fangyu, Zhao Lingling, Wang Junyu, Li Xiaoying, Xue Zixuan, Ma Yimeng, Zheng Minghui, Chen Chenglin, Tong Meiting, Guo Xiaohuan, Li Hongyan, Jin Honglei, Xie Qipeng, Zhang Xiaodong, Huang Chuanshu, Huang Haishan", "reference": { "type": "PubMed", "id": "39357549", "url": "https://pubmed.ncbi.nlm.nih.gov/39357549" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q13464-1", "protein_name": "Rho-associated protein kinase 1", "gene_name": "ROCK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01106-2", "protein_name": "Myc proto-oncogene protein", "gene_name": "MYC", "tax_name": "Human" }, { "uniprot_canonical_ac": "P38936-1", "protein_name": "Cyclin-dependent kinase inhibitor 1", "gene_name": "CDKN1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6P9F5-1", "protein_name": "E3 ubiquitin ligase TRIM40", "gene_name": "TRIM40", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q13464", "url": "https://www.uniprot.org/uniprotkb/Q13464" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.39357549", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 4 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Different molecular mechanisms for Rho family GTPase-dependent, Ca2+-independent contraction of smooth muscle.", "journal": "The Journal of biological chemistry", "date": "1998-09-04", "authors": "Van Eyk J E, Arrell D K, Foster D B, Strauss J D, Heinonen T Y, Furmaniak-Kazmierczak E, C\u00f4t\u00e9 G P, Mak A S", "reference": { "type": "PubMed", "id": "9722579", "url": "https://pubmed.ncbi.nlm.nih.gov/9722579" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q13464-1", "protein_name": "Rho-associated protein kinase 1", "gene_name": "ROCK1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q13464", "url": "https://www.uniprot.org/uniprotkb/Q13464" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.9722579", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Cloning, tissue distribution, genomic organization, and functional characterization of NBC3, a new member of the sodium bicarbonate cotransporter family.", "journal": "The Journal of biological chemistry", "date": "1999", "authors": "Pushkin A, Abuladze N, Lee I, Newman D, Hwang J, Kurtz I", "reference": { "type": "PubMed", "id": "10347222", "url": "https://pubmed.ncbi.nlm.nih.gov/10347222" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9Y6M7-1", "protein_name": "Sodium bicarbonate cotransporter 3", "gene_name": "SLC4A7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BY07-1", "protein_name": "Electrogenic sodium bicarbonate cotransporter 4", "gene_name": "SLC4A5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96HN2-1", "protein_name": "S-adenosylhomocysteine hydrolase-like protein 2", "gene_name": "AHCYL2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P02730-1", "protein_name": "Band 3 anion transport protein", "gene_name": "SLC4A1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y6R1-1", "protein_name": "Electrogenic sodium bicarbonate cotransporter 1", "gene_name": "SLC4A4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96Q91-1", "protein_name": "Anion exchange protein 4", "gene_name": "SLC4A9", "tax_name": "Human" }, { "uniprot_canonical_ac": "P48751-1", "protein_name": "Anion exchange protein 3", "gene_name": "SLC4A3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04920-1", "protein_name": "Anion exchange protein 2", "gene_name": "SLC4A2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6U841-1", "protein_name": "Sodium-driven chloride bicarbonate exchanger", "gene_name": "SLC4A10", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q2Y0W8-1", "protein_name": "Electroneutral sodium bicarbonate exchanger 1", "gene_name": "SLC4A8", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9Y6M7", "url": "https://www.uniprot.org/uniprotkb/Q9Y6M7" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.10347222", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 10 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Characterization of Na+/HCO-3 cotransporter isoform NBC-3.", "journal": "The American journal of physiology", "date": "1999", "authors": "Amlal H, Burnham CE, Soleimani M", "reference": { "type": "PubMed", "id": "10362779", "url": "https://pubmed.ncbi.nlm.nih.gov/10362779" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9Y6M7-1", "protein_name": "Sodium bicarbonate cotransporter 3", "gene_name": "SLC4A7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BY07-1", "protein_name": "Electrogenic sodium bicarbonate cotransporter 4", "gene_name": "SLC4A5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96HN2-1", "protein_name": "S-adenosylhomocysteine hydrolase-like protein 2", "gene_name": "AHCYL2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P02730-1", "protein_name": "Band 3 anion transport protein", "gene_name": "SLC4A1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y6R1-1", "protein_name": "Electrogenic sodium bicarbonate cotransporter 1", "gene_name": "SLC4A4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96Q91-1", "protein_name": "Anion exchange protein 4", "gene_name": "SLC4A9", "tax_name": "Human" }, { "uniprot_canonical_ac": "P48751-1", "protein_name": "Anion exchange protein 3", "gene_name": "SLC4A3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04920-1", "protein_name": "Anion exchange protein 2", "gene_name": "SLC4A2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6U841-1", "protein_name": "Sodium-driven chloride bicarbonate exchanger", "gene_name": "SLC4A10", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q2Y0W8-1", "protein_name": "Electroneutral sodium bicarbonate exchanger 1", "gene_name": "SLC4A8", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9Y6M7", "url": "https://www.uniprot.org/uniprotkb/Q9Y6M7" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.10362779", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 10 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Mutations in SLC4A4 cause permanent isolated proximal renal tubular acidosis with ocular abnormalities.", "journal": "Nature genetics", "date": "1999", "authors": "Igarashi T, Inatomi J, Sekine T, Cha SH, Kanai Y, Kunimi M, Tsukamoto K, Satoh H, Shimadzu M, Tozawa F, Mori T, Shiobara M, Seki G, Endou H", "reference": { "type": "PubMed", "id": "10545938", "url": "https://pubmed.ncbi.nlm.nih.gov/10545938" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9Y6M7-1", "protein_name": "Sodium bicarbonate cotransporter 3", "gene_name": "SLC4A7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BY07-1", "protein_name": "Electrogenic sodium bicarbonate cotransporter 4", "gene_name": "SLC4A5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96HN2-1", "protein_name": "S-adenosylhomocysteine hydrolase-like protein 2", "gene_name": "AHCYL2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P02730-1", "protein_name": "Band 3 anion transport protein", "gene_name": "SLC4A1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y6R1-1", "protein_name": "Electrogenic sodium bicarbonate cotransporter 1", "gene_name": "SLC4A4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96Q91-1", "protein_name": "Anion exchange protein 4", "gene_name": "SLC4A9", "tax_name": "Human" }, { "uniprot_canonical_ac": "P48751-1", "protein_name": "Anion exchange protein 3", "gene_name": "SLC4A3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04920-1", "protein_name": "Anion exchange protein 2", "gene_name": "SLC4A2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6U841-1", "protein_name": "Sodium-driven chloride bicarbonate exchanger", "gene_name": "SLC4A10", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q2Y0W8-1", "protein_name": "Electroneutral sodium bicarbonate exchanger 1", "gene_name": "SLC4A8", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9Y6M7", "url": "https://www.uniprot.org/uniprotkb/Q9Y6M7" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.10545938", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 10 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Cloning, characterization and chromosomal assignment of NBC4, a new member of the sodium bicarbonate cotransporter family.", "journal": "Biochimica et biophysica acta", "date": "2000", "authors": "Pushkin A, Abuladze N, Newman D, Lee I, Xu G, Kurtz I", "reference": { "type": "PubMed", "id": "10978526", "url": "https://pubmed.ncbi.nlm.nih.gov/10978526" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9Y6M7-1", "protein_name": "Sodium bicarbonate cotransporter 3", "gene_name": "SLC4A7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BY07-1", "protein_name": "Electrogenic sodium bicarbonate cotransporter 4", "gene_name": "SLC4A5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96HN2-1", "protein_name": "S-adenosylhomocysteine hydrolase-like protein 2", "gene_name": "AHCYL2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P02730-1", "protein_name": "Band 3 anion transport protein", "gene_name": "SLC4A1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y6R1-1", "protein_name": "Electrogenic sodium bicarbonate cotransporter 1", "gene_name": "SLC4A4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96Q91-1", "protein_name": "Anion exchange protein 4", "gene_name": "SLC4A9", "tax_name": "Human" }, { "uniprot_canonical_ac": "P48751-1", "protein_name": "Anion exchange protein 3", "gene_name": "SLC4A3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04920-1", "protein_name": "Anion exchange protein 2", "gene_name": "SLC4A2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6U841-1", "protein_name": "Sodium-driven chloride bicarbonate exchanger", "gene_name": "SLC4A10", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q2Y0W8-1", "protein_name": "Electroneutral sodium bicarbonate exchanger 1", "gene_name": "SLC4A8", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9Y6M7", "url": "https://www.uniprot.org/uniprotkb/Q9Y6M7" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.10978526", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 10 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "A novel sodium bicarbonate cotransporter-like gene in an ancient duplicated region: SLC4A9 at 5q31.", "journal": "Genome biology", "date": "2001", "authors": "Lipovich L, Lynch ED, Lee MK, King MC", "reference": { "type": "PubMed", "id": "11305939", "url": "https://pubmed.ncbi.nlm.nih.gov/11305939" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9Y6M7-1", "protein_name": "Sodium bicarbonate cotransporter 3", "gene_name": "SLC4A7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BY07-1", "protein_name": "Electrogenic sodium bicarbonate cotransporter 4", "gene_name": "SLC4A5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96HN2-1", "protein_name": "S-adenosylhomocysteine hydrolase-like protein 2", "gene_name": "AHCYL2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P02730-1", "protein_name": "Band 3 anion transport protein", "gene_name": "SLC4A1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y6R1-1", "protein_name": "Electrogenic sodium bicarbonate cotransporter 1", "gene_name": "SLC4A4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96Q91-1", "protein_name": "Anion exchange protein 4", "gene_name": "SLC4A9", "tax_name": "Human" }, { "uniprot_canonical_ac": "P48751-1", "protein_name": "Anion exchange protein 3", "gene_name": "SLC4A3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04920-1", "protein_name": "Anion exchange protein 2", "gene_name": "SLC4A2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6U841-1", "protein_name": "Sodium-driven chloride bicarbonate exchanger", "gene_name": "SLC4A10", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q2Y0W8-1", "protein_name": "Electroneutral sodium bicarbonate exchanger 1", "gene_name": "SLC4A8", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9Y6M7", "url": "https://www.uniprot.org/uniprotkb/Q9Y6M7" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.11305939", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 10 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Functional characterization of NBC4: a new electrogenic sodium-bicarbonate cotransporter.", "journal": "American journal of physiology. Cell physiology", "date": "2002", "authors": "Sassani P, Pushkin A, Gross E, Gomer A, Abuladze N, Dukkipati R, Carpenito G, Kurtz I", "reference": { "type": "PubMed", "id": "11788353", "url": "https://pubmed.ncbi.nlm.nih.gov/11788353" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9Y6M7-1", "protein_name": "Sodium bicarbonate cotransporter 3", "gene_name": "SLC4A7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BY07-1", "protein_name": "Electrogenic sodium bicarbonate cotransporter 4", "gene_name": "SLC4A5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96HN2-1", "protein_name": "S-adenosylhomocysteine hydrolase-like protein 2", "gene_name": "AHCYL2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P02730-1", "protein_name": "Band 3 anion transport protein", "gene_name": "SLC4A1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y6R1-1", "protein_name": "Electrogenic sodium bicarbonate cotransporter 1", "gene_name": "SLC4A4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96Q91-1", "protein_name": "Anion exchange protein 4", "gene_name": "SLC4A9", "tax_name": "Human" }, { "uniprot_canonical_ac": "P48751-1", "protein_name": "Anion exchange protein 3", "gene_name": "SLC4A3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04920-1", "protein_name": "Anion exchange protein 2", "gene_name": "SLC4A2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6U841-1", "protein_name": "Sodium-driven chloride bicarbonate exchanger", "gene_name": "SLC4A10", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q2Y0W8-1", "protein_name": "Electroneutral sodium bicarbonate exchanger 1", "gene_name": "SLC4A8", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9Y6M7", "url": "https://www.uniprot.org/uniprotkb/Q9Y6M7" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.11788353", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 10 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The COOH termini of NBC3 and the 56-kDa H+-ATPase subunit are PDZ motifs involved in their interaction.", "journal": "American journal of physiology. Cell physiology", "date": "2003", "authors": "Pushkin A, Abuladze N, Newman D, Muronets V, Sassani P, Tatishchev S, Kurtz I", "reference": { "type": "PubMed", "id": "12444018", "url": "https://pubmed.ncbi.nlm.nih.gov/12444018" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9Y6M7-1", "protein_name": "Sodium bicarbonate cotransporter 3", "gene_name": "SLC4A7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9JJ19-1", "protein_name": "Na(+)/H(+) exchange regulatory cofactor NHE-RF1", "gene_name": "Nherf1", "tax_name": "Rat" }, { "uniprot_canonical_ac": "P15313-1", "protein_name": "V-type proton ATPase subunit B, kidney isoform", "gene_name": "ATP6V1B1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14745-1", "protein_name": "Na(+)/H(+) exchange regulatory cofactor NHE-RF1", "gene_name": "NHERF1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9Y6M7", "url": "https://www.uniprot.org/uniprotkb/Q9Y6M7" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 1214, "end_pos": 1214, "sequence_org": "L", "sequence_mut": "G", "comment": "Loss of interaction with ATP6V1B1.", "evidence": [ { "database": "UniProtKB", "id": "Q9Y6M7", "url": "https://www.uniprot.org/uniprotkb/Q9Y6M7" }, { "database": "PubMed", "id": "12444018", "url": "https://pubmed.ncbi.nlm.nih.gov/12444018" } ], "uniprot_canonical_ac": "Q9Y6M7-1" }, { "start_pos": 513, "end_pos": 513, "sequence_org": "L", "sequence_mut": "G", "comment": "Loss of interactions with NHERF1 and SCL4A7.", "evidence": [ { "database": "UniProtKB", "id": "P15313", "url": "https://www.uniprot.org/uniprotkb/P15313" }, { "database": "PubMed", "id": "12444018", "url": "https://pubmed.ncbi.nlm.nih.gov/12444018" } ], "uniprot_canonical_ac": "P15313-1" } ], "record_id": "pubmed.12444018", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 4 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Structural and functional characterization of the human NBC3 sodium/bicarbonate co-transporter carboxyl-terminal cytoplasmic domain.", "journal": "Molecular membrane biology", "date": "2003", "authors": "Loiselle FB, Jaschke P, Casey JR", "reference": { "type": "PubMed", "id": "14578046", "url": "https://pubmed.ncbi.nlm.nih.gov/14578046" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9Y6M7-1", "protein_name": "Sodium bicarbonate cotransporter 3", "gene_name": "SLC4A7", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9Y6M7", "url": "https://www.uniprot.org/uniprotkb/Q9Y6M7" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 1127, "end_pos": 1214, "sequence_org": "TKRELSWLDDLMPESKKKKEDDKKKKEKEEAERMLQDDDDTVHLPFEGGSLLQIPVKALKYSPDKPVSVKISFEDEPRKKYVDAETSL", "sequence_mut": "", "comment": "Loss of cell membrane localization. Significant reduction in transport activity.", "evidence": [ { "database": "UniProtKB", "id": "Q9Y6M7", "url": "https://www.uniprot.org/uniprotkb/Q9Y6M7" }, { "database": "PubMed", "id": "14578046", "url": "https://pubmed.ncbi.nlm.nih.gov/14578046" } ], "uniprot_canonical_ac": "Q9Y6M7-1" } ], "record_id": "pubmed.14578046", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Regulation of the human NBC3 Na+/HCO3- cotransporter by carbonic anhydrase II and PKA.", "journal": "American journal of physiology. Cell physiology", "date": "2004", "authors": "Loiselle FB, Morgan PE, Alvarez BV, Casey JR", "reference": { "type": "PubMed", "id": "14736710", "url": "https://pubmed.ncbi.nlm.nih.gov/14736710" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9Y6M7-1", "protein_name": "Sodium bicarbonate cotransporter 3", "gene_name": "SLC4A7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P00918-1", "protein_name": "Carbonic anhydrase 2", "gene_name": "CA2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9Y6M7", "url": "https://www.uniprot.org/uniprotkb/Q9Y6M7" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 1135, "end_pos": 1136, "sequence_org": "DD", "sequence_mut": "NN", "comment": "Loss of interaction with CA2. Loss of regulation by CA2.", "evidence": [ { "database": "UniProtKB", "id": "Q9Y6M7", "url": "https://www.uniprot.org/uniprotkb/Q9Y6M7" }, { "database": "PubMed", "id": "14736710", "url": "https://pubmed.ncbi.nlm.nih.gov/14736710" } ], "uniprot_canonical_ac": "Q9Y6M7-1" }, { "start_pos": 1163, "end_pos": 1165, "sequence_org": "DDD", "sequence_mut": "NNN", "comment": "No effect on interaction with CA2. No effect on regulation by CA2.", "evidence": [ { "database": "UniProtKB", "id": "Q9Y6M7", "url": "https://www.uniprot.org/uniprotkb/Q9Y6M7" }, { "database": "PubMed", "id": "14736710", "url": "https://pubmed.ncbi.nlm.nih.gov/14736710" } ], "uniprot_canonical_ac": "Q9Y6M7-1" } ], "record_id": "pubmed.14736710", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Scaffold protein harmonin (USH1C) provides molecular links between Usher syndrome type 1 and type 2.", "journal": "Hum. Mol. Genet.", "date": "2005", "authors": "Reiners Jan, van Wijk Erwin, M\u00e4rker Tina, Zimmermann Ulrike, J\u00fcrgens Karin, te Brinke Heleen, Overlack Nora, Roepman Ronald, Knipper Marlies, Kremer Hannie, Wolfrum Uwe", "reference": { "type": "PubMed", "id": "16301216", "url": "https://pubmed.ncbi.nlm.nih.gov/16301216" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9Y6M7-1", "protein_name": "Sodium bicarbonate cotransporter 3", "gene_name": "SLC4A7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8BTY2-1", "protein_name": "Sodium bicarbonate cotransporter 3", "gene_name": "Slc4a7", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "Q2QI47-1", "protein_name": "Usherin", "gene_name": "Ush2A; Ush2a", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "Q8K3K1-2", "protein_name": "Usherin", "gene_name": "Ush2a", "tax_name": "Rat" }, { "uniprot_canonical_ac": "Q9R1N3-1", "protein_name": "Sodium bicarbonate cotransporter 3", "gene_name": "Slc4a7", "tax_name": "Rat" }, { "uniprot_canonical_ac": "Q9Y6N9-1", "protein_name": "Harmonin", "gene_name": "USH1C", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75445-1", "protein_name": "Usherin", "gene_name": "USH2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9ES64-1", "protein_name": "Harmonin", "gene_name": "Ush1c", "tax_name": "Mouse" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9Y6M7", "url": "https://www.uniprot.org/uniprotkb/Q9Y6M7" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.16301216", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 8 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Characterization of human SLC4A10 as an electroneutral Na/HCO3 cotransporter (NBCn2) with Cl- self-exchange activity.", "journal": "The Journal of biological chemistry", "date": "2008", "authors": "Parker MD, Musa-Aziz R, Rojas JD, Choi I, Daly CM, Boron WF", "reference": { "type": "PubMed", "id": "18319254", "url": "https://pubmed.ncbi.nlm.nih.gov/18319254" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9Y6M7-1", "protein_name": "Sodium bicarbonate cotransporter 3", "gene_name": "SLC4A7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BY07-1", "protein_name": "Electrogenic sodium bicarbonate cotransporter 4", "gene_name": "SLC4A5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96HN2-1", "protein_name": "S-adenosylhomocysteine hydrolase-like protein 2", "gene_name": "AHCYL2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P02730-1", "protein_name": "Band 3 anion transport protein", "gene_name": "SLC4A1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y6R1-1", "protein_name": "Electrogenic sodium bicarbonate cotransporter 1", "gene_name": "SLC4A4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96Q91-1", "protein_name": "Anion exchange protein 4", "gene_name": "SLC4A9", "tax_name": "Human" }, { "uniprot_canonical_ac": "P48751-1", "protein_name": "Anion exchange protein 3", "gene_name": "SLC4A3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04920-1", "protein_name": "Anion exchange protein 2", "gene_name": "SLC4A2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6U841-1", "protein_name": "Sodium-driven chloride bicarbonate exchanger", "gene_name": "SLC4A10", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q2Y0W8-1", "protein_name": "Electroneutral sodium bicarbonate exchanger 1", "gene_name": "SLC4A8", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9Y6M7", "url": "https://www.uniprot.org/uniprotkb/Q9Y6M7" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.18319254", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 10 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Modular structure of sodium-coupled bicarbonate transporters.", "journal": "J. Exp. Biol.", "date": "2009", "authors": "Boron Walter F, Chen Liming, Parker Mark D", "reference": { "type": "PubMed", "id": "19448079", "url": "https://pubmed.ncbi.nlm.nih.gov/19448079" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9Y6M7-1", "protein_name": "Sodium bicarbonate cotransporter 3", "gene_name": "SLC4A7", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9Y6M7", "url": "https://www.uniprot.org/uniprotkb/Q9Y6M7" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.19448079", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Cloning and characterization of band 3, the human erythrocyte anion-exchange protein (AE1).", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1989", "authors": "Lux SE, John KM, Kopito RR, Lodish HF", "reference": { "type": "PubMed", "id": "2594752", "url": "https://pubmed.ncbi.nlm.nih.gov/2594752" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9Y6M7-1", "protein_name": "Sodium bicarbonate cotransporter 3", "gene_name": "SLC4A7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BY07-1", "protein_name": "Electrogenic sodium bicarbonate cotransporter 4", "gene_name": "SLC4A5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96HN2-1", "protein_name": "S-adenosylhomocysteine hydrolase-like protein 2", "gene_name": "AHCYL2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P02730-1", "protein_name": "Band 3 anion transport protein", "gene_name": "SLC4A1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y6R1-1", "protein_name": "Electrogenic sodium bicarbonate cotransporter 1", "gene_name": "SLC4A4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96Q91-1", "protein_name": "Anion exchange protein 4", "gene_name": "SLC4A9", "tax_name": "Human" }, { "uniprot_canonical_ac": "P48751-1", "protein_name": "Anion exchange protein 3", "gene_name": "SLC4A3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04920-1", "protein_name": "Anion exchange protein 2", "gene_name": "SLC4A2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6U841-1", "protein_name": "Sodium-driven chloride bicarbonate exchanger", "gene_name": "SLC4A10", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q2Y0W8-1", "protein_name": "Electroneutral sodium bicarbonate exchanger 1", "gene_name": "SLC4A8", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9Y6M7", "url": "https://www.uniprot.org/uniprotkb/Q9Y6M7" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.2594752", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 10 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The Bicarbonate Transporter SLC4A7 Plays a Key Role in Macrophage Phagosome Acidification.", "journal": "Cell host & microbe", "date": "2018", "authors": "Sedlyarov V, Eichner R, Girardi E, Essletzbichler P, Goldmann U, Nunes-Hasler P, Srndic I, Moskovskich A, Heinz LX, Kartnig F, Bigenzahn JW, Rebsamen M, Kovarik P, Demaurex N, Superti-Furga G", "reference": { "type": "PubMed", "id": "29779931", "url": "https://pubmed.ncbi.nlm.nih.gov/29779931" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9Y6M7-1", "protein_name": "Sodium bicarbonate cotransporter 3", "gene_name": "SLC4A7", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9Y6M7", "url": "https://www.uniprot.org/uniprotkb/Q9Y6M7" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 1008, "end_pos": 1131, "sequence_org": "QRVTGLMIFILMGLSVFMTSVLKFIPMPVLYGVFLYMGVSSLKGIQLFDRIKLFGMPAKHQPDLIYLRYVPLWKVHIFTVIQLTCLVLLWVIKVSAAAVVFPMMVLALVFVRKLMDLCFTKREL", "sequence_mut": "", "comment": "Loss of cell membrane localization. Unable to rescue phagocyte deficient acidification phenotype of SLC4A7 knockout.", "evidence": [ { "database": "UniProtKB", "id": "Q9Y6M7", "url": "https://www.uniprot.org/uniprotkb/Q9Y6M7" }, { "database": "PubMed", "id": "29779931", "url": "https://pubmed.ncbi.nlm.nih.gov/29779931" } ], "uniprot_canonical_ac": "Q9Y6M7-1" }, { "start_pos": 549, "end_pos": 549, "sequence_org": "I", "sequence_mut": "I", "comment": "No effect on cell membrane localization. Unable to rescue phagocyte deficient acidification phenotype of SLC4A7 knockout.", "evidence": [ { "database": "UniProtKB", "id": "Q9Y6M7", "url": "https://www.uniprot.org/uniprotkb/Q9Y6M7" }, { "database": "PubMed", "id": "29779931", "url": "https://pubmed.ncbi.nlm.nih.gov/29779931" } ], "uniprot_canonical_ac": "Q9Y6M7-1" }, { "start_pos": 811, "end_pos": 811, "sequence_org": "G", "sequence_mut": "A", "comment": "No effect on cell membrane localization. Unable to rescue phagocyte deficient acidification phenotype of SLC4A7 knockout.", "evidence": [ { "database": "UniProtKB", "id": "Q9Y6M7", "url": "https://www.uniprot.org/uniprotkb/Q9Y6M7" }, { "database": "PubMed", "id": "29779931", "url": "https://pubmed.ncbi.nlm.nih.gov/29779931" } ], "uniprot_canonical_ac": "Q9Y6M7-1" } ], "record_id": "pubmed.29779931", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The mTORC1-SLC4A7 axis stimulates bicarbonate import to enhance de novo nucleotide synthesis.", "journal": "Molecular cell", "date": "2022", "authors": "Ali ES, Liponska A, O'Hara BP, Amici DR, Torno MD, Gao P, Asara JM, Yap MF, Mendillo ML, Ben-Sahra I", "reference": { "type": "PubMed", "id": "35772404", "url": "https://pubmed.ncbi.nlm.nih.gov/35772404" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9Y6M7-1", "protein_name": "Sodium bicarbonate cotransporter 3", "gene_name": "SLC4A7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15418-1", "protein_name": "Ribosomal protein S6 kinase alpha-1", "gene_name": "RPS6KA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P23588-1", "protein_name": "Eukaryotic translation initiation factor 4B", "gene_name": "EIF4B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49815-1", "protein_name": "Tuberin", "gene_name": "TSC2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9Y6M7", "url": "https://www.uniprot.org/uniprotkb/Q9Y6M7" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 406, "end_pos": 406, "sequence_org": "S", "sequence_mut": "A", "comment": "Non-phosphorylatable mutant whose expression results in reduced SLC4A7 protein levels in TSC2-deficient cells accompanied by decrease in the bicarbonate-dependent flux into nucleotide synthesis.", "evidence": [ { "database": "UniProtKB", "id": "P23588", "url": "https://www.uniprot.org/uniprotkb/P23588" }, { "database": "PubMed", "id": "35772404", "url": "https://pubmed.ncbi.nlm.nih.gov/35772404" } ], "uniprot_canonical_ac": "P23588-1" }, { "start_pos": 422, "end_pos": 422, "sequence_org": "S", "sequence_mut": "A", "comment": "Non-phosphorylatable mutant whose expression results in reduced SLC4A7 protein levels in TSC2-deficient cells accompanied by decrease in the bicarbonate-dependent flux into nucleotide synthesis.", "evidence": [ { "database": "UniProtKB", "id": "P23588", "url": "https://www.uniprot.org/uniprotkb/P23588" }, { "database": "PubMed", "id": "35772404", "url": "https://pubmed.ncbi.nlm.nih.gov/35772404" } ], "uniprot_canonical_ac": "P23588-1" } ], "phosphorylation": [ { "start_pos": 406, "end_pos": 406, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by RPS6KA1", "evidence": [ { "database": "UniProtKB", "id": "P23588", "url": "https://www.uniprot.org/uniprotkb/P23588" }, { "database": "iPTMnet", "id": "P23588", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P23588" }, { "database": "PubMed", "id": "17081983", "url": "https://pubmed.ncbi.nlm.nih.gov/17081983" }, { "database": "PubMed", "id": "18767875", "url": "https://pubmed.ncbi.nlm.nih.gov/18767875" }, { "database": "PubMed", "id": "19651622", "url": "https://pubmed.ncbi.nlm.nih.gov/19651622" }, { "database": "PubMed", "id": "20068231", "url": "https://pubmed.ncbi.nlm.nih.gov/20068231" }, { "database": "PubMed", "id": "18836482", "url": "https://pubmed.ncbi.nlm.nih.gov/18836482" }, { "database": "PubMed", "id": "24777602", "url": "https://pubmed.ncbi.nlm.nih.gov/24777602" }, { "database": "PubMed", "id": "25332164", "url": "https://pubmed.ncbi.nlm.nih.gov/25332164" }, { "database": "PubMed", "id": "30583073", "url": "https://pubmed.ncbi.nlm.nih.gov/30583073" }, { "database": "PubMed", "id": "33658483", "url": "https://pubmed.ncbi.nlm.nih.gov/33658483" }, { "database": "PubMed", "id": "21406692", "url": "https://pubmed.ncbi.nlm.nih.gov/21406692" }, { "database": "PubMed", "id": "23186163", "url": "https://pubmed.ncbi.nlm.nih.gov/23186163" }, { "database": "PubMed", "id": "35772404", "url": "https://pubmed.ncbi.nlm.nih.gov/35772404" } ], "site_lbl": "Ser406", "uniprot_canonical_ac": "P23588-1" }, { "start_pos": 422, "end_pos": 422, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by RPS6KA1 and RPS6KB1", "evidence": [ { "database": "UniProtKB", "id": "P23588", "url": "https://www.uniprot.org/uniprotkb/P23588" }, { "database": "iPTMnet", "id": "P23588", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P23588" }, { "database": "PubMed", "id": "16763566", "url": "https://pubmed.ncbi.nlm.nih.gov/16763566" }, { "database": "PubMed", "id": "18836482", "url": "https://pubmed.ncbi.nlm.nih.gov/18836482" }, { "database": "PubMed", "id": "22750809", "url": "https://pubmed.ncbi.nlm.nih.gov/22750809" }, { "database": "PubMed", "id": "27028868", "url": "https://pubmed.ncbi.nlm.nih.gov/27028868" }, { "database": "PubMed", "id": "30285764", "url": "https://pubmed.ncbi.nlm.nih.gov/30285764" }, { "database": "PubMed", "id": "31106142", "url": "https://pubmed.ncbi.nlm.nih.gov/31106142" }, { "database": "PubMed", "id": "33658483", "url": "https://pubmed.ncbi.nlm.nih.gov/33658483" }, { "database": "PubMed", "id": "20068231", "url": "https://pubmed.ncbi.nlm.nih.gov/20068231" }, { "database": "PubMed", "id": "23186163", "url": "https://pubmed.ncbi.nlm.nih.gov/23186163" }, { "database": "PubMed", "id": "24275569", "url": "https://pubmed.ncbi.nlm.nih.gov/24275569" }, { "database": "PubMed", "id": "35772404", "url": "https://pubmed.ncbi.nlm.nih.gov/35772404" }, { "database": "PubMed", "id": "15071500", "url": "https://pubmed.ncbi.nlm.nih.gov/15071500" } ], "site_lbl": "Ser422", "uniprot_canonical_ac": "P23588-1" } ], "record_id": "pubmed.35772404", "abstract": "", "glycosylation": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 4 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Dynamic localization of the Na+-HCO3- co-transporter NBCn1 to the plasma membrane, centrosomes, spindle and primary cilia.", "journal": "Journal of cell science", "date": "2023-04-01", "authors": "Severin Marc, Pedersen Emma Lind, Borre Magnus Thane, Axholm Ida, Christiansen Frederik Bendix, Ponniah Muthulakshmi, Czaplinska Dominika, Larsen Tanja, Pardo Luis Angel, Pedersen Stine Falsig", "reference": { "type": "PubMed", "id": "37039101", "url": "https://pubmed.ncbi.nlm.nih.gov/37039101" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9Y6M7-1", "protein_name": "Sodium bicarbonate cotransporter 3", "gene_name": "SLC4A7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9R1N3-1", "protein_name": "Sodium bicarbonate cotransporter 3", "gene_name": "Slc4a7", "tax_name": "Rat" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9Y6M7", "url": "https://www.uniprot.org/uniprotkb/Q9Y6M7" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.37039101", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Update on the relationship between the SLC4A7 variant rs4973768 and breast cancer risk: a systematic review and meta-analysis.", "journal": "The Journal of international medical research", "date": "2023-04", "authors": "Zhou Yuhui, Ma Xiaoxia, Sun Jinglan", "reference": { "type": "PubMed", "id": "37128157", "url": "https://pubmed.ncbi.nlm.nih.gov/37128157" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9Y6M7-1", "protein_name": "Sodium bicarbonate cotransporter 3", "gene_name": "SLC4A7", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9Y6M7", "url": "https://www.uniprot.org/uniprotkb/Q9Y6M7" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.37128157", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Antibodies toward Na+,HCO3--cotransporter NBCn1/SLC4A7 block net acid extrusion and cause pH-dependent growth inhibition and apoptosis in breast cancer.", "journal": "British journal of cancer", "date": "2024-02-03", "authors": "Axelsen Trine V, Olesen Claus, Khan Danish, Mohammadi Ali, Bouzinova Elena V, Nielsen Christine J F, Mele Marco, Hauerslev Katrine R, Pedersen Helene L, Balling Eva, Vahl Pernille, Tramm Trine, Christiansen Peer M, Boedtkjer Ebbe", "reference": { "type": "PubMed", "id": "38310186", "url": "https://pubmed.ncbi.nlm.nih.gov/38310186" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9Y6M7-1", "protein_name": "Sodium bicarbonate cotransporter 3", "gene_name": "SLC4A7", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9Y6M7", "url": "https://www.uniprot.org/uniprotkb/Q9Y6M7" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.38310186", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Anion exchanger 1 in human kidney and oncocytoma differs from erythroid AE1 in its NH2 terminus.", "journal": "The American journal of physiology", "date": "1993", "authors": "Kollert-Jons A, Wagner S, Hubner S, Appelhans H, Drenckhahn D", "reference": { "type": "PubMed", "id": "7506871", "url": "https://pubmed.ncbi.nlm.nih.gov/7506871" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9Y6M7-1", "protein_name": "Sodium bicarbonate cotransporter 3", "gene_name": "SLC4A7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BY07-1", "protein_name": "Electrogenic sodium bicarbonate cotransporter 4", "gene_name": "SLC4A5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96HN2-1", "protein_name": "S-adenosylhomocysteine hydrolase-like protein 2", "gene_name": "AHCYL2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P02730-1", "protein_name": "Band 3 anion transport protein", "gene_name": "SLC4A1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y6R1-1", "protein_name": "Electrogenic sodium bicarbonate cotransporter 1", "gene_name": "SLC4A4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96Q91-1", "protein_name": "Anion exchange protein 4", "gene_name": "SLC4A9", "tax_name": "Human" }, { "uniprot_canonical_ac": "P48751-1", "protein_name": "Anion exchange protein 3", "gene_name": "SLC4A3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04920-1", "protein_name": "Anion exchange protein 2", "gene_name": "SLC4A2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6U841-1", "protein_name": "Sodium-driven chloride bicarbonate exchanger", "gene_name": "SLC4A10", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q2Y0W8-1", "protein_name": "Electroneutral sodium bicarbonate exchanger 1", "gene_name": "SLC4A8", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9Y6M7", "url": "https://www.uniprot.org/uniprotkb/Q9Y6M7" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.7506871", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 10 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Mutations of conserved arginines in the membrane domain of erythroid band 3 lead to a decrease in membrane-associated band 3 and to the phenotype of hereditary spherocytosis.", "journal": "Blood", "date": "1995", "authors": "Jarolim P, Rubin HL, Brabec V, Chrobak L, Zolotarev AS, Alper SL, Brugnara C, Wichterle H, Palek J", "reference": { "type": "PubMed", "id": "7530501", "url": "https://pubmed.ncbi.nlm.nih.gov/7530501" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9Y6M7-1", "protein_name": "Sodium bicarbonate cotransporter 3", "gene_name": "SLC4A7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BY07-1", "protein_name": "Electrogenic sodium bicarbonate cotransporter 4", "gene_name": "SLC4A5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96HN2-1", "protein_name": "S-adenosylhomocysteine hydrolase-like protein 2", "gene_name": "AHCYL2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P02730-1", "protein_name": "Band 3 anion transport protein", "gene_name": "SLC4A1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y6R1-1", "protein_name": "Electrogenic sodium bicarbonate cotransporter 1", "gene_name": "SLC4A4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96Q91-1", "protein_name": "Anion exchange protein 4", "gene_name": "SLC4A9", "tax_name": "Human" }, { "uniprot_canonical_ac": "P48751-1", "protein_name": "Anion exchange protein 3", "gene_name": "SLC4A3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04920-1", "protein_name": "Anion exchange protein 2", "gene_name": "SLC4A2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6U841-1", "protein_name": "Sodium-driven chloride bicarbonate exchanger", "gene_name": "SLC4A10", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q2Y0W8-1", "protein_name": "Electroneutral sodium bicarbonate exchanger 1", "gene_name": "SLC4A8", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9Y6M7", "url": "https://www.uniprot.org/uniprotkb/Q9Y6M7" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.7530501", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 10 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Molecular cloning, expression, and chromosomal localization of two isoforms of the AE3 anion exchanger from human heart.", "journal": "Circulation research", "date": "1994", "authors": "Yannoukakos D, Stuart-Tilley A, Fernandez HA, Fey P, Duyk G, Alper SL", "reference": { "type": "PubMed", "id": "7923606", "url": "https://pubmed.ncbi.nlm.nih.gov/7923606" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9Y6M7-1", "protein_name": "Sodium bicarbonate cotransporter 3", "gene_name": "SLC4A7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BY07-1", "protein_name": "Electrogenic sodium bicarbonate cotransporter 4", "gene_name": "SLC4A5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96HN2-1", "protein_name": "S-adenosylhomocysteine hydrolase-like protein 2", "gene_name": "AHCYL2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P02730-1", "protein_name": "Band 3 anion transport protein", "gene_name": "SLC4A1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y6R1-1", "protein_name": "Electrogenic sodium bicarbonate cotransporter 1", "gene_name": "SLC4A4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96Q91-1", "protein_name": "Anion exchange protein 4", "gene_name": "SLC4A9", "tax_name": "Human" }, { "uniprot_canonical_ac": "P48751-1", "protein_name": "Anion exchange protein 3", "gene_name": "SLC4A3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04920-1", "protein_name": "Anion exchange protein 2", "gene_name": "SLC4A2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6U841-1", "protein_name": "Sodium-driven chloride bicarbonate exchanger", "gene_name": "SLC4A10", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q2Y0W8-1", "protein_name": "Electroneutral sodium bicarbonate exchanger 1", "gene_name": "SLC4A8", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9Y6M7", "url": "https://www.uniprot.org/uniprotkb/Q9Y6M7" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.7923606", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 10 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Band 3 Memphis variant II. Altered stilbene disulfonate binding and the Diego (Dia) blood group antigen are associated with the human erythrocyte band 3 mutation Pro854-->Leu.", "journal": "The Journal of biological chemistry", "date": "1994", "authors": "Bruce LJ, Anstee DJ, Spring FA, Tanner MJ", "reference": { "type": "PubMed", "id": "8206915", "url": "https://pubmed.ncbi.nlm.nih.gov/8206915" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9Y6M7-1", "protein_name": "Sodium bicarbonate cotransporter 3", "gene_name": "SLC4A7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BY07-1", "protein_name": "Electrogenic sodium bicarbonate cotransporter 4", "gene_name": "SLC4A5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96HN2-1", "protein_name": "S-adenosylhomocysteine hydrolase-like protein 2", "gene_name": "AHCYL2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P02730-1", "protein_name": "Band 3 anion transport protein", "gene_name": "SLC4A1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y6R1-1", "protein_name": "Electrogenic sodium bicarbonate cotransporter 1", "gene_name": "SLC4A4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96Q91-1", "protein_name": "Anion exchange protein 4", "gene_name": "SLC4A9", "tax_name": "Human" }, { "uniprot_canonical_ac": "P48751-1", "protein_name": "Anion exchange protein 3", "gene_name": "SLC4A3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04920-1", "protein_name": "Anion exchange protein 2", "gene_name": "SLC4A2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6U841-1", "protein_name": "Sodium-driven chloride bicarbonate exchanger", "gene_name": "SLC4A10", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q2Y0W8-1", "protein_name": "Electroneutral sodium bicarbonate exchanger 1", "gene_name": "SLC4A8", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9Y6M7", "url": "https://www.uniprot.org/uniprotkb/Q9Y6M7" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.8206915", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 10 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Cloning and functional expression of a human kidney Na+:HCO3- cotransporter.", "journal": "The Journal of biological chemistry", "date": "1997", "authors": "Burnham CE, Amlal H, Wang Z, Shull GE, Soleimani M", "reference": { "type": "PubMed", "id": "9235899", "url": "https://pubmed.ncbi.nlm.nih.gov/9235899" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9Y6M7-1", "protein_name": "Sodium bicarbonate cotransporter 3", "gene_name": "SLC4A7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BY07-1", "protein_name": "Electrogenic sodium bicarbonate cotransporter 4", "gene_name": "SLC4A5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96HN2-1", "protein_name": "S-adenosylhomocysteine hydrolase-like protein 2", "gene_name": "AHCYL2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P02730-1", "protein_name": "Band 3 anion transport protein", "gene_name": "SLC4A1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y6R1-1", "protein_name": "Electrogenic sodium bicarbonate cotransporter 1", "gene_name": "SLC4A4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96Q91-1", "protein_name": "Anion exchange protein 4", "gene_name": "SLC4A9", "tax_name": "Human" }, { "uniprot_canonical_ac": "P48751-1", "protein_name": "Anion exchange protein 3", "gene_name": "SLC4A3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04920-1", "protein_name": "Anion exchange protein 2", "gene_name": "SLC4A2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6U841-1", "protein_name": "Sodium-driven chloride bicarbonate exchanger", "gene_name": "SLC4A10", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q2Y0W8-1", "protein_name": "Electroneutral sodium bicarbonate exchanger 1", "gene_name": "SLC4A8", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9Y6M7", "url": "https://www.uniprot.org/uniprotkb/Q9Y6M7" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.9235899", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 10 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Familial distal renal tubular acidosis is associated with mutations in the red cell anion exchanger (Band 3, AE1) gene.", "journal": "The Journal of clinical investigation", "date": "1997", "authors": "Bruce LJ, Cope DL, Jones GK, Schofield AE, Burley M, Povey S, Unwin RJ, Wrong O, Tanner MJ", "reference": { "type": "PubMed", "id": "9312167", "url": "https://pubmed.ncbi.nlm.nih.gov/9312167" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9Y6M7-1", "protein_name": "Sodium bicarbonate cotransporter 3", "gene_name": "SLC4A7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BY07-1", "protein_name": "Electrogenic sodium bicarbonate cotransporter 4", "gene_name": "SLC4A5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96HN2-1", "protein_name": "S-adenosylhomocysteine hydrolase-like protein 2", "gene_name": "AHCYL2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P02730-1", "protein_name": "Band 3 anion transport protein", "gene_name": "SLC4A1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y6R1-1", "protein_name": "Electrogenic sodium bicarbonate cotransporter 1", "gene_name": "SLC4A4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96Q91-1", "protein_name": "Anion exchange protein 4", "gene_name": "SLC4A9", "tax_name": "Human" }, { "uniprot_canonical_ac": "P48751-1", "protein_name": "Anion exchange protein 3", "gene_name": "SLC4A3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04920-1", "protein_name": "Anion exchange protein 2", "gene_name": "SLC4A2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6U841-1", "protein_name": "Sodium-driven chloride bicarbonate exchanger", "gene_name": "SLC4A10", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q2Y0W8-1", "protein_name": "Electroneutral sodium bicarbonate exchanger 1", "gene_name": "SLC4A8", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9Y6M7", "url": "https://www.uniprot.org/uniprotkb/Q9Y6M7" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.9312167", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 10 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Molecular cloning of a new sodium bicarbonate cotransporter cDNA from human retina.", "journal": "Biochem. Biophys. Res. Commun.", "date": "1998", "authors": "Ishibashi K, Sasaki S, Marumo F", "reference": { "type": "PubMed", "id": "9610397", "url": "https://pubmed.ncbi.nlm.nih.gov/9610397" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9Y6M7-1", "protein_name": "Sodium bicarbonate cotransporter 3", "gene_name": "SLC4A7", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9Y6M7", "url": "https://www.uniprot.org/uniprotkb/Q9Y6M7" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.9610397", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Molecular cloning, chromosomal localization, tissue distribution, and functional expression of the human pancreatic sodium bicarbonate cotransporter.", "journal": "The Journal of biological chemistry", "date": "1998", "authors": "Abuladze N, Lee I, Newman D, Hwang J, Boorer K, Pushkin A, Kurtz I", "reference": { "type": "PubMed", "id": "9651366", "url": "https://pubmed.ncbi.nlm.nih.gov/9651366" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9Y6M7-1", "protein_name": "Sodium bicarbonate cotransporter 3", "gene_name": "SLC4A7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BY07-1", "protein_name": "Electrogenic sodium bicarbonate cotransporter 4", "gene_name": "SLC4A5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96HN2-1", "protein_name": "S-adenosylhomocysteine hydrolase-like protein 2", "gene_name": "AHCYL2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P02730-1", "protein_name": "Band 3 anion transport protein", "gene_name": "SLC4A1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y6R1-1", "protein_name": "Electrogenic sodium bicarbonate cotransporter 1", "gene_name": "SLC4A4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96Q91-1", "protein_name": "Anion exchange protein 4", "gene_name": "SLC4A9", "tax_name": "Human" }, { "uniprot_canonical_ac": "O88343-1", "protein_name": "Electrogenic sodium bicarbonate cotransporter 1", "gene_name": "Slc4a4", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "P48751-1", "protein_name": "Anion exchange protein 3", "gene_name": "SLC4A3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04920-1", "protein_name": "Anion exchange protein 2", "gene_name": "SLC4A2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6U841-1", "protein_name": "Sodium-driven chloride bicarbonate exchanger", "gene_name": "SLC4A10", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q2Y0W8-1", "protein_name": "Electroneutral sodium bicarbonate exchanger 1", "gene_name": "SLC4A8", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9Y6M7", "url": "https://www.uniprot.org/uniprotkb/Q9Y6M7" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.9651366", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 11 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Analysis of the V(D)J recombination efficiency at lymphoid chromosomal translocation breakpoints.", "journal": "J. Biol. Chem.", "date": "2001", "authors": "Raghavan S C, Kirsch I R, Lieber M R", "reference": { "type": "PubMed", "id": "11390401", "url": "https://pubmed.ncbi.nlm.nih.gov/11390401" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q15468-1", "protein_name": "SCL-interrupting locus protein", "gene_name": "STIL", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q15468", "url": "https://www.uniprot.org/uniprotkb/Q15468" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.11390401", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The genomic structure, chromosomal localization, and analysis of SIL as a candidate gene for holoprosencephaly.", "journal": "Cytogenet. Genome Res.", "date": "2002", "authors": "Karkera JD, Izraeli S, Roessler E, Dutra A, Kirsch I, Muenke M", "reference": { "type": "PubMed", "id": "12438740", "url": "https://pubmed.ncbi.nlm.nih.gov/12438740" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q15468-1", "protein_name": "SCL-interrupting locus protein", "gene_name": "STIL", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q15468", "url": "https://www.uniprot.org/uniprotkb/Q15468" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.12438740", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Cloning and characterization of the SIL promoter.", "journal": "Biochimica et biophysica acta", "date": "2003", "authors": "Colaizzo-Anas T, Aplan PD", "reference": { "type": "PubMed", "id": "12531481", "url": "https://pubmed.ncbi.nlm.nih.gov/12531481" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q15468-1", "protein_name": "SCL-interrupting locus protein", "gene_name": "STIL", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q15468", "url": "https://www.uniprot.org/uniprotkb/Q15468" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.12531481", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Measurement of SIL-TAL1 fusion gene transcripts associated with human T-cell lymphocytic leukemia by real-time reverse transcriptase-PCR.", "journal": "Leuk. Res.", "date": "2003", "authors": "Curry John D, Smith Martyn T", "reference": { "type": "PubMed", "id": "12681356", "url": "https://pubmed.ncbi.nlm.nih.gov/12681356" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q15468-1", "protein_name": "SCL-interrupting locus protein", "gene_name": "STIL", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q15468", "url": "https://www.uniprot.org/uniprotkb/Q15468" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.12681356", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Involvement of the putative hematopoietic transcription factor SCL in T-cell acute lymphoblastic leukemia.", "journal": "Blood", "date": "1992", "authors": "Aplan PD, Lombardi DP, Reaman GH, Sather HN, Hammond GD, Kirsch IR", "reference": { "type": "PubMed", "id": "1311214", "url": "https://pubmed.ncbi.nlm.nih.gov/1311214" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q15468-1", "protein_name": "SCL-interrupting locus protein", "gene_name": "STIL", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q15468", "url": "https://www.uniprot.org/uniprotkb/Q15468" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.1311214", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Clinical significance of HOX11L2 expression linked to t(5;14)(q35;q32), of HOX11 expression, and of SIL-TAL fusion in childhood T-cell malignancies: results of EORTC studies 58881 and 58951.", "journal": "Blood", "date": "2004", "authors": "Cav\u00e9 H\u00e9l\u00e8ne, Suciu Stefan, Preudhomme Claude, Poppe Bruce, Robert Alain, Uyttebroeck Anne, Malet Mich\u00e8le, Boutard Patrick, Benoit Yves, Mauvieux Laurent, Lutz Patrick, M\u00e9chinaud Fran\u00e7oise, Grardel Nathalie, Mazingue Francoise, Dupont Madeleine, Margueritte Genevi\u00e8ve, Pages Marie-Pierre, Bertrand Yves, Plouvier Emmanuel, Brunie Ghislaine, Bastard Christian, Plantaz Dominique, Vande Velde Isabel, Hagemeijer Anne, Speleman Frank, Lessard Michel, Otten Jacques, Vilmer Etienne, Dastugue Nicole,", "reference": { "type": "PubMed", "id": "14504110", "url": "https://pubmed.ncbi.nlm.nih.gov/14504110" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q15468-1", "protein_name": "SCL-interrupting locus protein", "gene_name": "STIL", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q15468", "url": "https://www.uniprot.org/uniprotkb/Q15468" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.14504110", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Sil overexpression in lung cancer characterizes tumors with increased mitotic activity.", "journal": "Oncogene", "date": "2004", "authors": "Erez Ayelet, Perelman Marina, Hewitt Stephen M, Cojacaru Gadi, Goldberg Iris, Shahar Iris, Yaron Pnina, Muler Inna, Campaner Stefano, Amariglio Ninette, Rechavi Gideon, Kirsch Ilan R, Krupsky Meir, Kaminski Naftali, Izraeli Shai", "reference": { "type": "PubMed", "id": "15107824", "url": "https://pubmed.ncbi.nlm.nih.gov/15107824" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q15468-1", "protein_name": "SCL-interrupting locus protein", "gene_name": "STIL", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q15468", "url": "https://www.uniprot.org/uniprotkb/Q15468" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.15107824", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Sil phosphorylation in a Pin1 binding domain affects the duration of the spindle checkpoint.", "journal": "Molecular and cellular biology", "date": "2005", "authors": "Campaner S, Kaldis P, Izraeli S, Kirsch IR", "reference": { "type": "PubMed", "id": "16024801", "url": "https://pubmed.ncbi.nlm.nih.gov/16024801" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q15468-1", "protein_name": "SCL-interrupting locus protein", "gene_name": "STIL", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06493-1", "protein_name": "Cyclin-dependent kinase 1", "gene_name": "CDK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q60988-1", "protein_name": "SCL-interrupting locus protein homolog", "gene_name": "Stil", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "Q9QUR7-1", "protein_name": "Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1", "gene_name": "Pin1", "tax_name": "Mouse" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q15468", "url": "https://www.uniprot.org/uniprotkb/Q15468" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 161, "end_pos": 161, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine; by CAK", "evidence": [ { "database": "UniProtKB", "id": "P06493", "url": "https://www.uniprot.org/uniprotkb/P06493" }, { "database": "iPTMnet", "id": "P06493", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P06493" }, { "database": "PubMed", "id": "16565220", "url": "https://pubmed.ncbi.nlm.nih.gov/16565220" }, { "database": "PubMed", "id": "17924679", "url": "https://pubmed.ncbi.nlm.nih.gov/17924679" }, { "database": "PubMed", "id": "18452278", "url": "https://pubmed.ncbi.nlm.nih.gov/18452278" }, { "database": "PubMed", "id": "18669648", "url": "https://pubmed.ncbi.nlm.nih.gov/18669648" }, { "database": "PubMed", "id": "18691976", "url": "https://pubmed.ncbi.nlm.nih.gov/18691976" }, { "database": "PubMed", "id": "18767875", "url": "https://pubmed.ncbi.nlm.nih.gov/18767875" }, { "database": "PubMed", "id": "19651622", "url": "https://pubmed.ncbi.nlm.nih.gov/19651622" }, { "database": "PubMed", "id": "19664995", "url": "https://pubmed.ncbi.nlm.nih.gov/19664995" }, { "database": "PubMed", "id": "20068231", "url": "https://pubmed.ncbi.nlm.nih.gov/20068231" }, { "database": "PubMed", "id": "7944411", "url": "https://pubmed.ncbi.nlm.nih.gov/7944411" }, { "database": "PRO", "id": "P06493", "url": "https://proconsortium.org/cgi-bin/entry_pro?id=P06493" }, { "database": "PubMed", "id": "10564259", "url": "https://pubmed.ncbi.nlm.nih.gov/10564259" }, { "database": "PubMed", "id": "10913154", "url": "https://pubmed.ncbi.nlm.nih.gov/10913154" }, { "database": "PubMed", "id": "12222840", "url": "https://pubmed.ncbi.nlm.nih.gov/12222840" }, { "database": "PubMed", "id": "1483349", "url": "https://pubmed.ncbi.nlm.nih.gov/1483349" }, { "database": "PubMed", "id": "1483352", "url": "https://pubmed.ncbi.nlm.nih.gov/1483352" }, { "database": "PubMed", "id": "1535244", "url": "https://pubmed.ncbi.nlm.nih.gov/1535244" }, { "database": "PubMed", "id": "15798220", "url": "https://pubmed.ncbi.nlm.nih.gov/15798220" }, { "database": "PubMed", "id": "16024801", "url": "https://pubmed.ncbi.nlm.nih.gov/16024801" }, { "database": "PubMed", "id": "16847100", "url": "https://pubmed.ncbi.nlm.nih.gov/16847100" }, { "database": "PubMed", "id": "17012222", "url": "https://pubmed.ncbi.nlm.nih.gov/17012222" }, { "database": "PubMed", "id": "17013563", "url": "https://pubmed.ncbi.nlm.nih.gov/17013563" }, { "database": "PubMed", "id": "17015169", "url": "https://pubmed.ncbi.nlm.nih.gov/17015169" }, { "database": "PubMed", "id": "17102938", "url": "https://pubmed.ncbi.nlm.nih.gov/17102938" }, { "database": "PubMed", "id": "17340628", "url": "https://pubmed.ncbi.nlm.nih.gov/17340628" }, { "database": "PubMed", "id": "17374997", "url": "https://pubmed.ncbi.nlm.nih.gov/17374997" }, { "database": "PubMed", "id": "18025287", "url": "https://pubmed.ncbi.nlm.nih.gov/18025287" }, { "database": "PubMed", "id": "18193228", "url": "https://pubmed.ncbi.nlm.nih.gov/18193228" }, { "database": "PubMed", "id": "18501396", "url": "https://pubmed.ncbi.nlm.nih.gov/18501396" }, { "database": "PubMed", "id": "18603276", "url": "https://pubmed.ncbi.nlm.nih.gov/18603276" }, { "database": "PubMed", "id": "19450678", "url": "https://pubmed.ncbi.nlm.nih.gov/19450678" }, { "database": "PubMed", "id": "19735649", "url": "https://pubmed.ncbi.nlm.nih.gov/19735649" }, { "database": "PubMed", "id": "19781537", "url": "https://pubmed.ncbi.nlm.nih.gov/19781537" }, { "database": "PubMed", "id": "20360007", "url": "https://pubmed.ncbi.nlm.nih.gov/20360007" }, { "database": "PubMed", "id": "20367638", "url": "https://pubmed.ncbi.nlm.nih.gov/20367638" }, { "database": "PubMed", "id": "20395957", "url": "https://pubmed.ncbi.nlm.nih.gov/20395957" }, { "database": "PubMed", "id": "21468563", "url": "https://pubmed.ncbi.nlm.nih.gov/21468563" }, { "database": "PubMed", "id": "21900495", "url": "https://pubmed.ncbi.nlm.nih.gov/21900495" }, { "database": "PubMed", "id": "22204398", "url": "https://pubmed.ncbi.nlm.nih.gov/22204398" }, { "database": "PubMed", "id": "22563433", "url": "https://pubmed.ncbi.nlm.nih.gov/22563433" }, { "database": "PubMed", "id": "22580740", "url": "https://pubmed.ncbi.nlm.nih.gov/22580740" }, { "database": "PubMed", "id": "23397083", "url": "https://pubmed.ncbi.nlm.nih.gov/23397083" }, { "database": "PubMed", "id": "23471882", "url": "https://pubmed.ncbi.nlm.nih.gov/23471882" }, { "database": "PubMed", "id": "23775190", "url": "https://pubmed.ncbi.nlm.nih.gov/23775190" }, { "database": "PubMed", "id": "23802687", "url": "https://pubmed.ncbi.nlm.nih.gov/23802687" }, { "database": "PubMed", "id": "24042231", "url": "https://pubmed.ncbi.nlm.nih.gov/24042231" }, { "database": "PubMed", "id": "25092827", "url": "https://pubmed.ncbi.nlm.nih.gov/25092827" }, { "database": "PubMed", "id": "25483135", "url": "https://pubmed.ncbi.nlm.nih.gov/25483135" }, { "database": "PubMed", "id": "25563361", "url": "https://pubmed.ncbi.nlm.nih.gov/25563361" }, { "database": "PubMed", "id": "25864384", "url": "https://pubmed.ncbi.nlm.nih.gov/25864384" }, { "database": "PubMed", "id": "26354852", "url": "https://pubmed.ncbi.nlm.nih.gov/26354852" }, { "database": "PubMed", "id": "26714015", "url": "https://pubmed.ncbi.nlm.nih.gov/26714015" }, { "database": "PubMed", "id": "26815740", "url": "https://pubmed.ncbi.nlm.nih.gov/26815740" }, { "database": "PubMed", "id": "26881434", "url": "https://pubmed.ncbi.nlm.nih.gov/26881434" }, { "database": "PubMed", "id": "26913578", "url": "https://pubmed.ncbi.nlm.nih.gov/26913578" }, { "database": "PubMed", "id": "27819344", "url": "https://pubmed.ncbi.nlm.nih.gov/27819344" }, { "database": "PubMed", "id": "28062857", "url": "https://pubmed.ncbi.nlm.nih.gov/28062857" }, { "database": "PubMed", "id": "28534969", "url": "https://pubmed.ncbi.nlm.nih.gov/28534969" }, { "database": "PubMed", "id": "29071385", "url": "https://pubmed.ncbi.nlm.nih.gov/29071385" }, { "database": "PubMed", "id": "29277717", "url": "https://pubmed.ncbi.nlm.nih.gov/29277717" }, { "database": "PubMed", "id": "29435156", "url": "https://pubmed.ncbi.nlm.nih.gov/29435156" }, { "database": "PubMed", "id": "29515122", "url": "https://pubmed.ncbi.nlm.nih.gov/29515122" }, { "database": "PubMed", "id": "30190546", "url": "https://pubmed.ncbi.nlm.nih.gov/30190546" }, { "database": "PubMed", "id": "30273361", "url": "https://pubmed.ncbi.nlm.nih.gov/30273361" }, { "database": "PubMed", "id": "30538118", "url": "https://pubmed.ncbi.nlm.nih.gov/30538118" }, { "database": "PubMed", "id": "31035650", "url": "https://pubmed.ncbi.nlm.nih.gov/31035650" }, { "database": "PubMed", "id": "31836849", "url": "https://pubmed.ncbi.nlm.nih.gov/31836849" }, { "database": "PubMed", "id": "32231646", "url": "https://pubmed.ncbi.nlm.nih.gov/32231646" }, { "database": "PubMed", "id": "32410646", "url": "https://pubmed.ncbi.nlm.nih.gov/32410646" }, { "database": "PubMed", "id": "33281346", "url": "https://pubmed.ncbi.nlm.nih.gov/33281346" }, { "database": "PubMed", "id": "33352782", "url": "https://pubmed.ncbi.nlm.nih.gov/33352782" }, { "database": "PubMed", "id": "33574676", "url": "https://pubmed.ncbi.nlm.nih.gov/33574676" }, { "database": "PubMed", "id": "33718142", "url": "https://pubmed.ncbi.nlm.nih.gov/33718142" }, { "database": "PubMed", "id": "33863878", "url": "https://pubmed.ncbi.nlm.nih.gov/33863878" }, { "database": "PubMed", "id": "35694267", "url": "https://pubmed.ncbi.nlm.nih.gov/35694267" }, { "database": "PubMed", "id": "7543054", "url": "https://pubmed.ncbi.nlm.nih.gov/7543054" }, { "database": "PubMed", "id": "7929589", "url": "https://pubmed.ncbi.nlm.nih.gov/7929589" }, { "database": "PubMed", "id": "8078587", "url": "https://pubmed.ncbi.nlm.nih.gov/8078587" }, { "database": "PubMed", "id": "8336738", "url": "https://pubmed.ncbi.nlm.nih.gov/8336738" }, { "database": "PubMed", "id": "8440392", "url": "https://pubmed.ncbi.nlm.nih.gov/8440392" }, { "database": "PubMed", "id": "8441405", "url": "https://pubmed.ncbi.nlm.nih.gov/8441405" }, { "database": "PubMed", "id": "9001210", "url": "https://pubmed.ncbi.nlm.nih.gov/9001210" }, { "database": "PubMed", "id": "21406692", "url": "https://pubmed.ncbi.nlm.nih.gov/21406692" }, { "database": "PubMed", "id": "23186163", "url": "https://pubmed.ncbi.nlm.nih.gov/23186163" }, { "database": "PubMed", "id": "19690332", "url": "https://pubmed.ncbi.nlm.nih.gov/19690332" } ], "site_lbl": "Thr161", "uniprot_canonical_ac": "P06493-1" } ], "mutagenesis": [ { "start_pos": 574, "end_pos": 574, "sequence_org": "T", "sequence_mut": "A", "comment": "Abolishes mitotic phosphorylation and decreases mitotic index as well as CDK1 activity; when associated with A-643; A-656; A-664; A-686; A-699 and A-760.", "evidence": [ { "database": "UniProtKB", "id": "Q60988", "url": "https://www.uniprot.org/uniprotkb/Q60988" }, { "database": "PubMed", "id": "16024801", "url": "https://pubmed.ncbi.nlm.nih.gov/16024801" } ], "uniprot_canonical_ac": "Q60988-1" }, { "start_pos": 643, "end_pos": 643, "sequence_org": "S", "sequence_mut": "A", "comment": "Abolishes mitotic phosphorylation and decreases mitotic index as well as CDK1 activity; when associated with A-574; A-656; A-664; A-686; A-699 and A-760.", "evidence": [ { "database": "UniProtKB", "id": "Q60988", "url": "https://www.uniprot.org/uniprotkb/Q60988" }, { "database": "PubMed", "id": "16024801", "url": "https://pubmed.ncbi.nlm.nih.gov/16024801" } ], "uniprot_canonical_ac": "Q60988-1" }, { "start_pos": 656, "end_pos": 656, "sequence_org": "S", "sequence_mut": "A", "comment": "Abolishes mitotic phosphorylation and decreases mitotic index as well as CDK1 activity; when associated with A-574; A-643; A-664; A-686; A-699 and A-760.", "evidence": [ { "database": "UniProtKB", "id": "Q60988", "url": "https://www.uniprot.org/uniprotkb/Q60988" }, { "database": "PubMed", "id": "16024801", "url": "https://pubmed.ncbi.nlm.nih.gov/16024801" } ], "uniprot_canonical_ac": "Q60988-1" }, { "start_pos": 664, "end_pos": 664, "sequence_org": "S", "sequence_mut": "A", "comment": "Abolishes mitotic phosphorylation and decreases mitotic index as well as CDK1 activity; when associated with A-574; A-643; A-656; A-686; A-699 and A-760.", "evidence": [ { "database": "UniProtKB", "id": "Q60988", "url": "https://www.uniprot.org/uniprotkb/Q60988" }, { "database": "PubMed", "id": "16024801", "url": "https://pubmed.ncbi.nlm.nih.gov/16024801" } ], "uniprot_canonical_ac": "Q60988-1" }, { "start_pos": 686, "end_pos": 686, "sequence_org": "T", "sequence_mut": "A", "comment": "Abolishes mitotic phosphorylation and decreases mitotic index as well as CDK1 activity; when associated with A-574; A-643; A-656; A-664; A-699 and A-760.", "evidence": [ { "database": "UniProtKB", "id": "Q60988", "url": "https://www.uniprot.org/uniprotkb/Q60988" }, { "database": "PubMed", "id": "16024801", "url": "https://pubmed.ncbi.nlm.nih.gov/16024801" } ], "uniprot_canonical_ac": "Q60988-1" }, { "start_pos": 699, "end_pos": 699, "sequence_org": "S", "sequence_mut": "A", "comment": "Abolishes mitotic phosphorylation and decreases mitotic index as well as CDK1 activity; when associated with A-574; A-643; A-656; A-664; A-686 and A-760.", "evidence": [ { "database": "UniProtKB", "id": "Q60988", "url": "https://www.uniprot.org/uniprotkb/Q60988" }, { "database": "PubMed", "id": "16024801", "url": "https://pubmed.ncbi.nlm.nih.gov/16024801" } ], "uniprot_canonical_ac": "Q60988-1" }, { "start_pos": 760, "end_pos": 760, "sequence_org": "S", "sequence_mut": "A", "comment": "Abolishes mitotic phosphorylation and decreases mitotic index as well as CDK1 activity; when associated with A-574; A-643; A-656; A-664; A-686 and A-699.", "evidence": [ { "database": "UniProtKB", "id": "Q60988", "url": "https://www.uniprot.org/uniprotkb/Q60988" }, { "database": "PubMed", "id": "16024801", "url": "https://pubmed.ncbi.nlm.nih.gov/16024801" } ], "uniprot_canonical_ac": "Q60988-1" } ], "record_id": "pubmed.16024801", "abstract": "", "glycosylation": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 4 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Mutations in STIL, encoding a pericentriolar and centrosomal protein, cause primary microcephaly.", "journal": "Am. J. Hum. Genet.", "date": "2009", "authors": "Kumar A, Girimaji SC, Duvvari MR, Blanton SH", "reference": { "type": "PubMed", "id": "19215732", "url": "https://pubmed.ncbi.nlm.nih.gov/19215732" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q15468-1", "protein_name": "SCL-interrupting locus protein", "gene_name": "STIL", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q15468", "url": "https://www.uniprot.org/uniprotkb/Q15468" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.19215732", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Structural characterization of SIL, a gene frequently disrupted in T-cell acute lymphoblastic leukemia.", "journal": "Mol. Cell. Biol.", "date": "1991", "authors": "Aplan P D, Lombardi D P, Kirsch I R", "reference": { "type": "PubMed", "id": "1922059", "url": "https://pubmed.ncbi.nlm.nih.gov/1922059" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q15468-1", "protein_name": "SCL-interrupting locus protein", "gene_name": "STIL", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q60988-1", "protein_name": "SCL-interrupting locus protein homolog", "gene_name": "Stil", "tax_name": "Mouse" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q15468", "url": "https://www.uniprot.org/uniprotkb/Q15468" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.1922059", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The human microcephaly protein STIL interacts with CPAP and is required for procentriole formation.", "journal": "The EMBO journal", "date": "2011", "authors": "Tang CJ, Lin SY, Hsu WB, Lin YN, Wu CT, Lin YC, Chang CW, Wu KS, Tang TK", "reference": { "type": "PubMed", "id": "22020124", "url": "https://pubmed.ncbi.nlm.nih.gov/22020124" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q15468-1", "protein_name": "SCL-interrupting locus protein", "gene_name": "STIL", "tax_name": "Human" }, { "uniprot_canonical_ac": "O94986-4", "protein_name": "Centrosomal protein of 152 kDa", "gene_name": "CEP152", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6UVJ0-1", "protein_name": "Spindle assembly abnormal protein 6 homolog", "gene_name": "SASS6", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00444-1", "protein_name": "Serine/threonine-protein kinase PLK4", "gene_name": "PLK4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HC77-1", "protein_name": "Centrosomal P4.1-associated protein", "gene_name": "CPAP", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q15468", "url": "https://www.uniprot.org/uniprotkb/Q15468" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.22020124", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 5 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Site-specific recombination of the tal-1 gene is a common occurrence in human T cell leukemia.", "journal": "EMBO J.", "date": "1990", "authors": "Brown L, Cheng J T, Chen Q, Siciliano M J, Crist W, Buchanan G, Baer R", "reference": { "type": "PubMed", "id": "2209547", "url": "https://pubmed.ncbi.nlm.nih.gov/2209547" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q15468-1", "protein_name": "SCL-interrupting locus protein", "gene_name": "STIL", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q15468", "url": "https://www.uniprot.org/uniprotkb/Q15468" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.2209547", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Disruption of the human SCL locus by 'illegitimate' V-(D)-J recombinase activity.", "journal": "Science", "date": "1990", "authors": "Aplan P D, Lombardi D P, Ginsberg A M, Cossman J, Bertness V L, Kirsch I R", "reference": { "type": "PubMed", "id": "2255914", "url": "https://pubmed.ncbi.nlm.nih.gov/2255914" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q15468-1", "protein_name": "SCL-interrupting locus protein", "gene_name": "STIL", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q15468", "url": "https://www.uniprot.org/uniprotkb/Q15468" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.2255914", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Investigation of primary microcephaly in Bushehr province of Iran: novel STIL and ASPM mutations.", "journal": "Clinical genetics", "date": "2013", "authors": "Papari E, Bastami M, Farhadi A, Abedini SS, Hosseini M, Bahman I, Mohseni M, Garshasbi M, Moheb LA, Behjati F, Kahrizi K, Ropers HH, Najmabadi H", "reference": { "type": "PubMed", "id": "22989186", "url": "https://pubmed.ncbi.nlm.nih.gov/22989186" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q15468-1", "protein_name": "SCL-interrupting locus protein", "gene_name": "STIL", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8IZT6-1", "protein_name": "Abnormal spindle-like microcephaly-associated protein", "gene_name": "ASPM", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q15468", "url": "https://www.uniprot.org/uniprotkb/Q15468" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.22989186", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Direct interaction of Plk4 with STIL ensures formation of a single procentriole per parental centriole.", "journal": "Nature communications", "date": "2014", "authors": "Ohta M, Ashikawa T, Nozaki Y, Kozuka-Hata H, Goto H, Inagaki M, Oyama M, Kitagawa D", "reference": { "type": "PubMed", "id": "25342035", "url": "https://pubmed.ncbi.nlm.nih.gov/25342035" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q15468-1", "protein_name": "SCL-interrupting locus protein", "gene_name": "STIL", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q15468", "url": "https://www.uniprot.org/uniprotkb/Q15468" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 1061, "end_pos": 1061, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q15468", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q15468" }, { "database": "PubMed", "id": "25342035", "url": "https://pubmed.ncbi.nlm.nih.gov/25342035" } ], "site_lbl": "Ser1061", "uniprot_canonical_ac": "Q15468-1" }, { "start_pos": 1116, "end_pos": 1116, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q15468", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q15468" }, { "database": "PubMed", "id": "25342035", "url": "https://pubmed.ncbi.nlm.nih.gov/25342035" }, { "database": "PubMed", "id": "25701666", "url": "https://pubmed.ncbi.nlm.nih.gov/25701666" }, { "database": "PubMed", "id": "26101219", "url": "https://pubmed.ncbi.nlm.nih.gov/26101219" } ], "site_lbl": "Ser1116", "uniprot_canonical_ac": "Q15468-1" }, { "start_pos": 1119, "end_pos": 1119, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q15468", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q15468" }, { "database": "PubMed", "id": "25342035", "url": "https://pubmed.ncbi.nlm.nih.gov/25342035" } ], "site_lbl": "Thr1119", "uniprot_canonical_ac": "Q15468-1" } ], "record_id": "pubmed.25342035", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 3 }, { "field": "total_sites", "count": 3 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Plk4-dependent phosphorylation of STIL is required for centriole duplication.", "journal": "Biology open", "date": "2015", "authors": "Kratz AS, Barenz F, Richter KT, Hoffmann I", "reference": { "type": "PubMed", "id": "25701666", "url": "https://pubmed.ncbi.nlm.nih.gov/25701666" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q15468-1", "protein_name": "SCL-interrupting locus protein", "gene_name": "STIL", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q15468", "url": "https://www.uniprot.org/uniprotkb/Q15468" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 1116, "end_pos": 1116, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q15468", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q15468" }, { "database": "PubMed", "id": "25342035", "url": "https://pubmed.ncbi.nlm.nih.gov/25342035" }, { "database": "PubMed", "id": "25701666", "url": "https://pubmed.ncbi.nlm.nih.gov/25701666" }, { "database": "PubMed", "id": "26101219", "url": "https://pubmed.ncbi.nlm.nih.gov/26101219" } ], "site_lbl": "Ser1116", "uniprot_canonical_ac": "Q15468-1" }, { "start_pos": 1250, "end_pos": 1250, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q15468", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q15468" }, { "database": "PubMed", "id": "25701666", "url": "https://pubmed.ncbi.nlm.nih.gov/25701666" } ], "site_lbl": "Thr1250", "uniprot_canonical_ac": "Q15468-1" }, { "start_pos": 871, "end_pos": 871, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q15468", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q15468" }, { "database": "PubMed", "id": "25701666", "url": "https://pubmed.ncbi.nlm.nih.gov/25701666" } ], "site_lbl": "Ser871", "uniprot_canonical_ac": "Q15468-1" }, { "start_pos": 873, "end_pos": 873, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q15468", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q15468" }, { "database": "PubMed", "id": "25701666", "url": "https://pubmed.ncbi.nlm.nih.gov/25701666" } ], "site_lbl": "Ser873", "uniprot_canonical_ac": "Q15468-1" }, { "start_pos": 874, "end_pos": 874, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q15468", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q15468" }, { "database": "PubMed", "id": "25701666", "url": "https://pubmed.ncbi.nlm.nih.gov/25701666" } ], "site_lbl": "Ser874", "uniprot_canonical_ac": "Q15468-1" } ], "record_id": "pubmed.25701666", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 5 }, { "field": "total_sites", "count": 5 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Binding of STIL to Plk4 activates kinase activity to promote centriole assembly.", "journal": "The Journal of cell biology", "date": "2015", "authors": "Moyer TC, Clutario KM, Lambrus BG, Daggubati V, Holland AJ", "reference": { "type": "PubMed", "id": "26101219", "url": "https://pubmed.ncbi.nlm.nih.gov/26101219" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q15468-1", "protein_name": "SCL-interrupting locus protein", "gene_name": "STIL", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00444-1", "protein_name": "Serine/threonine-protein kinase PLK4", "gene_name": "PLK4", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q15468", "url": "https://www.uniprot.org/uniprotkb/Q15468" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 1108, "end_pos": 1108, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q15468", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q15468" }, { "database": "PubMed", "id": "26101219", "url": "https://pubmed.ncbi.nlm.nih.gov/26101219" }, { "database": "PubMed", "id": "31672968", "url": "https://pubmed.ncbi.nlm.nih.gov/31672968" } ], "site_lbl": "Ser1108", "uniprot_canonical_ac": "Q15468-1" }, { "start_pos": 1116, "end_pos": 1116, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q15468", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q15468" }, { "database": "PubMed", "id": "25342035", "url": "https://pubmed.ncbi.nlm.nih.gov/25342035" }, { "database": "PubMed", "id": "25701666", "url": "https://pubmed.ncbi.nlm.nih.gov/25701666" }, { "database": "PubMed", "id": "26101219", "url": "https://pubmed.ncbi.nlm.nih.gov/26101219" } ], "site_lbl": "Ser1116", "uniprot_canonical_ac": "Q15468-1" }, { "start_pos": 170, "end_pos": 170, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O00444", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O00444" }, { "database": "PubMed", "id": "26101219", "url": "https://pubmed.ncbi.nlm.nih.gov/26101219" }, { "database": "PubMed", "id": "31142743", "url": "https://pubmed.ncbi.nlm.nih.gov/31142743" } ], "site_lbl": "Thr170", "uniprot_canonical_ac": "O00444-1" } ], "record_id": "pubmed.26101219", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 3 }, { "field": "total_sites", "count": 3 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The SKP1-Cullin-F-box E3 ligase betaTrCP and CDK2 cooperate to control STIL abundance and centriole number.", "journal": "Open biology", "date": "2018", "authors": "Arquint C, Cubizolles F, Morand A, Schmidt A, Nigg EA", "reference": { "type": "PubMed", "id": "29445034", "url": "https://pubmed.ncbi.nlm.nih.gov/29445034" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q15468-1", "protein_name": "SCL-interrupting locus protein", "gene_name": "STIL", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q15468", "url": "https://www.uniprot.org/uniprotkb/Q15468" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 395, "end_pos": 395, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "Q15468", "url": "https://www.uniprot.org/uniprotkb/Q15468" }, { "database": "PubMed", "id": "23186163", "url": "https://pubmed.ncbi.nlm.nih.gov/23186163" }, { "database": "iPTMnet", "id": "Q15468", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q15468" }, { "database": "PubMed", "id": "29445034", "url": "https://pubmed.ncbi.nlm.nih.gov/29445034" } ], "site_lbl": "Ser395", "uniprot_canonical_ac": "Q15468-1" } ], "record_id": "pubmed.29445034", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Direct binding of CEP85 to STIL ensures robust PLK4 activation and efficient centriole assembly.", "journal": "Nature communications", "date": "2018", "authors": "Liu Y, Gupta GD, Barnabas DD, Agircan FG, Mehmood S, Wu D, Coyaud E, Johnson CM, McLaughlin SH, Andreeva A, Freund SMV, Robinson CV, Cheung SWT, Raught B, Pelletier L, van Breugel M", "reference": { "type": "PubMed", "id": "29712910", "url": "https://pubmed.ncbi.nlm.nih.gov/29712910" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q15468-1", "protein_name": "SCL-interrupting locus protein", "gene_name": "STIL", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00444-1", "protein_name": "Serine/threonine-protein kinase PLK4", "gene_name": "PLK4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6P2H3-1", "protein_name": "Centrosomal protein of 85 kDa", "gene_name": "CEP85", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q15468", "url": "https://www.uniprot.org/uniprotkb/Q15468" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 64, "end_pos": 64, "sequence_org": "L", "sequence_mut": "A", "comment": "Reduced centriole localization; when associated with 67-A. Does not fully rescue the centriole duplication defect in STIL depleted cells.", "evidence": [ { "database": "UniProtKB", "id": "Q15468", "url": "https://www.uniprot.org/uniprotkb/Q15468" }, { "database": "PubMed", "id": "29712910", "url": "https://pubmed.ncbi.nlm.nih.gov/29712910" } ], "uniprot_canonical_ac": "Q15468-1" }, { "start_pos": 67, "end_pos": 67, "sequence_org": "R", "sequence_mut": "A", "comment": "Reduced centriole localization; when associated with 64-A. Does not fully rescue the centriole duplication defect in STIL depleted cells.", "evidence": [ { "database": "UniProtKB", "id": "Q15468", "url": "https://www.uniprot.org/uniprotkb/Q15468" }, { "database": "PubMed", "id": "29712910", "url": "https://pubmed.ncbi.nlm.nih.gov/29712910" } ], "uniprot_canonical_ac": "Q15468-1" }, { "start_pos": 640, "end_pos": 640, "sequence_org": "Q", "sequence_mut": "A", "comment": "Strongly reduced interaction with STIL. Strongly reduced interaction with STIL; when associated with A-644. Does not affect interaction wit PLKA; when associated with A-644.", "evidence": [ { "database": "UniProtKB", "id": "Q6P2H3", "url": "https://www.uniprot.org/uniprotkb/Q6P2H3" }, { "database": "PubMed", "id": "32107292", "url": "https://pubmed.ncbi.nlm.nih.gov/32107292" }, { "database": "PubMed", "id": "29712910", "url": "https://pubmed.ncbi.nlm.nih.gov/29712910" } ], "uniprot_canonical_ac": "Q6P2H3-1" }, { "start_pos": 644, "end_pos": 644, "sequence_org": "E", "sequence_mut": "A", "comment": "Strongly reduced interaction with STIL. Strongly reduced interaction with STIL; when associated with A-640. Does not affect interaction wit PLKA; when associated with A-644.", "evidence": [ { "database": "UniProtKB", "id": "Q6P2H3", "url": "https://www.uniprot.org/uniprotkb/Q6P2H3" }, { "database": "PubMed", "id": "32107292", "url": "https://pubmed.ncbi.nlm.nih.gov/32107292" }, { "database": "PubMed", "id": "29712910", "url": "https://pubmed.ncbi.nlm.nih.gov/29712910" } ], "uniprot_canonical_ac": "Q6P2H3-1" } ], "phosphorylation": [ { "start_pos": 305, "end_pos": 305, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O00444", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O00444" }, { "database": "PubMed", "id": "20032307", "url": "https://pubmed.ncbi.nlm.nih.gov/20032307" }, { "database": "PubMed", "id": "25174401", "url": "https://pubmed.ncbi.nlm.nih.gov/25174401" }, { "database": "PubMed", "id": "29712910", "url": "https://pubmed.ncbi.nlm.nih.gov/29712910" }, { "database": "PubMed", "id": "31000710", "url": "https://pubmed.ncbi.nlm.nih.gov/31000710" }, { "database": "PubMed", "id": "31142743", "url": "https://pubmed.ncbi.nlm.nih.gov/31142743" } ], "site_lbl": "Ser305", "uniprot_canonical_ac": "O00444-1" } ], "record_id": "pubmed.29712910", "abstract": "", "glycosylation": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Phase separation of Polo-like kinase 4 by autoactivation and clustering drives centriole biogenesis.", "journal": "Nature communications", "date": "2019", "authors": "Park JE, Zhang L, Bang JK, Andresson T, DiMaio F, Lee KS", "reference": { "type": "PubMed", "id": "31672968", "url": "https://pubmed.ncbi.nlm.nih.gov/31672968" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q15468-1", "protein_name": "SCL-interrupting locus protein", "gene_name": "STIL", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q15468", "url": "https://www.uniprot.org/uniprotkb/Q15468" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 1108, "end_pos": 1108, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q15468", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q15468" }, { "database": "PubMed", "id": "26101219", "url": "https://pubmed.ncbi.nlm.nih.gov/26101219" }, { "database": "PubMed", "id": "31672968", "url": "https://pubmed.ncbi.nlm.nih.gov/31672968" } ], "site_lbl": "Ser1108", "uniprot_canonical_ac": "Q15468-1" } ], "record_id": "pubmed.31672968", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Direct interaction between CEP85 and STIL mediates PLK4-driven directed cell migration.", "journal": "Journal of cell science", "date": "2020", "authors": "Liu Y, Kim J, Philip R, Sridhar V, Chandrashekhar M, Moffat J, van Breugel M, Pelletier L", "reference": { "type": "PubMed", "id": "32107292", "url": "https://pubmed.ncbi.nlm.nih.gov/32107292" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q15468-1", "protein_name": "SCL-interrupting locus protein", "gene_name": "STIL", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6P2H3-1", "protein_name": "Centrosomal protein of 85 kDa", "gene_name": "CEP85", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q15468", "url": "https://www.uniprot.org/uniprotkb/Q15468" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 640, "end_pos": 640, "sequence_org": "Q", "sequence_mut": "A", "comment": "Strongly reduced interaction with STIL. Strongly reduced interaction with STIL; when associated with A-644. Does not affect interaction wit PLKA; when associated with A-644.", "evidence": [ { "database": "UniProtKB", "id": "Q6P2H3", "url": "https://www.uniprot.org/uniprotkb/Q6P2H3" }, { "database": "PubMed", "id": "32107292", "url": "https://pubmed.ncbi.nlm.nih.gov/32107292" }, { "database": "PubMed", "id": "29712910", "url": "https://pubmed.ncbi.nlm.nih.gov/29712910" } ], "uniprot_canonical_ac": "Q6P2H3-1" }, { "start_pos": 644, "end_pos": 644, "sequence_org": "E", "sequence_mut": "A", "comment": "Strongly reduced interaction with STIL. Strongly reduced interaction with STIL; when associated with A-640. Does not affect interaction wit PLKA; when associated with A-644.", "evidence": [ { "database": "UniProtKB", "id": "Q6P2H3", "url": "https://www.uniprot.org/uniprotkb/Q6P2H3" }, { "database": "PubMed", "id": "32107292", "url": "https://pubmed.ncbi.nlm.nih.gov/32107292" }, { "database": "PubMed", "id": "29712910", "url": "https://pubmed.ncbi.nlm.nih.gov/29712910" } ], "uniprot_canonical_ac": "Q6P2H3-1" } ], "record_id": "pubmed.32107292", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "STIL/AURKA axis promotes cell proliferation by influencing primary cilia formation in bladder cancer.", "journal": "Journal of translational medicine", "date": "2023-04-26", "authors": "Li Jingxian, Qi Yuanjiong, Li Bo, Liu Yan, Yang Kuo, Zhang Zhihong, Zhu Jianqiang, Du E", "reference": { "type": "PubMed", "id": "37101292", "url": "https://pubmed.ncbi.nlm.nih.gov/37101292" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q15468-1", "protein_name": "SCL-interrupting locus protein", "gene_name": "STIL", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q15468", "url": "https://www.uniprot.org/uniprotkb/Q15468" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.37101292", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Molecular Mechanism of STIL Coiled-Coil Domain Oligomerization.", "journal": "International journal of molecular sciences", "date": "2023-09-27", "authors": "Shamir Mai, Martin Freddie J O, Woolfson Derek N, Friedler Assaf", "reference": { "type": "PubMed", "id": "37834064", "url": "https://pubmed.ncbi.nlm.nih.gov/37834064" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q15468-1", "protein_name": "SCL-interrupting locus protein", "gene_name": "STIL", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q15468", "url": "https://www.uniprot.org/uniprotkb/Q15468" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.37834064", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Expression of the SIL gene is correlated with growth induction and cellular proliferation.", "journal": "Cell growth & differentiation : the molecular biology journal of the American Association for Cancer Research", "date": "1997", "authors": "Izraeli S, Colaizzo-Anas T, Bertness VL, Mani K, Aplan PD, Kirsch IR", "reference": { "type": "PubMed", "id": "9372240", "url": "https://pubmed.ncbi.nlm.nih.gov/9372240" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q15468-1", "protein_name": "SCL-interrupting locus protein", "gene_name": "STIL", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q15468", "url": "https://www.uniprot.org/uniprotkb/Q15468" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.9372240", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "JM2, encoding a fork head-related protein, is mutated in X-linked autoimmunity-allergic disregulation syndrome.", "journal": "The Journal of clinical investigation", "date": "2000", "authors": "Chatila TA, Blaeser F, Ho N, Lederman HM, Voulgaropoulos C, Helms C, Bowcock AM", "reference": { "type": "PubMed", "id": "11120765", "url": "https://pubmed.ncbi.nlm.nih.gov/11120765" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9BZS1-1", "protein_name": "Forkhead box protein P3", "gene_name": "FOXP3", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9BZS1", "url": "https://www.uniprot.org/uniprotkb/Q9BZS1" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.11120765", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "X-linked neonatal diabetes mellitus, enteropathy and endocrinopathy syndrome is the human equivalent of mouse scurfy.", "journal": "Nature genetics", "date": "2001", "authors": "Wildin RS, Ramsdell F, Peake J, Faravelli F, Casanova JL, Buist N, Levy-Lahad E, Mazzella M, Goulet O, Perroni L, Bricarelli FD, Byrne G, McEuen M, Proll S, Appleby M, Brunkow ME", "reference": { "type": "PubMed", "id": "11137992", "url": "https://pubmed.ncbi.nlm.nih.gov/11137992" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9BZS1-1", "protein_name": "Forkhead box protein P3", "gene_name": "FOXP3", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9BZS1", "url": "https://www.uniprot.org/uniprotkb/Q9BZS1" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.11137992", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The immune dysregulation, polyendocrinopathy, enteropathy, X-linked syndrome (IPEX) is caused by mutations of FOXP3.", "journal": "Nature genetics", "date": "2001", "authors": "Bennett CL, Christie J, Ramsdell F, Brunkow ME, Ferguson PJ, Whitesell L, Kelly TE, Saulsbury FT, Chance PF, Ochs HD", "reference": { "type": "PubMed", "id": "11137993", "url": "https://pubmed.ncbi.nlm.nih.gov/11137993" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9BZS1-1", "protein_name": "Forkhead box protein P3", "gene_name": "FOXP3", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9BZS1", "url": "https://www.uniprot.org/uniprotkb/Q9BZS1" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.11137993", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Disruption of a new forkhead/winged-helix protein, scurfin, results in the fatal lymphoproliferative disorder of the scurfy mouse.", "journal": "Nat. Genet.", "date": "2001", "authors": "Brunkow M E, Jeffery E W, Hjerrild K A, Paeper B, Clark L B, Yasayko S A, Wilkinson J E, Galas D, Ziegler S F, Ramsdell F", "reference": { "type": "PubMed", "id": "11138001", "url": "https://pubmed.ncbi.nlm.nih.gov/11138001" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9BZS1-1", "protein_name": "Forkhead box protein P3", "gene_name": "FOXP3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99JB6-1", "protein_name": "Forkhead box protein P3", "gene_name": "Foxp3", "tax_name": "Mouse" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9BZS1", "url": "https://www.uniprot.org/uniprotkb/Q9BZS1" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.11138001", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Novel mutations of FOXP3 in two Japanese patients with immune dysregulation, polyendocrinopathy, enteropathy, X linked syndrome (IPEX).", "journal": "Journal of medical genetics", "date": "2001", "authors": "Kobayashi I, Shiari R, Yamada M, Kawamura N, Okano M, Yara A, Iguchi A, Ishikawa N, Ariga T, Sakiyama Y, Ochs HD, Kobayashi K", "reference": { "type": "PubMed", "id": "11768393", "url": "https://pubmed.ncbi.nlm.nih.gov/11768393" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9BZS1-1", "protein_name": "Forkhead box protein P3", "gene_name": "FOXP3", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9BZS1", "url": "https://www.uniprot.org/uniprotkb/Q9BZS1" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.11768393", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Isoform-specific inhibition of ROR alpha-mediated transcriptional activation by human FOXP3.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "2008", "authors": "Du J, Huang C, Zhou B, Ziegler SF", "reference": { "type": "PubMed", "id": "18354202", "url": "https://pubmed.ncbi.nlm.nih.gov/18354202" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9BZS1-1", "protein_name": "Forkhead box protein P3", "gene_name": "FOXP3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35398-2", "protein_name": "Nuclear receptor ROR-alpha", "gene_name": "RORA", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9BZS1", "url": "https://www.uniprot.org/uniprotkb/Q9BZS1" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 95, "end_pos": 96, "sequence_org": "LL", "sequence_mut": "AA", "comment": "Loss of interaction with RORA.", "evidence": [ { "database": "UniProtKB", "id": "Q9BZS1", "url": "https://www.uniprot.org/uniprotkb/Q9BZS1" }, { "database": "PubMed", "id": "18354202", "url": "https://pubmed.ncbi.nlm.nih.gov/18354202" } ], "uniprot_canonical_ac": "Q9BZS1-1" }, { "start_pos": 510, "end_pos": 511, "sequence_org": "LF", "sequence_mut": "AA", "comment": "Decreases interaction with NCOA2. Loss of interaction with FOXP3.", "evidence": [ { "database": "UniProtKB", "id": "P35398", "url": "https://www.uniprot.org/uniprotkb/P35398" }, { "database": "PubMed", "id": "10478845", "url": "https://pubmed.ncbi.nlm.nih.gov/10478845" }, { "database": "PubMed", "id": "18354202", "url": "https://pubmed.ncbi.nlm.nih.gov/18354202" } ], "uniprot_canonical_ac": "P35398-2" } ], "record_id": "pubmed.18354202", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Clinical and molecular profile of a new series of patients with immune dysregulation, polyendocrinopathy, enteropathy, X-linked syndrome: inconsistent correlation between forkhead box protein 3 expression and disease severity.", "journal": "The Journal of allergy and clinical immunology", "date": "2008", "authors": "Gambineri E, Perroni L, Passerini L, Bianchi L, Doglioni C, Meschi F, Bonfanti R, Sznajer Y, Tommasini A, Lawitschka A, Junker A, Dunstheimer D, Heidemann PH, Cazzola G, Cipolli M, Friedrich W, Janic D, Azzi N, Richmond E, Vignola S, Barabino A, Chiumello G, Azzari C, Roncarolo MG, Bacchetta R", "reference": { "type": "PubMed", "id": "18951619", "url": "https://pubmed.ncbi.nlm.nih.gov/18951619" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9BZS1-1", "protein_name": "Forkhead box protein P3", "gene_name": "FOXP3", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9BZS1", "url": "https://www.uniprot.org/uniprotkb/Q9BZS1" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.18951619", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Foxp3 processing by proprotein convertases and control of regulatory T cell function.", "journal": "The Journal of biological chemistry", "date": "2009", "authors": "de Zoeten EF, Lee I, Wang L, Chen C, Ge G, Wells AD, Hancock WW, Ozkaynak E", "reference": { "type": "PubMed", "id": "19117830", "url": "https://pubmed.ncbi.nlm.nih.gov/19117830" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9BZS1-1", "protein_name": "Forkhead box protein P3", "gene_name": "FOXP3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99JB6-1", "protein_name": "Forkhead box protein P3", "gene_name": "Foxp3", "tax_name": "Mouse" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9BZS1", "url": "https://www.uniprot.org/uniprotkb/Q9BZS1" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 414, "end_pos": 417, "sequence_org": "RKKR", "sequence_mut": "PNNW", "comment": "Loss of ability to suppress the proliferation of effector T-cells.", "evidence": [ { "database": "UniProtKB", "id": "Q99JB6", "url": "https://www.uniprot.org/uniprotkb/Q99JB6" }, { "database": "PubMed", "id": "19117830", "url": "https://pubmed.ncbi.nlm.nih.gov/19117830" } ], "uniprot_canonical_ac": "Q99JB6-1" }, { "start_pos": 414, "end_pos": 417, "sequence_org": "RKKR", "sequence_mut": "QNKS", "comment": "Loss of proteolytic processing.", "evidence": [ { "database": "UniProtKB", "id": "Q99JB6", "url": "https://www.uniprot.org/uniprotkb/Q99JB6" }, { "database": "PubMed", "id": "19117830", "url": "https://pubmed.ncbi.nlm.nih.gov/19117830" } ], "uniprot_canonical_ac": "Q99JB6-1" }, { "start_pos": 48, "end_pos": 51, "sequence_org": "RDLR", "sequence_mut": "HDLH", "comment": "Loss of proteolytic processing.", "evidence": [ { "database": "UniProtKB", "id": "Q99JB6", "url": "https://www.uniprot.org/uniprotkb/Q99JB6" }, { "database": "PubMed", "id": "19117830", "url": "https://pubmed.ncbi.nlm.nih.gov/19117830" } ], "uniprot_canonical_ac": "Q99JB6-1" } ], "record_id": "pubmed.19117830", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Activation of the aryl hydrocarbon receptor induces human type 1 regulatory T cell-like and Foxp3(+) regulatory T cells.", "journal": "Nat. Immunol.", "date": "2010", "authors": "Gandhi Roopali, Kumar Deepak, Burns Evan J, Nadeau Meghan, Dake Ben, Laroni Alice, Kozoriz Deneen, Weiner Howard L, Quintana Francisco J", "reference": { "type": "PubMed", "id": "20676092", "url": "https://pubmed.ncbi.nlm.nih.gov/20676092" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9BZS1-1", "protein_name": "Forkhead box protein P3", "gene_name": "FOXP3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UKT9-1", "protein_name": "Zinc finger protein Aiolos", "gene_name": "IKZF3", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9BZS1", "url": "https://www.uniprot.org/uniprotkb/Q9BZS1" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.20676092", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Three novel acetylation sites in the Foxp3 transcription factor regulate the suppressive activity of regulatory T cells.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "2012", "authors": "Kwon HS, Lim HW, Wu J, Schnolzer M, Verdin E, Ott M", "reference": { "type": "PubMed", "id": "22312127", "url": "https://pubmed.ncbi.nlm.nih.gov/22312127" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9BZS1-1", "protein_name": "Forkhead box protein P3", "gene_name": "FOXP3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99JB6-1", "protein_name": "Forkhead box protein P3", "gene_name": "Foxp3", "tax_name": "Mouse" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9BZS1", "url": "https://www.uniprot.org/uniprotkb/Q9BZS1" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.22312127", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Subcellular localization of FOXP3 in human regulatory and nonregulatory T cells.", "journal": "European journal of immunology", "date": "2012", "authors": "Magg T, Mannert J, Ellwart JW, Schmid I, Albert MH", "reference": { "type": "PubMed", "id": "22678915", "url": "https://pubmed.ncbi.nlm.nih.gov/22678915" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9BZS1-1", "protein_name": "Forkhead box protein P3", "gene_name": "FOXP3", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9BZS1", "url": "https://www.uniprot.org/uniprotkb/Q9BZS1" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 242, "end_pos": 242, "sequence_org": "L", "sequence_mut": "A", "comment": "Decrease in nuclear export; when associated with A-246 and A-248.", "evidence": [ { "database": "UniProtKB", "id": "Q9BZS1", "url": "https://www.uniprot.org/uniprotkb/Q9BZS1" }, { "database": "PubMed", "id": "22678915", "url": "https://pubmed.ncbi.nlm.nih.gov/22678915" } ], "uniprot_canonical_ac": "Q9BZS1-1" }, { "start_pos": 246, "end_pos": 246, "sequence_org": "L", "sequence_mut": "A", "comment": "Decrease in nuclear export; when associated with A-242 and A-248.", "evidence": [ { "database": "UniProtKB", "id": "Q9BZS1", "url": "https://www.uniprot.org/uniprotkb/Q9BZS1" }, { "database": "PubMed", "id": "22678915", "url": "https://pubmed.ncbi.nlm.nih.gov/22678915" } ], "uniprot_canonical_ac": "Q9BZS1-1" }, { "start_pos": 248, "end_pos": 248, "sequence_org": "L", "sequence_mut": "A", "comment": "Decrease in nuclear export; when associated with A-242 and A-246.", "evidence": [ { "database": "UniProtKB", "id": "Q9BZS1", "url": "https://www.uniprot.org/uniprotkb/Q9BZS1" }, { "database": "PubMed", "id": "22678915", "url": "https://pubmed.ncbi.nlm.nih.gov/22678915" } ], "uniprot_canonical_ac": "Q9BZS1-1" }, { "start_pos": 415, "end_pos": 416, "sequence_org": "KK", "sequence_mut": "EE", "comment": "Loss of nuclear localization.", "evidence": [ { "database": "UniProtKB", "id": "Q9BZS1", "url": "https://www.uniprot.org/uniprotkb/Q9BZS1" }, { "database": "PubMed", "id": "22678915", "url": "https://pubmed.ncbi.nlm.nih.gov/22678915" } ], "uniprot_canonical_ac": "Q9BZS1-1" }, { "start_pos": 69, "end_pos": 69, "sequence_org": "L", "sequence_mut": "A", "comment": "Decrease in nuclear export; when associated with A-71, A-74 and A-76.", "evidence": [ { "database": "UniProtKB", "id": "Q9BZS1", "url": "https://www.uniprot.org/uniprotkb/Q9BZS1" }, { "database": "PubMed", "id": "22678915", "url": "https://pubmed.ncbi.nlm.nih.gov/22678915" } ], "uniprot_canonical_ac": "Q9BZS1-1" }, { "start_pos": 71, "end_pos": 71, "sequence_org": "L", "sequence_mut": "A", "comment": "Decrease in nuclear export; when associated with A-69, A-74 and A-76.", "evidence": [ { "database": "UniProtKB", "id": "Q9BZS1", "url": "https://www.uniprot.org/uniprotkb/Q9BZS1" }, { "database": "PubMed", "id": "22678915", "url": "https://pubmed.ncbi.nlm.nih.gov/22678915" } ], "uniprot_canonical_ac": "Q9BZS1-1" }, { "start_pos": 74, "end_pos": 74, "sequence_org": "L", "sequence_mut": "A", "comment": "Decrease in nuclear export; when associated with A-69, A-71 and A-76.", "evidence": [ { "database": "UniProtKB", "id": "Q9BZS1", "url": "https://www.uniprot.org/uniprotkb/Q9BZS1" }, { "database": "PubMed", "id": "22678915", "url": "https://pubmed.ncbi.nlm.nih.gov/22678915" } ], "uniprot_canonical_ac": "Q9BZS1-1" }, { "start_pos": 76, "end_pos": 76, "sequence_org": "L", "sequence_mut": "A", "comment": "Decrease in nuclear export; when associated with A-69, A-71 and A-74.", "evidence": [ { "database": "UniProtKB", "id": "Q9BZS1", "url": "https://www.uniprot.org/uniprotkb/Q9BZS1" }, { "database": "PubMed", "id": "22678915", "url": "https://pubmed.ncbi.nlm.nih.gov/22678915" } ], "uniprot_canonical_ac": "Q9BZS1-1" } ], "record_id": "pubmed.22678915", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "A novel function for FOXP3 in humans: intrinsic regulation of conventional T cells.", "journal": "Blood", "date": "2013-02-21", "authors": "McMurchy Alicia N, Gillies Jana, Gizzi Maria Concetta, Riba Michela, Garcia-Manteiga Jose Manuel, Cittaro Davide, Lazarevic Dejan, Di Nunzio Sara, Piras Ignazio S, Bulfone Alessandro, Roncarolo Maria Grazia, Stupka Elia, Bacchetta Rosa, Levings Megan K", "reference": { "type": "PubMed", "id": "23169781", "url": "https://pubmed.ncbi.nlm.nih.gov/23169781" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9BZS1-1", "protein_name": "Forkhead box protein P3", "gene_name": "FOXP3", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9BZS1", "url": "https://www.uniprot.org/uniprotkb/Q9BZS1" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.23169781", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The role of FOXP3 in regulating immune responses.", "journal": "International reviews of immunology", "date": "2014-03", "authors": "Vent-Schmidt Jens, Han Jonathan M, MacDonald Katherine G, Levings Megan K", "reference": { "type": "PubMed", "id": "23947341", "url": "https://pubmed.ncbi.nlm.nih.gov/23947341" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9BZS1-1", "protein_name": "Forkhead box protein P3", "gene_name": "FOXP3", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9BZS1", "url": "https://www.uniprot.org/uniprotkb/Q9BZS1" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.23947341", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Stabilization of the transcription factor Foxp3 by the deubiquitinase USP7 increases Treg-cell-suppressive capacity.", "journal": "Immunity", "date": "2013", "authors": "van Loosdregt J, Fleskens V, Fu J, Brenkman AB, Bekker CP, Pals CE, Meerding J, Berkers CR, Barbi J, Grone A, Sijts AJ, Maurice MM, Kalkhoven E, Prakken BJ, Ovaa H, Pan F, Zaiss DM, Coffer PJ", "reference": { "type": "PubMed", "id": "23973222", "url": "https://pubmed.ncbi.nlm.nih.gov/23973222" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9BZS1-1", "protein_name": "Forkhead box protein P3", "gene_name": "FOXP3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99JB6-1", "protein_name": "Forkhead box protein P3", "gene_name": "Foxp3", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "Q93009-1", "protein_name": "Ubiquitin C-terminal hydrolase 7", "gene_name": "USP7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6A4J8-1", "protein_name": "Ubiquitin C-terminal hydrolase 7", "gene_name": "Usp7", "tax_name": "Mouse" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9BZS1", "url": "https://www.uniprot.org/uniprotkb/Q9BZS1" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.23973222", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 4 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Phosphorylation of FOXP3 by LCK downregulates MMP9 expression and represses cell invasion.", "journal": "PloS one", "date": "2013", "authors": "Nakahira K, Morita A, Kim NS, Yanagihara I", "reference": { "type": "PubMed", "id": "24155921", "url": "https://pubmed.ncbi.nlm.nih.gov/24155921" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9BZS1-1", "protein_name": "Forkhead box protein P3", "gene_name": "FOXP3", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9BZS1", "url": "https://www.uniprot.org/uniprotkb/Q9BZS1" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 342, "end_pos": 342, "kinase_uniprot_canonical_ac": "P06239-1", "kinase_gene_name": "LCK", "residue": "Tyr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q9BZS1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9BZS1" }, { "database": "PubMed", "id": "24155921", "url": "https://pubmed.ncbi.nlm.nih.gov/24155921" } ], "site_lbl": "Tyr342", "uniprot_canonical_ac": "Q9BZS1-1" }, { "start_pos": 342, "end_pos": 342, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q9BZS1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9BZS1" }, { "database": "PubMed", "id": "24155921", "url": "https://pubmed.ncbi.nlm.nih.gov/24155921" }, { "database": "PubMed", "id": "30011797", "url": "https://pubmed.ncbi.nlm.nih.gov/30011797" } ], "site_lbl": "Tyr342", "uniprot_canonical_ac": "Q9BZS1-1" } ], "record_id": "pubmed.24155921", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Searching for the Achilles Heel of FOXP3.", "journal": "Front. Oncol.", "date": "2013", "authors": "Lozano Teresa, Casares Noelia, Lasarte Juan Jos\u00e9", "reference": { "type": "PubMed", "id": "24350059", "url": "https://pubmed.ncbi.nlm.nih.gov/24350059" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9BZS1-1", "protein_name": "Forkhead box protein P3", "gene_name": "FOXP3", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9BZS1", "url": "https://www.uniprot.org/uniprotkb/Q9BZS1" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.24350059", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Forkhead box P3: the peacekeeper of the immune system.", "journal": "International reviews of immunology", "date": "2014-03", "authors": "Passerini Laura, Santoni de Sio Francesca Romana, Roncarolo Maria Grazia, Bacchetta Rosa", "reference": { "type": "PubMed", "id": "24354325", "url": "https://pubmed.ncbi.nlm.nih.gov/24354325" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9BZS1-1", "protein_name": "Forkhead box protein P3", "gene_name": "FOXP3", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9BZS1", "url": "https://www.uniprot.org/uniprotkb/Q9BZS1" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.24354325", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "FOXP3 and scurfy: how it all began.", "journal": "Nature reviews. Immunology", "date": "2014-05", "authors": "Ramsdell Fred, Ziegler Steven F", "reference": { "type": "PubMed", "id": "24722479", "url": "https://pubmed.ncbi.nlm.nih.gov/24722479" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9BZS1-1", "protein_name": "Forkhead box protein P3", "gene_name": "FOXP3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99JB6-1", "protein_name": "Forkhead box protein P3", "gene_name": "Foxp3", "tax_name": "Mouse" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9BZS1", "url": "https://www.uniprot.org/uniprotkb/Q9BZS1" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.24722479", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Post-translational modification networks regulating FOXP3 function.", "journal": "Trends Immunol.", "date": "2014", "authors": "van Loosdregt Jorg, Coffer Paul J", "reference": { "type": "PubMed", "id": "25047417", "url": "https://pubmed.ncbi.nlm.nih.gov/25047417" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9BZS1-1", "protein_name": "Forkhead box protein P3", "gene_name": "FOXP3", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9BZS1", "url": "https://www.uniprot.org/uniprotkb/Q9BZS1" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.25047417", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "PIM1 kinase phosphorylates the human transcription factor FOXP3 at serine 422 to negatively regulate its activity under inflammation.", "journal": "The Journal of biological chemistry", "date": "2014", "authors": "Li Z, Lin F, Zhuo C, Deng G, Chen Z, Yin S, Gao Z, Piccioni M, Tsun A, Cai S, Zheng SG, Zhang Y, Li B", "reference": { "type": "PubMed", "id": "25096571", "url": "https://pubmed.ncbi.nlm.nih.gov/25096571" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9BZS1-1", "protein_name": "Forkhead box protein P3", "gene_name": "FOXP3", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9BZS1", "url": "https://www.uniprot.org/uniprotkb/Q9BZS1" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 418, "end_pos": 418, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "Q9BZS1", "url": "https://www.uniprot.org/uniprotkb/Q9BZS1" }, { "database": "PubMed", "id": "23396208", "url": "https://pubmed.ncbi.nlm.nih.gov/23396208" }, { "database": "iPTMnet", "id": "Q9BZS1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9BZS1" }, { "database": "PubMed", "id": "25096571", "url": "https://pubmed.ncbi.nlm.nih.gov/25096571" }, { "database": "PubMed", "id": "30011797", "url": "https://pubmed.ncbi.nlm.nih.gov/30011797" } ], "site_lbl": "Ser418", "uniprot_canonical_ac": "Q9BZS1-1" }, { "start_pos": 422, "end_pos": 422, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q9BZS1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9BZS1" }, { "database": "PubMed", "id": "25096571", "url": "https://pubmed.ncbi.nlm.nih.gov/25096571" }, { "database": "PubMed", "id": "29352742", "url": "https://pubmed.ncbi.nlm.nih.gov/29352742" } ], "site_lbl": "Ser422", "uniprot_canonical_ac": "Q9BZS1-1" } ], "record_id": "pubmed.25096571", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "DNA binding by FOXP3 domain-swapped dimer suggests mechanisms of long-range chromosomal interactions.", "journal": "Nucleic Acids Res.", "date": "2015", "authors": "Chen Yongheng, Chen Chunxia, Zhang Zhe, Liu Chun-Chi, Johnson Matthew E, Espinoza Celso A, Edsall Lee E, Ren Bing, Zhou Xianghong Jasmine, Grant Struan F A, Wells Andrew D, Chen Lin", "reference": { "type": "PubMed", "id": "25567984", "url": "https://pubmed.ncbi.nlm.nih.gov/25567984" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9BZS1-1", "protein_name": "Forkhead box protein P3", "gene_name": "FOXP3", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9BZS1", "url": "https://www.uniprot.org/uniprotkb/Q9BZS1" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.25567984", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Cambogin suppresses dextran sulphate sodium-induced colitis by enhancing Treg cell stability and function.", "journal": "British journal of pharmacology", "date": "2018-04", "authors": "Lu Yue, Kim Na-Mi, Jiang Yi-Wen, Zhang Hong, Zheng Dan, Zhu Fu-Xiang, Liang Rui, Li Bin, Xu Hong-Xi", "reference": { "type": "PubMed", "id": "29352742", "url": "https://pubmed.ncbi.nlm.nih.gov/29352742" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9BZS1-1", "protein_name": "Forkhead box protein P3", "gene_name": "FOXP3", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9BZS1", "url": "https://www.uniprot.org/uniprotkb/Q9BZS1" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 422, "end_pos": 422, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q9BZS1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9BZS1" }, { "database": "PubMed", "id": "25096571", "url": "https://pubmed.ncbi.nlm.nih.gov/25096571" }, { "database": "PubMed", "id": "29352742", "url": "https://pubmed.ncbi.nlm.nih.gov/29352742" } ], "site_lbl": "Ser422", "uniprot_canonical_ac": "Q9BZS1-1" } ], "record_id": "pubmed.29352742", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "FOXP3 Activates SUMO-Conjugating UBC9 Gene in MCF7 Breast Cancer Cells.", "journal": "International journal of molecular sciences", "date": "2018", "authors": "Wang CM, Yang WH, Liu R, Wang L, Yang WH", "reference": { "type": "PubMed", "id": "30011797", "url": "https://pubmed.ncbi.nlm.nih.gov/30011797" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9BZS1-1", "protein_name": "Forkhead box protein P3", "gene_name": "FOXP3", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9BZS1", "url": "https://www.uniprot.org/uniprotkb/Q9BZS1" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 342, "end_pos": 342, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q9BZS1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9BZS1" }, { "database": "PubMed", "id": "24155921", "url": "https://pubmed.ncbi.nlm.nih.gov/24155921" }, { "database": "PubMed", "id": "30011797", "url": "https://pubmed.ncbi.nlm.nih.gov/30011797" } ], "site_lbl": "Tyr342", "uniprot_canonical_ac": "Q9BZS1-1" }, { "start_pos": 418, "end_pos": 418, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "Q9BZS1", "url": "https://www.uniprot.org/uniprotkb/Q9BZS1" }, { "database": "PubMed", "id": "23396208", "url": "https://pubmed.ncbi.nlm.nih.gov/23396208" }, { "database": "iPTMnet", "id": "Q9BZS1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9BZS1" }, { "database": "PubMed", "id": "25096571", "url": "https://pubmed.ncbi.nlm.nih.gov/25096571" }, { "database": "PubMed", "id": "30011797", "url": "https://pubmed.ncbi.nlm.nih.gov/30011797" } ], "site_lbl": "Ser418", "uniprot_canonical_ac": "Q9BZS1-1" } ], "record_id": "pubmed.30011797", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Depleting T regulatory cells by targeting intracellular Foxp3 with a TCR mimic antibody.", "journal": "Oncoimmunology", "date": "2019", "authors": "Dao Tao, Mun Sung Soo, Scott Andrew C, Jarvis Casey A, Korontsvit Tatyana, Yang Zhiyuan, Liu Lianxing, Klatt Martin G, Guerreiro Manuel, Selvakumar Annamalai, Brea Elliott J, Oh Claire, Liu Cheng, Scheinberg David A", "reference": { "type": "PubMed", "id": "31143508", "url": "https://pubmed.ncbi.nlm.nih.gov/31143508" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9BZS1-1", "protein_name": "Forkhead box protein P3", "gene_name": "FOXP3", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9BZS1", "url": "https://www.uniprot.org/uniprotkb/Q9BZS1" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.31143508", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Staphylococcus aureus alpha-toxin inhibits CD8+ T cell-mediated killing of cancer cells in cutaneous T-cell lymphoma.", "journal": "Oncoimmunology", "date": "2020", "authors": "Bl\u00fcmel Edda, Munir Ahmad Shamaila, Nastasi Claudia, Willerslev-Olsen Andreas, Gluud Maria, Fredholm Simon, Hu Tengpeng, Surewaard Bas G J, Lindahl Lise M, Fogh Hanne, Koralov Sergei B, Rahbek Gjerdrum Lise Mette, Clark Rachael A, Iversen Lars, Krejsgaard Thorbj\u00f8rn, Bonefeld Charlotte Menn\u00e9, Geisler Carsten, Becker J\u00fcrgen C, Woetmann Anders, Andersen Mads Hald, Buus Terkild Brink, \u00d8dum Niels", "reference": { "type": "PubMed", "id": "32363124", "url": "https://pubmed.ncbi.nlm.nih.gov/32363124" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9BZS1-1", "protein_name": "Forkhead box protein P3", "gene_name": "FOXP3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NZQ7-1", "protein_name": "Programmed cell death 1 ligand 1", "gene_name": "CD274", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16655-1", "protein_name": "Melanoma antigen recognized by T-cells 1", "gene_name": "MLANA", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9BZS1", "url": "https://www.uniprot.org/uniprotkb/Q9BZS1" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.32363124", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The deubiquitinase USP44 promotes Treg function during inflammation by preventing FOXP3 degradation.", "journal": "EMBO reports", "date": "2020", "authors": "Yang J, Wei P, Barbi J, Huang Q, Yang E, Bai Y, Nie J, Gao Y, Tao J, Lu Y, Xie C, Hou X, Ren J, Wu X, Meng J, Zhang Y, Fu J, Kou W, Gao Y, Chen Z, Liang R, Tsun A, Li D, Guo W, Zhang S, Zheng SG, Niu J, Galardy P, Tong X, Shi G, Li H, Pan F, Li B", "reference": { "type": "PubMed", "id": "32644293", "url": "https://pubmed.ncbi.nlm.nih.gov/32644293" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9BZS1-1", "protein_name": "Forkhead box protein P3", "gene_name": "FOXP3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H0E7-1", "protein_name": "Ubiquitin carboxyl-terminal hydrolase 44", "gene_name": "USP44", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9BZS1", "url": "https://www.uniprot.org/uniprotkb/Q9BZS1" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.32644293", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Genetic and Epigenetic Association of FOXP3 with Papillary Thyroid Cancer Predisposition.", "journal": "International journal of molecular sciences", "date": "2024-06-28", "authors": "Achilla Charoula, Chorti Angeliki, Papavramidis Theodosios, Angelis Lefteris, Chatzikyriakidou Anthoula", "reference": { "type": "PubMed", "id": "39000267", "url": "https://pubmed.ncbi.nlm.nih.gov/39000267" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9BZS1-1", "protein_name": "Forkhead box protein P3", "gene_name": "FOXP3", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9BZS1", "url": "https://www.uniprot.org/uniprotkb/Q9BZS1" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.39000267", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Deciphering the role of protein kinase A in the control of FoxP3 expression in regulatory T cells in health and autoimmunity.", "journal": "Scientific reports", "date": "2024-07-30", "authors": "Lepore Maria Teresa, Bruzzaniti Sara, La Rocca Claudia, Fusco Clorinda, Carbone Fortunata, Mottola Maria, Zuccarelli Bruno, Lanzillo Roberta, Brescia Morra Vincenzo, Maniscalco Giorgia Teresa, De Simone Salvatore, Procaccini Claudio, Porcellini Antonio, De Rosa Veronica, Galgani Mario, Cassano Silvana, Matarese Giuseppe", "reference": { "type": "PubMed", "id": "39080325", "url": "https://pubmed.ncbi.nlm.nih.gov/39080325" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9BZS1-1", "protein_name": "Forkhead box protein P3", "gene_name": "FOXP3", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9BZS1", "url": "https://www.uniprot.org/uniprotkb/Q9BZS1" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.39080325", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Role of Forkhead Box P3 in IFN\u03b3-Mediated PD-L1 Expression and Bladder Cancer Epithelial-to-Mesenchymal Transition.", "journal": "Cancer research communications", "date": "2024-08-01", "authors": "Zhang Hanwei, Ly Ann, Chou Emily, Wang Liang, Zhang Paul, Prado Kris, Gu Yiqian, Pellegrini Matteo, Chin Arnold I", "reference": { "type": "PubMed", "id": "39099201", "url": "https://pubmed.ncbi.nlm.nih.gov/39099201" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9BZS1-1", "protein_name": "Forkhead box protein P3", "gene_name": "FOXP3", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9BZS1", "url": "https://www.uniprot.org/uniprotkb/Q9BZS1" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.39099201", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Transcription factor Ikzf1 associates with Foxp3 to repress gene expression in Treg cells and limit autoimmunity and anti-tumor immunity.", "journal": "Immunity", "date": "2024-09-10", "authors": "Ichiyama Kenji, Long Jia, Kobayashi Yusuke, Horita Yuji, Kinoshita Takeshi, Nakamura Yamami, Kominami Chizuko, Georgopoulos Katia, Sakaguchi Shimon", "reference": { "type": "PubMed", "id": "39111316", "url": "https://pubmed.ncbi.nlm.nih.gov/39111316" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9BZS1-1", "protein_name": "Forkhead box protein P3", "gene_name": "FOXP3", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9BZS1", "url": "https://www.uniprot.org/uniprotkb/Q9BZS1" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.39111316", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Antisense targeting of FOXP3+ Tregs to boost anti-tumor immunity.", "journal": "Frontiers in immunology", "date": "2024", "authors": "Akimova Tatiana, Wang Liqing, Bartosh Zhanna, Christensen Lanette M, Eruslanov Evgeniy, Singhal Sunil, Aishwarya Veenu, Hancock Wayne W", "reference": { "type": "PubMed", "id": "39234236", "url": "https://pubmed.ncbi.nlm.nih.gov/39234236" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9BZS1-1", "protein_name": "Forkhead box protein P3", "gene_name": "FOXP3", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9BZS1", "url": "https://www.uniprot.org/uniprotkb/Q9BZS1" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.39234236", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The human membrane progesterone receptor gene: genomic structure and promoter analysis.", "journal": "DNA Seq.", "date": "2001", "authors": "Bernauer S, Wehling M, Gerdes D, Falkenstein E", "reference": { "type": "PubMed", "id": "11697142", "url": "https://pubmed.ncbi.nlm.nih.gov/11697142" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O00264-1", "protein_name": "Membrane-associated progesterone receptor component 1", "gene_name": "PGRMC1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "O00264", "url": "https://www.uniprot.org/uniprotkb/O00264" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.11697142", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Hpr6.6 protein mediates cell death from oxidative damage in MCF-7 human breast cancer cells.", "journal": "Journal of cellular biochemistry", "date": "2003", "authors": "Hand RA, Craven RJ", "reference": { "type": "PubMed", "id": "14523988", "url": "https://pubmed.ncbi.nlm.nih.gov/14523988" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O00264-1", "protein_name": "Membrane-associated progesterone receptor component 1", "gene_name": "PGRMC1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "O00264", "url": "https://www.uniprot.org/uniprotkb/O00264" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.14523988", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Identification of the PGRMC1 protein complex as the putative sigma-2 receptor binding site.", "journal": "Nat. Commun.", "date": "2011", "authors": "Xu Jinbin, Zeng Chenbo, Chu Wenhua, Pan Fenghui, Rothfuss Justin M, Zhang Fanjie, Tu Zhude, Zhou Dong, Zeng Dexing, Vangveravong Suwanna, Johnston Fabian, Spitzer Dirk, Chang Katherine C, Hotchkiss Richard S, Hawkins William G, Wheeler Kenneth T, Mach Robert H", "reference": { "type": "PubMed", "id": "21730960", "url": "https://pubmed.ncbi.nlm.nih.gov/21730960" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O00264-1", "protein_name": "Membrane-associated progesterone receptor component 1", "gene_name": "PGRMC1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "O00264", "url": "https://www.uniprot.org/uniprotkb/O00264" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.21730960", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "S2R(Pgrmc1): the cytochrome-related sigma-2 receptor that regulates lipid and drug metabolism and hormone signaling.", "journal": "Expert Opin. Drug Metab. Toxicol.", "date": "2012", "authors": "Ahmed Ikhlas S A, Chamberlain Cora, Craven Rolf J", "reference": { "type": "PubMed", "id": "22292588", "url": "https://pubmed.ncbi.nlm.nih.gov/22292588" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O00264-1", "protein_name": "Membrane-associated progesterone receptor component 1", "gene_name": "PGRMC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5BJF2-1", "protein_name": "Sigma intracellular receptor 2", "gene_name": "TMEM97", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99720-1", "protein_name": "Sigma non-opioid intracellular receptor 1", "gene_name": "SIGMAR1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "O00264", "url": "https://www.uniprot.org/uniprotkb/O00264" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.22292588", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Spectroscopic and mutagenesis studies of human PGRMC1.", "journal": "Biochemistry", "date": "2015-03-03", "authors": "Kaluka Daniel, Batabyal Dipanwita, Chiang Bing-Yu, Poulos Thomas L, Yeh Syun-Ru", "reference": { "type": "PubMed", "id": "25675345", "url": "https://pubmed.ncbi.nlm.nih.gov/25675345" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O00264-1", "protein_name": "Membrane-associated progesterone receptor component 1", "gene_name": "PGRMC1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "O00264", "url": "https://www.uniprot.org/uniprotkb/O00264" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.25675345", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "PGRMC1 regulation by phosphorylation: potential new insights in controlling biological activity", "journal": "Oncotarget", "date": "2016", "authors": "Cahill MA, Jazayeri JA, Kovacevic Z, Richardson DR", "reference": { "type": "PubMed", "id": "27448967", "url": "https://pubmed.ncbi.nlm.nih.gov/27448967" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O00264-1", "protein_name": "Membrane-associated progesterone receptor component 1", "gene_name": "PGRMC1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "O00264", "url": "https://www.uniprot.org/uniprotkb/O00264" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 113, "end_pos": 113, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O00264", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O00264" }, { "database": "PubMed", "id": "27448967", "url": "https://pubmed.ncbi.nlm.nih.gov/27448967" } ], "site_lbl": "Tyr113", "uniprot_canonical_ac": "O00264-1" } ], "record_id": "pubmed.27448967", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Sigma-2 receptor and progesterone receptor membrane component 1 (PGRMC1) are two different proteins: Proofs by fluorescent labeling and binding of sigma-2 receptor ligands to PGRMC1.", "journal": "Pharmacol. Res.", "date": "2017", "authors": "Pati Maria Laura, Groza Diana, Riganti Chiara, Kopecka Joanna, Niso Mauro, Berardi Francesco, Hager Sonja, Heffeter Petra, Hirai Miwa, Tsugawa Hitoshi, Kabe Yasuaki, Suematsu Makoto, Abate Carmen", "reference": { "type": "PubMed", "id": "28007569", "url": "https://pubmed.ncbi.nlm.nih.gov/28007569" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O00264-1", "protein_name": "Membrane-associated progesterone receptor component 1", "gene_name": "PGRMC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5BJF2-1", "protein_name": "Sigma intracellular receptor 2", "gene_name": "TMEM97", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "O00264", "url": "https://www.uniprot.org/uniprotkb/O00264" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.28007569", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Progesterone receptor membrane component 1 is phosphorylated upon progestin treatment in breast cancer cells.", "journal": "Oncotarget", "date": "2017", "authors": "Willibald M, Bayer G, Stahlhut V, Poschmann G, Stuhler K, Gierke B, Pawlak M, Seeger H, Mueck AO, Niederacher D, Fehm T, Neubauer H", "reference": { "type": "PubMed", "id": "29069804", "url": "https://pubmed.ncbi.nlm.nih.gov/29069804" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O00264-1", "protein_name": "Membrane-associated progesterone receptor component 1", "gene_name": "PGRMC1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "O00264", "url": "https://www.uniprot.org/uniprotkb/O00264" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 178, "end_pos": 178, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O00264", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O00264" }, { "database": "PubMed", "id": "17081983", "url": "https://pubmed.ncbi.nlm.nih.gov/17081983" }, { "database": "PubMed", "id": "18452278", "url": "https://pubmed.ncbi.nlm.nih.gov/18452278" }, { "database": "PubMed", "id": "18491316", "url": "https://pubmed.ncbi.nlm.nih.gov/18491316" }, { "database": "PubMed", "id": "18691976", "url": "https://pubmed.ncbi.nlm.nih.gov/18691976" }, { "database": "PubMed", "id": "18767875", "url": "https://pubmed.ncbi.nlm.nih.gov/18767875" }, { "database": "PubMed", "id": "19413330", "url": "https://pubmed.ncbi.nlm.nih.gov/19413330" }, { "database": "PubMed", "id": "20166139", "url": "https://pubmed.ncbi.nlm.nih.gov/20166139" }, { "database": "PubMed", "id": "29069804", "url": "https://pubmed.ncbi.nlm.nih.gov/29069804" } ], "site_lbl": "Thr178", "uniprot_canonical_ac": "O00264-1" }, { "start_pos": 180, "end_pos": 180, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O00264", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O00264" }, { "database": "PubMed", "id": "17081983", "url": "https://pubmed.ncbi.nlm.nih.gov/17081983" }, { "database": "PubMed", "id": "18452278", "url": "https://pubmed.ncbi.nlm.nih.gov/18452278" }, { "database": "PubMed", "id": "18669648", "url": "https://pubmed.ncbi.nlm.nih.gov/18669648" }, { "database": "PubMed", "id": "18691976", "url": "https://pubmed.ncbi.nlm.nih.gov/18691976" }, { "database": "PubMed", "id": "19651622", "url": "https://pubmed.ncbi.nlm.nih.gov/19651622" }, { "database": "PubMed", "id": "20068231", "url": "https://pubmed.ncbi.nlm.nih.gov/20068231" }, { "database": "PubMed", "id": "29069804", "url": "https://pubmed.ncbi.nlm.nih.gov/29069804" }, { "database": "PubMed", "id": "32245408", "url": "https://pubmed.ncbi.nlm.nih.gov/32245408" }, { "database": "PubMed", "id": "32293262", "url": "https://pubmed.ncbi.nlm.nih.gov/32293262" } ], "site_lbl": "Tyr180", "uniprot_canonical_ac": "O00264-1" }, { "start_pos": 181, "end_pos": 181, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "O00264", "url": "https://www.uniprot.org/uniprotkb/O00264" }, { "database": "PubMed", "id": "24275569", "url": "https://pubmed.ncbi.nlm.nih.gov/24275569" }, { "database": "PubMed", "id": "23186163", "url": "https://pubmed.ncbi.nlm.nih.gov/23186163" }, { "database": "PubMed", "id": "20068231", "url": "https://pubmed.ncbi.nlm.nih.gov/20068231" }, { "database": "PubMed", "id": "18669648", "url": "https://pubmed.ncbi.nlm.nih.gov/18669648" }, { "database": "PubMed", "id": "21406692", "url": "https://pubmed.ncbi.nlm.nih.gov/21406692" }, { "database": "iPTMnet", "id": "O00264", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O00264" }, { "database": "PubMed", "id": "15302935", "url": "https://pubmed.ncbi.nlm.nih.gov/15302935" }, { "database": "PubMed", "id": "16565220", "url": "https://pubmed.ncbi.nlm.nih.gov/16565220" }, { "database": "PubMed", "id": "17287340", "url": "https://pubmed.ncbi.nlm.nih.gov/17287340" }, { "database": "PubMed", "id": "17924679", "url": "https://pubmed.ncbi.nlm.nih.gov/17924679" }, { "database": "PubMed", "id": "18088087", "url": "https://pubmed.ncbi.nlm.nih.gov/18088087" }, { "database": "PubMed", "id": "18452278", "url": "https://pubmed.ncbi.nlm.nih.gov/18452278" }, { "database": "PubMed", "id": "18491316", "url": "https://pubmed.ncbi.nlm.nih.gov/18491316" }, { "database": "PubMed", "id": "18578522", "url": "https://pubmed.ncbi.nlm.nih.gov/18578522" }, { "database": "PubMed", "id": "18691976", "url": "https://pubmed.ncbi.nlm.nih.gov/18691976" }, { "database": "PubMed", "id": "18707149", "url": "https://pubmed.ncbi.nlm.nih.gov/18707149" }, { "database": "PubMed", "id": "18767875", "url": "https://pubmed.ncbi.nlm.nih.gov/18767875" }, { "database": "PubMed", "id": "19413330", "url": "https://pubmed.ncbi.nlm.nih.gov/19413330" }, { "database": "PubMed", "id": "19415658", "url": "https://pubmed.ncbi.nlm.nih.gov/19415658" }, { "database": "PubMed", "id": "19651622", "url": "https://pubmed.ncbi.nlm.nih.gov/19651622" }, { "database": "PubMed", "id": "20166139", "url": "https://pubmed.ncbi.nlm.nih.gov/20166139" }, { "database": "PubMed", "id": "29069804", "url": "https://pubmed.ncbi.nlm.nih.gov/29069804" }, { "database": "PubMed", "id": "35137666", "url": "https://pubmed.ncbi.nlm.nih.gov/35137666" } ], "site_lbl": "Ser181", "uniprot_canonical_ac": "O00264-1" }, { "start_pos": 54, "end_pos": 54, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "O00264", "url": "https://www.uniprot.org/uniprotkb/O00264" }, { "database": "PubMed", "id": "24275569", "url": "https://pubmed.ncbi.nlm.nih.gov/24275569" }, { "database": "PubMed", "id": "18691976", "url": "https://pubmed.ncbi.nlm.nih.gov/18691976" }, { "database": "iPTMnet", "id": "O00264", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O00264" }, { "database": "PubMed", "id": "17081983", "url": "https://pubmed.ncbi.nlm.nih.gov/17081983" }, { "database": "PubMed", "id": "18452278", "url": "https://pubmed.ncbi.nlm.nih.gov/18452278" }, { "database": "PubMed", "id": "18578522", "url": "https://pubmed.ncbi.nlm.nih.gov/18578522" }, { "database": "PubMed", "id": "18669648", "url": "https://pubmed.ncbi.nlm.nih.gov/18669648" }, { "database": "PubMed", "id": "19415658", "url": "https://pubmed.ncbi.nlm.nih.gov/19415658" }, { "database": "PubMed", "id": "19562805", "url": "https://pubmed.ncbi.nlm.nih.gov/19562805" }, { "database": "PubMed", "id": "19651622", "url": "https://pubmed.ncbi.nlm.nih.gov/19651622" }, { "database": "PubMed", "id": "20058876", "url": "https://pubmed.ncbi.nlm.nih.gov/20058876" }, { "database": "PubMed", "id": "20068231", "url": "https://pubmed.ncbi.nlm.nih.gov/20068231" }, { "database": "PubMed", "id": "20166139", "url": "https://pubmed.ncbi.nlm.nih.gov/20166139" }, { "database": "PubMed", "id": "29069804", "url": "https://pubmed.ncbi.nlm.nih.gov/29069804" } ], "site_lbl": "Ser54", "uniprot_canonical_ac": "O00264-1" }, { "start_pos": 57, "end_pos": 57, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "O00264", "url": "https://www.uniprot.org/uniprotkb/O00264" }, { "database": "PubMed", "id": "19367720", "url": "https://pubmed.ncbi.nlm.nih.gov/19367720" }, { "database": "PubMed", "id": "18691976", "url": "https://pubmed.ncbi.nlm.nih.gov/18691976" }, { "database": "PubMed", "id": "18669648", "url": "https://pubmed.ncbi.nlm.nih.gov/18669648" }, { "database": "PubMed", "id": "21406692", "url": "https://pubmed.ncbi.nlm.nih.gov/21406692" }, { "database": "PubMed", "id": "24275569", "url": "https://pubmed.ncbi.nlm.nih.gov/24275569" }, { "database": "PubMed", "id": "19690332", "url": "https://pubmed.ncbi.nlm.nih.gov/19690332" }, { "database": "PubMed", "id": "19369195", "url": "https://pubmed.ncbi.nlm.nih.gov/19369195" }, { "database": "PubMed", "id": "18318008", "url": "https://pubmed.ncbi.nlm.nih.gov/18318008" }, { "database": "PubMed", "id": "17081983", "url": "https://pubmed.ncbi.nlm.nih.gov/17081983" }, { "database": "PubMed", "id": "23186163", "url": "https://pubmed.ncbi.nlm.nih.gov/23186163" }, { "database": "PubMed", "id": "20068231", "url": "https://pubmed.ncbi.nlm.nih.gov/20068231" }, { "database": "iPTMnet", "id": "O00264", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O00264" }, { "database": "PubMed", "id": "15302935", "url": "https://pubmed.ncbi.nlm.nih.gov/15302935" }, { "database": "PubMed", "id": "17287340", "url": "https://pubmed.ncbi.nlm.nih.gov/17287340" }, { "database": "PubMed", "id": "18452278", "url": "https://pubmed.ncbi.nlm.nih.gov/18452278" }, { "database": "PubMed", "id": "18491316", "url": "https://pubmed.ncbi.nlm.nih.gov/18491316" }, { "database": "PubMed", "id": "18510355", "url": "https://pubmed.ncbi.nlm.nih.gov/18510355" }, { "database": "PubMed", "id": "18578522", "url": "https://pubmed.ncbi.nlm.nih.gov/18578522" }, { "database": "PubMed", "id": "18707149", "url": "https://pubmed.ncbi.nlm.nih.gov/18707149" }, { "database": "PubMed", "id": "18767875", "url": "https://pubmed.ncbi.nlm.nih.gov/18767875" }, { "database": "PubMed", "id": "19413330", "url": "https://pubmed.ncbi.nlm.nih.gov/19413330" }, { "database": "PubMed", "id": "19415658", "url": "https://pubmed.ncbi.nlm.nih.gov/19415658" }, { "database": "PubMed", "id": "19562805", "url": "https://pubmed.ncbi.nlm.nih.gov/19562805" }, { "database": "PubMed", "id": "19651622", "url": "https://pubmed.ncbi.nlm.nih.gov/19651622" }, { "database": "PubMed", "id": "19664994", "url": "https://pubmed.ncbi.nlm.nih.gov/19664994" }, { "database": "PubMed", "id": "20058876", "url": "https://pubmed.ncbi.nlm.nih.gov/20058876" }, { "database": "PubMed", "id": "20166139", "url": "https://pubmed.ncbi.nlm.nih.gov/20166139" }, { "database": "PubMed", "id": "20230923", "url": "https://pubmed.ncbi.nlm.nih.gov/20230923" }, { "database": "PubMed", "id": "29069804", "url": "https://pubmed.ncbi.nlm.nih.gov/29069804" } ], "site_lbl": "Ser57", "uniprot_canonical_ac": "O00264-1" } ], "record_id": "pubmed.29069804", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 5 }, { "field": "total_sites", "count": 5 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] } ]